Taivaan ilossa tavataan?

Taivaan ilossa tavataan, vai tavataanko? Minut on kutsuttu rakkauden juhliin, mutta koska Herra on ollut koko ajan hyvin hiljaa, ajattelin jättää nämä bileet väliin. Haitanneeko tuo, jos jätän osallistumatta tähän maailmanloppuun? Minulla on tärkeämpääkin tekemistä, kuin kuolla koronaan.

Kunpa Jeesus pian tulisi ja loppuisi tämän maailman kärsimys

Tällaisia COVID-19-epidemian herättämiä toiveita olen viimeaikoina lukenut suomalaisilla ja ulkomaisilla keskustelupalstoilla. Monet rakkaudesta ja armosta saarnaavat haaveilevat Jeesuksen toisesta tulemisesta, armollisesta maailmanlopusta ja synnit puhtaaksi polttavasta tulesta.

Minä sanon teille rakkauden apostoleille ja tuomiopäivän trumpetisteille, että vaikka pasuunat ja vasket soisivat kuinka kauniisti, ei meillä ole mikään kiire tuonpuoleiseen. Kyllä täällä on vielä niin paljon tehtävää, nähtävää ja opittavaa, että en kiireiltäni ehdi seuraavaan ylöstempaisuun.

Älkää huolestuko. Te pääsette sinne Taivaan iloon, kun maltatte vain mielenne. Kaikki kuolevat ennemmin tai myöhemmin. Kaikkien ei kuitenkaan tarvitse kuolla yhdessä rykäyksessä, vai tarvitseeko? Onko Jumalalla johonkin kiire? Koitetaan nyt vain jotenkin selvitä tästä pandemiasta.

Tuomiopäivän trumpetistit ja viimeisten päivien vihaiset pasunistit voivat Taivaan ilossa pohtia elämän ja kuoleman kysymyksiä stressaamatta maahanmuutosta, seksuaalisisten vähemmistöjen sänkyleikeistä tai muistakaan Iisebelin hirvityksistä.

Aika ei ole ongelma Paratiisissa. Taivaan riemussa on kokonainen ikuisuus aikaa miettiä, miksi rajallinen elämä on niin vaikeaa ja miksi iankaikkinen elämä on paljon helpompaa.

Kun te rakkauden apostolit viimeisenä päivänä saavutte kultaisten porttien kautta taivaan riemuun ja Paratiisin poikkipolulla avaatte hihitellen raskaan vaskisen kaivonkannen, joka johtaa syvyyteen ja pimeyteen, tuohon rikinkatkuiseen sielujen viemäriin, jossa me uskottomat hereetikot ja armosta piittaamattomat paskiaiset palamme kirkkaalla ja kivuliaalla liekillä aina ja iankaikkisesti syntejämme katuen, matojen vetistämin silmin armosta unelmoiden; kun te katsotte meitä ja näette, kuinka mädäntyvä iho riippuu riekaleina yllämme niin kuin revitty vaate ja sieraimissamme kiemurtelee myrkkykäärmeitä. Silloin te tiedätte, että Jumala on armo, oikeus ja rakkaus.

Minulle on ihan okei,jos te rallattelette kuorossa ylistystä Herralle ikuisuuden Tralalaa-mikä-mikä-maassa. Ei se minua haittaa. Minä haluan jättää sen reissun kuitenkin väliin.

Mutta onko Taivaan ilon ja Isän hylkääminen oikeudenmukainen peruste grillata miua ja muita ateisteja iankaikkisesti erilaisissa tulisissa järvissä ja padoissa samalla kun hampaitani revitään hitaasti irti, raajojani sahataan tylsillä sahoilla, läskistäni tehdään saippuaa ja ihoani leikellään saksilla? Tietenkin se on oikeudenmukaista, vaikka minusta se on hieman ylimitoitettua.

Tapasin taannoin Helvetin esikartanossa viisaan eksistentialistin, joka odotti tuomiota ateismista. Hän ihmetteli syvästi abrahamilaista tulkintaa armosta ja oikeudenmukaisuudesta. Työssään ja elämässään hän oli kokenut merkittävää uskonnollista härintää. Ikuisuutta oli kaupattu hänelle lupauksilla kauneudesta ja lihaksikkaasta kuumppanista paratiisissa. No minunkin mielestäni oli hieman hassua, että hän ei tarttunut syöttiin, vaan valitsi myrkkykäärmeet sieraimiinsa. No sellaistahan tämä elämä on.

Mutta mikä kiire sillä maailmanlopulla on, jos kaikki jumalattomat ja syntiset kuitenkin palavat iankaikkisesti. Ei mitään kiirettä. Päivä tänne, vuosi tuonne ja yksi elämä on vain kärpäsen kusema ikuisuudessa. Koitetaan kestää se.

Uskossaan vahvoja ja vanhurskaita COVID-19 ei tietenkään pelota niin kuin ateisteja, koska korona on Jumalan rangaistus homoille ja syntisille, mutta aivan erityisesti homoille.

Toistan: COVID-19 on Jumalan rangaistus, koska maailmassa on liikaa homoja ja vihervasemmistolaisia puunhalaajia, sossutätejä, feministejä ja ateisteja.

Jumala ei tykkää kommareista ja vihreistä tai kikattelevien tyttöjen hallituksista. Kaikki sen tietää! Ja Jumala vihaa myös Euroopan unionia ja katolista kirkkoa. COVID-19 on rangaistus Gayroopalle. Sen tietää Putinkin.

Pelastus on yhtä lähellä kuin lähin kirkko

Nyt kyllä viimeistään kannattaa pakkautua suurin joukoin kirkkoihin, temppeleihin ja moskeijoihin rukoilemaan pelastusta. Se voi olla ainoa toivomme. Ehtoollinen on taivaallinen idea. Muistakaa kosketella toisianne ja syökää pappien kädestä.

Tavataan sitten taivaan ilossa, jossa ei maalliset murheet paljon paina. Luojan kiitos, hopeavesi tappaa homovirukset ja pelastaa, jos ei muita, niin ainakin käärmeöljyjen kauppiaat ja evankelistat!

Israelilainen rabbi Meir Mazuz on julistanut koronaviruksen Jumalan rangaistukseksi homokulkueista. Heikompia on aina helppo vainota ja syyllistää. Kuvittelin, että juutalaiset rabbit osaisivat olla osoittelematta syyttävällä sormella vähemmistöjä. Ehkä eräät eivät enää muista.

Pahinta on se, että typerät massat seuraavat evankelistoja, rabbeja ja imaameja vaikka tuleen. Nyt odotetaan vain, että Päivin ja Lauran hengenheimolaiset alkavat lietsoa suomalaisia fanaatikkoja Jumalan homovastaiseen vihaan.

Järki käteen! Virukset eivät ole Jumalan rangaistus ja COVID-19 ei ole maailmanloppu. Suomessa patavanhoillisia herännäisiä on vain kourallinen, mutta viha leviää nopeammin kuin yksikään virus. Vihan lietsojia löytyy jokaisen kriisin yhteydessä, oli kriisin syy sitten tulehtunut hammas tai kikattelevien tyttöjen hallitus. Aina joku vihaa ja heittää bensaa vihan liekkeihin.

COVID-19 ei ole vitsi tai maailmanloppu

Epidemia on paholainen. Me emme voi antaa paholaisen piiloutua”, Xi Jinping, 28.1. Kiinan valtiollisen median mukaan

Yhdysvaltojen hallinnossa varautuminen pandemiaan on pelottavan heikolla tasolla. Trumpin hallinto lopetti vuonna 2018 asiantuntijoista koostuvan epidemioihin varautuvan erikoisryhmän rahoituksen. Tartuntatautiviraston (CDC) rahoitusta leikattiin seuraavana vuonna 80%.

Trump itse on kutsunut koronavirusepidemiaa demokraattien juoneksi ja viruksesta kertovia uutisia valeuutisiksi, joiden tarkoituksena on horjuttaa hänen valta-asemaansa. Päävastuu COVID-19-epidemiasta on Yhdysvalloissa siirretty tiedevastaiselle kristitylle, Mike Pencelle. Kädet ristiin. Nyt on hyvä aika rukoilla.

Eräät Trumpin lähipiiriin kuuluvat evankelistat julistavat blogeissaan ja vlogeissaan, että COVID-19 on Jumalan rangaistus aborteista ja homoseksistä. Joidenkin evankelistojen mukaan epidemia alkoi Kiinasta, koska Jumala vihaa kiinalaisia kommunisteja. Näiden evankelistojen mukaan amerikkalaisilla ei ole hätää, sillä Jumala suojelee kristittyjä amerikkalaisia.

Yhdysvalloissa kriisi voi kuitenkin kärjistyä vaarallisesti. Väestö on jakautunut hyvin rikkaisiin, hyvin toimentuleviin ja äärimmäisen köyhiin. Etniset ristiriidat, yhteiskunnan jakaantuminen, rikollisuus ja väkivalta ovat monin verroin suurempia ongelmia Yhdysvalloissa kuin Euroopassa.

Amerikkalainen lääketieteellinen osaaminen kuuluu maailman parhaimpiin, mutta se tarjoaa palveluita vain niille, joilla on riittävän kattava vakuutus tai rahaa. Kymmenillä miljoonilla amerikkalaisilla ei ole varaa edes edullisimpiin terveydenhoitopalveluihin tai välttämättömimpiin lääkkeisiin.

Washingtonin osavaltiossa koronavirustartuntojen määrä kaksinkertaistuu kuuden päivän välein. Tällä tahdilla sairastuneiden ja sairauteen kuolevien määrä kuusitoistakertaistuu seuraavan kuukauden sisällä. Kahdessa kuukaudessa potilaiden ja kuolleiden määrä 64-kertaistuu ja kolmessa kuukaudessa tuhatkertaistuu. Nämä ovat pelottavia lukuja.

Taannoin Kiinasta palannut amerikkalaismies tunsi olonsa flunssaiseksi, joten hän hakeutui sairaalaan Miamissa koronavirustestiä varten. Kaksi viikkoa myöhemmin vakuutusyhtiö muisti miestä 3270 dollarin laskulla. Kuinka moni köyhä amerikkalainen uskaltaa edes hakeutua testeihin?

Vuosittain sadat tuhannet amerikkalaista ajautuvat henkilökohtaiseen konkurssiin sairastumisen ja kalliiden terveydenhoitomenojen seurauksena.

”A new study from academic researchers found that 66.5 percent of all bankruptcies were tied to medical issues —either because of high costs for care or time out of work. An estimated 530,000 families turn to bankruptcy each year because of medical issues and bills, the research found.”

Erään tilastollisen analyysin mukaan COVID-19 voi tappaa Yhdysvalloissa jopa 2,5 miljoonaa ihmistä tulevien viikkojen ja kuukausien aikana. University College Londonin professori Mark Handley varoitti, että Italian tilanne toistuu muissakin maissa, mutta 9-14 päivän viiveellä.

”By March 1, 2020, between 1,043 and 9,484 people in the U.S. may have already been infected by the COVID-19 coronavirus, far more than the number that had been publicly reported, according to a new Cedars-Sinai study.”

21. helmikuuta Italiassa oli 3 varmistettua koronavirustapausta. Nyt sairastuneita on jo yli 10 000. Italiassa tauti tappaa päivittäin jo 100-200 henkilöä. Koko maa on asetettu karanteeniin. Tämän hirvittävän tragedian kaikkia taloudellisia ja inhimillisiä kärsimyksiä on mahdotonta arvioida.

Italian talous on horjunut jo vuosia. Entä, jos COVID-19 taittaa kamelin niskan, ja Italian talous romahtaa? Romahduksen seurannaisvaikutukset aiheuttaisivat taloudellisen tsunamin Euroopassa. Dominoefekti kaataisi monta korttitaloa.

Koronavirus on levinnyt lähes koko maailmaan.

Suomessa varautuminen on virallisten tietojen mukaan hyvällä tasolla, mutta edes johtavat lääkärit eivät oikein usko näihin väitteisiin. Edessä on pelottavan suurella todennäköisyydellä verta, hikeä, tuskaa ja vielä enemmän tuskaa. Jokainen meistä voi menettää jotain. Siihen kannattaa varautua.

EU varautuu pahimpaan ja on syytäkin


“I just talked to Giuseppe Conte [Italian prime minister] about the extraordinary situation Italy is facing & prepare the videoconference with European Council members this afternoon. Our duty is to strengthen an European Union coordinated approach. We are with all those affected by COVID-19″ . Charles Michel, President – European Council, 10 March 2020

70. päivä

Britannian terveysministeri Nadine Dorries ilmoitti sairastuneensa. Aiemmin muun muassa Ranskan kulttuuriministeri Franck Riester ja Italian demokraattipuolueen pääsihteeri Nicola Zingaretti ovat vahvistaneet saaneensa tartunnan.

Tauti on levinnyt myös Turkkiin. Tilanne on uhkaava. 3,6 miljoonan syyrialaisen pakolaisen ja horjuvan talouden vuoksi Turkin valmiudet sairastuneiden hoitoon ja koronavirusepidemian leviämisen taltuttamiseen ovat vähintäänkin puutteelliset.

Jos/ja kun koronavirus leviää pakolaisleireille, edessä on sodasta kärsineiden ja kotinsa menettäneille pakolaisille maanpäällinen helvetti. Ja me luulimme että pakolaisleirit ovat jo nyt helvetillisiä. Kuka heitä pystyy auttamaan? Luultavasti ei kukaan. Jos saisin toivoa, että jotain hyvää seuraisi tästä epidemiasta, niin toivon, että epidemia päättäisi Syyrian sisällissodan.

Italia

Väestöön suhteutettuna COVID-19-epidemia on pahimmillaan Italiassa. Päivittäin yli 100 sairastunutta menehtyy ja 1000 ihmistä sairastuu. Saksan tämänhetkinen tilanne muistuttaa tilannetta, joka Italiassa oli kaksi viikkoa sitten.

Epidemia on pakottanut Italian turvautumaan erittäin ankariin rajoituksiin. Mitään tällaista ei ole koettu rauhan aikana Euroopassa. Valitettavasti vain ankarat rajoitukset voivat estää taudin leviämisen ja pelastaa ihmishenkiä.

Lombardian tilanne on kaikkein kurjin. Lombardia on yksi Euroopan rikkaimpia alueita, joten raha ei takaa turvallisuutta. Osa sairaaloista toimii kaksinkertaisella teholla normaaliin nähden. Sairaalapaikoista, lääkäreistä ja hoitohenkilökunnasta on huutava pula.

Ihmisten taloudellisen hädän vuoksi asuntovelkojen lyhennyksiin ja verojen maksuun suunnitellaan lykkäyksiä. Se vaarantaa valtiontalouden ja johtaa todennäköisesti alijäämäisen budjetin kompensoimiseen uudella velalla.

Italia on EU:n neljänneksi suurin talous ja sen velkaantuminen on jo nyt yli 130 % suhteessa bruttokansantuotteeseen. Italian ajautuminen maksukyvyttömäksi samaan tapaan kuin Kreikka 2008,.. No en halua edes ajatella, mitä siitä seuraisi.

EU reagoi tähän kriisiin mielestäni hyvin

EU vapauttaa heti 7,5 miljardia hätärahoitusta koronaviruksen aiheuttamien talousiskujen korjaamiseen. EU-maat yhdistävät voimansa koronaviruksen torjumiseksi.

Komissio kokoaa virologeista ja muista asiantuntijoista ryhmän, joka laatii strategian viruksen leviämisen estämiseksi.

Tutkimukseen ja rokotteen kehittämiseen ohjataan 140 miljoonaa euroa. Komissio myös inventoi olemassaolevat resurssit lääke- ja hoitotarvikkeista EU:n laajuisesti, jotta tiedetään mitä on saatavilla ja mitä tarvitaan.

Euroopan unionin talous turvataan keinolla millä hyvänsä. Komission puheenjohtaja Ursula von der Leyden lupasi, että jäsenmaat saavat tukea taloudellisesti epidemian heikentämiä yrityksiä. Kasvu- ja vakaussopimuksen annetaan joustaa.

Erityisen tärkeää on, että komissio perustaa Korona-sijoitusrahaston, johon kootaan 25 miljardia euroa. Rahastosta voidaan ohjata apua terveydenhuoltoalalle, pienille ja keskisuurille yrityksille ja työmarkkinoille.

”Puhelinkokousta johtanut Eurooppa-neuvoston puheenjohtaja Charles Michel sanoi kokouksen jälkeen, että kaikkein tärkeintä on rajata virus ja huolehtia ihmisten terveydestä.

Viime viikon perjantaina terveysministerien ylimääräisessä kokouksessa kävi ilmi, että useampi jäsenmaa ei ole varautunut pandemian kaltaisen taudin torjuntaan eikä hoitoon. Myös Suomen valmiuksia on epäilty.

Lääkkeitä ja sairaalatarvikkeita kuten kasvosuojia ja respiraattoreita pyritään hankkimaan komission johdolla yhteishankintoina. Yhtälailla jäsenmaat pyrkivät nyt kohti yhtenäisiä ohjeita viruksen taltuttamiseksi.”

EU:lla on nyt mahdollisuus todistaa epäilijöille, että yhteistoiminta tekee meistä vahvempia. Toivon todella näin.

Ja tsemppiä kaikille. Pysykää terveinä, ottakaa iisisti ja pitäkää läheisistä huolta. On mahdollista, että Suomi ja suuri osa maailmaa menee tulevien viikkojen aikana kiinni.

COVID-19 tulee vaikuttamaan kaikkien meidän elämään tavalla tai toisella vaikka emme sairastuisikaan…

COVID-19 on äärimmäisen vakava uhka koko maailmalle ja todennäköisesti sen seuraukset muuttavat maailmaa ja vaikuttavat elämäämme vielä vuosien päästä.

”The mortality rate of this virus is 41 in 4,000 cases, or about 1%. Doesn’t sound like a lot, right?

By way of comparison, the mortality rate of influenza A is 0.1%, hepatitis A is 0.3%, anthrax is 0.6%, smallpox is 3.0%, and Lassa fever is 1.1%.

So we’re talking about a virus with comparable mortality to smallpox and Lassa fever, that’s easily transmitted (it has an R0 of somewhere between 1.4 and 2.5, meaning each infected person can be expected to transmit it to 2–4 others). By way of comparison, the R0 of influenza is 1.4 to 1.6, and Ebola is 1.5 to 2.0. It’s as lethal as smallpox and spreads as fast as or faster than Ebola.”

Tämä oli tämmöinen näkökulma. Pyydän anteeksi sarkasmiani, mutta toivon todella, että uskonnolliset ääriajatukset eivät ohjaa tämän pandemian selvittämistä.




Makeuttajat: sukraloosi ja aspartaami

Sukraloosin ja hiilihydraattien yhdistäminen voi heikentää insuliiniherkkyyttä ja altistaa aineenvaihdunnan häiriöille, kuten lihomiselle ja insuliiniresistenssille.

Ei ole helppoa, jos makeanhimo yllättää. Lisätyn sokerin riskit tunnetaan vanhastaan hyvin. Medical News Today uutisoi Yalen yliopiston tutkimuksesta, jonka mukaan sukraloosin (keinotekoinen makeutusaine) syöminen yhdessä hiilihydraattien kanssa muuttaa ihmisen makean aistimusta ja heikentää solujen insuliiniherkkyyttä. Tämä voi kasvattaa insuliiniresistenssin ja siihen assosioituvien sairauksien riskiä.

Onko sukraloosilla tai aspartaamilla makeutettu Cokis, burgeri ja ranskalaiset pikatie diabetekseen?

Makuaisti ja makean maistaminen kiihdyttävät insuliinin eritystä. Insuliini ohjaa energia-aineenvaihduntaa. Solujen insuliiniherkkyyden häiriöt voivat aiheuttaa insuliiniresistenssia.

Yalen yliopiston tutkijat tekivät yllättävän havainnon

Cell Metabolism julkaisi Yalen yliopiston tutkijoiden tutkimuspaperin, jonka tulokset viittaavat siihen, että keinotekoisten makeutusaineiden syöminen samaan aikaan hiilihydraattien kanssa heikentää terveiden aikuisten insuliiniherkkyyttä.



Sukraloosi ja hiilihydraatit: huono yhdistelmä?

Pienimuotoiseen tutkimukseen rekrytoitiin 45 tervettä 20-45 vuotiasta aikuista, jotka eivät normaalisti käyttäneet keinotekoisia makeutusaineita.

Tutkimukseen osallistuneilta ei edellytetty erityisiä ruokavalion muutoksia. Heille tarjottiin tutkimuksen yhteydessä seitsemän hedelmänmakuista virvoitusjuomaa. Osa juomista oli makeutettu sokerilla ja osa sukraloosilla, eli keinotekoisella makeutusaineella.

Sukraloosi

Sukraloosi on 600-650 kertaa tavallista sokeria makeampi keinotekoinen makeutusaine. Sukraloosia käytetään runsaasti elintarvikkeissa, kuten juomissa ja leivonnaisissa, sillä sen maku muistuttaa tavallista sokeria.

Sukraloosin etuna aspartaamiin verrattuna on hyvä lämpökestävyys ja säilyvyys. Sukraloosi valmistetaan sakkaroosia klooraamalla, jolloin sakkaroosin kolme hydroksyyliryhmää korvataan klooriatomeilla.

Sukraloosi keksittiin vuonna 1976 uuden hyönteismyrkyn kehittämisen yhteydessä Tate & Lyle Corporationin ja Queen Elizabeth College University of Londonin yhteistyönä. Tämä tapahtui sattumalta, kun kiinalainen opiskelija ymmärsi ohjeet väärin ja testaamisen (test) sijaan maistoi kemikaalia (taste).

Sukraloosia on tutkittu useilla eläin- ja ihmiskokeilla. Ihmiskokeissa havaittiin, että 11–27 % sukraloosista imeytyy, mutta 70–80 % poistuu kuitenkin muuttumattomana virtsaan. Noin 5 % sukraloosista hajoaa elimistössä kahdeksi monosakkaridiksi.

Ihmiskokeissa sukraloosilla ei havaittu kielteisiä terveysvaikutuksia, ja muun muassa Euroopan komission tieteellinen komitea on katsonut aineen turvalliseksi. Eräissä eläinkokeissa erittäin suurten annosten (2000 mg/kg) havaittiin aiheuttavan DNA-vaurioita hiirissä. Vielä suurempien annosten (3000 mg/kg) on havaittu kutistavan rottien kateenkorvaa. Sukraloosin on myös havaittu joissakin tapauksissa laukaisevan migreeniä.

Tutkimus

Osa koehenkilöistä sai sukraloosilla makeutettua juomaa, johon oli lisätty maltodekstriiniä (hiilihydraatti). Tähän turvauduttiin, koska näin oli helppo säädellä juoman kaloripitoisuutta tekemättä juomasta yhtään makeampaa. Koe kesti kaksi viikkoa.

Tutkittaville tehtiin erilaisia mittauksia, kuten MRI (aivojen magneettikuvaus) ennen koetta, kokeen aikana ja kokeen jälkeen.

Mittausten avulla tutkijat pystyivät arvioimaan erilaisten makuärsykkeiden aiheuttamat muutokset aivojen toiminnassa. Tutkittavien aivojen vastetta makeaan, happamaan ja suolaiseen, ja makuaistin sekä insuliiniherkkyyden tapahtumia seurattiin.

Analysoidessaan tutkimuksessa koottua aineistoa tutkijat löysivät kerätystä datasta yllättäviä poikkeamia. Havainnot koskivat sukraloosia ja maltodekstriiniä saanutta kontrolliryhmää. Tässä ryhmässä havaittiin aivojen muuttuneita vasteita makeaan, insuliiniherkkyyden heikentymistä ja muutoksia glukoosin metaboliassa.

Havaintojen paikkansapitävyyden varmistamiseksi tutkijat jatkoivat koetta siten, että uudelle ryhmälle annettiin joko sukraloosilla tai maltodekstriinillä makeutettuja juomia seitsemän päivän ajan. Näin varmistettiin, että sukraloosi tai maltodekstriini ei yksin selittänyt kokeessa havaittuja muutoksia.

Mitä tapahtui?

Miksi sukraloosi-hiilihydraatti-yhdistelmä muutti kokeeseen osallistuneiden makeuden aistimista ja insuliiniherkkyyttä? Tähän ei osata varmasti vielä vastata, mutta tutkijoilla on joitain ideoita syystä.

Vaikutus johtui mahdollisesti siitä, että ravinnon sisältämä energia tulkittiin väärin, jolloin aivojen saama kemiallinen viesti saadun energian määrästä oli virheellinen. Solut ovat herkkiä sukraloosille ja maltodekstriinille. Makuaisti tulkitsee makean ravinnoksi, joka sisältää energiaa. Aivoille välittyy sukraloosin ja maltodekstriinin yhteisvaikutuksesta kemiallinen signaali, että elimistö on saanut energiaa.

Maltodekstriini sisältää energiaa, mutta sukraloosi ei. Näiden yhteisvaikutuksen elimistö tulkitsee siten, että käytettävissä olisi todelliseen energianmäärään nähden kaksinkertainen määrä energiaa. Ajan mittaan keho oppii, että näin ei ole, ja metabolinen vaste makeaan muuttuu.

Aiemmat havainnot

Tutkimuksessa viitataan myös aikaisemmin jyrsijöillä tehtyihin tutkimuksiin, jotka antoivat samankaltaisia tuloksia. Näissä kokeissa rotille syötettiin makeuttamatonta jogurttia tai keinotekoisilla makeutusaineilla makeutettua jogurttia. Tulokset olivat verrannollisia Yalen yliopiston tutkimuksen tulosten kanssa.

Aikaisemmat tutkimukset rotilla osoittivat, että muutokset makean aistimisessa ohjaavat aineenvaihduntaa virheelliseen suuntaan, mikä voi altistaa aineenvaihduntahäiriöille ja lihomiselle.

Keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmä tulkitaan elimistössä virheellisesti suuremmaksi energiakuormaksi kuin se on.

Tutkimuksen tulosten perusteella dieetti-Colan juominen satunnaisesti on ihan okei, mutta runsaasti hiilihydraatteja sisältävän ruoan, kuten ranskalaisten perunoiden kanssa on parempi valita normaali Cola tai jokin muu juoma, kuten vesi.

Makeutusaineilla makeutetut virvokkeet ja runsashiilihydraattiset ruoat eivät tutkimusten perusteella sovi yhteen. Tutkijat suunnittelevat tutkimukselle jatkoa, jossa selvitetään, onko muiden keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmillä vastaavia insuliinisensitiivisyyttä heikentäviä vaikutuksia. Tarkoituksena on lisäksi tehdä vertaileva tutkimus stevian ja hiilihydraattien yhteisvaikutuksesta.


Onko aspartaamilla sivuvaikutuksia?

Aspartaami on sukraloosin ohella tunnetuin keinotekoinen ja vähäkalorinen makeutusaine. Aspartaami on eräs suosituimmista sokerin korvikkeista vähäkalorisissa ruoissa ja juomissa, sekä monissa lääkkeissä.

Yhdysvalloissa aspartaamia myydään tuotenimillä Nutrasweet ja Equal. Laajasta käytöstä ja suosiosta huolimatta aspartaami herättää yhä ristiriitoja ja kiistoja mm. terveysvaikutuksista. Useissa tutkimuksissa väitetään, että makeutusaineella on haitallisia sivuvaikutuksia.

Onko aspartaami turvallista?

Yhdysvalloissa FDA (Food and Drug Administration) hyväksyi aspartaamin elintarvikekäyttöön vuonna 1981. Aspartaamin käyttö elintarvikkeissa on hyväksytty EU:ssa, Kanadassa ja monissa muissa valtioissa. Seuraavat kansainväliset järjestöt hyväksyvät aspartaamin elintarvikekäytön:

  • World Health Organization
  • United Nations Food and Agriculture Organization
  • American Heart Association
  • American Dietetic Association

Vuonna 2013 Euroopan ruokaturvallisuudesta vastaava virasto (EFSA) analysoi satoja aspartaamia käsitteleviä tutkimuksia.

Analyysin perusteella EFSA arvioi, että aspartaamin käyttö ravinnossa on turvallista. EFSA asetti päivittäisen saannin ylärajaksi suosituksen 40 milligrammaa / painokilo.

EFSAn turvallisena saantina pidetty määrä on 10 mg vähemmän kuin FDA:n turvallisena pitämä määrä. Tällä ei sinänsä ole merkitystä, koska ylärajat ovat molemmissa tapauksissa normaalin käytön kannalta hyvin korkealla. Esimerkiksi normaali virvoitusjuoma sisältää noin 190 mg aspartaamia. Päivittäisen ylärajan saavuttamiseksi pitäisi juoda 19-20 aspartaamilla makeutettua virvoitusjuomaa.

Aspartaamin vaikutus painoon

Aspartaamissa on energiaa 4 kcal grammassa samoin kuin sokerissa, mutta aspartaami on 200 kertaa makeampaa kuin sokeri. 1:200 osa aspartaamia ajaa saman asian kuin gramma sokeria. Vähäkalorisilla makeutusaineilla makeutettuja elintarvikkeita suositaan lähinnä painonhallinnan vuoksi.

Tutkimuskatsaus viimeisimmistä tutkimuksista (2017 review) ei löytänyt todisteita siitä, että vähäkaloriset makeutusaineet, kuten aspartaami, sukraloosi ja steviosidi auttaisivat painon hallinnassa.

Eräät katsauksen tutkimuksista seurasivat tutkittavien elämäntapoja useiden vuosien ajan. Keinotekoisten makeutusaineiden säännöllinen käyttö assosioitui tutkimuksissa ylipainoon, lihavuuteen ja suurempaan vyötärönympärykseen.

Huolestuttavinta makeutusaineiden säännöllisessä saannissa on se, että vuoden 2017 tutkimuskatsaus havaitsi yhteyden säännöllisen makeutusaineiden saannin, sydäntautien, diabeteksen ja halvausten välillä.

Aspartaamin aikutukset ruokahaluun

Havaintojen perusteella keinotekoiset makeutusaineet lisäävät ruokahalua. Lisääntyneen ruokahalun arvellaan selittävän sitä, että kalorittomat ja vähäkaloriset makeutusaineet ovat yhteydessä lihomiseen.

Vuonna 2013 Trends in Endocrinology and Metabolism julkaisi tutkimuskatsauksen (2013 review), joka viittaa useisiin eläimillä tehtyihin tutkimuksiin. Säännöllinen kalorittomien tai vähän kaloreita sisältävän makeutusaineen saanti lisäsi näiden tutkimusraporttien mukaan eläinten ruokahalua ja painoa.

Katsauksessa arvellaan, että keinotekoiset makeutusaineet häiritsevät kehon ja aivojen välistä normaalia viestintää, jonka pitäisi kertoa aivoille, kun elimistö on saanut riittävästi runsasenergistä ravintoa. Elimistö viestii nälästä greliinin, ja kylläisyydestä leptiinin välityksellä. Näiden hormonien toiminnan sekoittaminen johtaa helposti lihomiseen.

Makean aistiminen signaloi suolistolle, että suolistoon on tulossa ravintoa. Keho odottaa saavansa energiaa ja valmistautuu siihen. Makuaisti tunnistaa myös makeutusaineiden makeuden, jolloin elimistö valmistautuu vastaanottamaan runsaasti ihania ja ravitsevia sokereita. Niitä ei kuitenkaan ole luvassa, sillä makeutusaineet eivät sisällä energiaa.

Hypoteesin mukaan säännöllinen keinotekoisten makeutusaineiden syöminen sekoittaa kehon nälästä ja kylläisyydestä kertovaa viestintää. Kun elimistö tottuu tähän, se ei enää reagoi oikeasti korkeakalorisiin ruokiin oikealla tavalla. Tämä voi vaikuttaa kylläisyyshormoni (leptiinin) toimintaan vaikuttamalla esimerkiksi leptiiniresistenssin kehittymiseen, jolloin ihminen ei koe tulevansa kylläiseksi, vaikka söisi riittävästi.

Vaikutukset aineenvaihduntaan

Sama prosessi, joka häiritsee elimistön energiatilasta kertovaa hormonaalista viestintää, voi lisätä insuliiniresistenssin ja tyypin 2 diabeteksen riskiä.

Keho oppii vähitellen, että makea ei tarkoita energiansaantia. Jos ihminen sitten syö sokeripitoista ravintoa, suolisto ja aineenvaihdunta ei reagoi enää sokeriin toivotulla tavalla.

Vuoden 2016 tutkimuskatsauksessa havaittiin, että keinotekoiset makeutusaineet ovat myrkkyä suoliston mikrobiomille. Keinotekoiset makeutusaineet järkyttävät suolistoflooran tasapainoa ja vähentävät mikrobiomin monimuotoisuutta.

Suolistoflooran lajikirjon heikkeneminen on myös yhteydessä lihomiseen. Esimerkiksi identtisillä kaksosilla, jotka syövät lähes identtisesti, toinen voi olla lihava ja toinen hoikka. Tämä selittyy suoliston mikrobiomin hyvinvoinnilla. Terve ja lajistoltaan runsaampi mikrobiomi vaikuttaa immuunijärjestelmän ohella myös aineenvaihduntaa tehostavasti. Mikrobilajistoltaan köyhempi suolistofloora assosioituu lihomiseen.

Eläinkokeissa on osoitettu, että tällaiset energia-aineenvaihdunnan häiriöt voivat johtaa glukoosi-intoleranssiin, joka on tyypin 2 diabeteksen riskitekijä.Vuodesta 2016 tehdyssä tutkimuksessa tutkittiin tiettyjen sokereiden ja makeutusaineiden vaikutuksia ihmisten sokerin sietokykyyn.

Lihavilla havaittiin yhteys aspartaamin saannin ja glukoosi-intoleranssin välillä. Mikään testatuista sokereista ja makeutusaineista ei kuitenkaan vaikuttanut kielteisesti normaalipainoisen ihmisen terveyteen.

Tutkimusten perusteella voidaan todeta, että säännöllinen aspartaamin saanti voi kasvattaa glukoosi-intoleranssin riskiä etenkin lihavilla.


Liittyykö aspartaamiin muita riskejä?

Viimeisten vuosikymmenten aikana aspartaamin on väitetty aiheuttavan ainakin:

  • Päänsärkyä
  • Huimausta
  • Kohtauksia
  • Masennusta
  • ADHD:ta
  • Alzheimerin tautia
  • Multippeliskleroosia (MS)
  • Syöpää
  • Lupusta
  • synnynnäisiä epämuodostumia

Ttutkimusaineistoa tai todisteita aspartaamin yhteydestä ylläoleviin sairauksiin ei ole olemassa. Nuo ovat enemmänkin urbaaneja legendoja.

Minä sairastan multippeliskleroosia, mutta en ole syönyt tai juonut juuri lainkaan aspartaamilla makeutettuja ruokia tai juomia. En usko aspartaamin aiheuttavan MS-tautia.Päänsärkyä paitsi aspartaamin yhteys ylläoleviin sairauksiin tuntuu epäuskottavalta.

Yhteenveto

Aspartaamin ympärillä kiehuu jatkuvasti, vaikka tutkimukset eivät anna aihetta ylettömälle paniikille.

Tuoreimpin tutkimusten mukaan aspartaamin pitkäaikainen säännöllinen käyttö voi aiheuttaa lihomista. On vain hyvin hataraa näyttöä siitä, että aspartaamista olisi haittaa terveille ja normaalipainoisille. Ylipainoisten ja lihavien kohdalla aspartaamin korrelaatio metaboliseen oireyhtymään ja tyypin 2 diabetekseen on osoitettu.




Ketogeeninen ruokavalio ja terveys

Korkea verenpaine on huonojen ravitsemustottumusten jälkeen toiseksi yleisin sairastumisen riskiä lisäävä tekijä, kertoo David J. Unwin (lue tutkimus tästä). Unwin on vuoden 2012 jälkeen hoitanut lihavia, korkeaa verenpainetta ja aikuistyypin diabetesta sairastavia potilaita ketogeenisellä ruokavaliolla. Tulokset ovat olleet hyviä.  Ketogeeninen ruokavalio ja terveys on laaja katsaus ketoilun positiivisiin terveysvaikutuksiin.

Kymmenet lääkärit ympäri maailman suosittelevat ketogeenistä ruokavaliota laihduttamiseen ja kardiometabolisten sairauksien hoitoon.

Uuden ravitsemusmallin omaksumisen vaikeus on siinä, että kasvavasta tutkimusnäytöstä ja parantuneista potilaista huolimatta ketogeeninen ruokavalio ei sovi nykyisiin ravitsemusmalleihin. Se haastaa vuosikymmeniä vallalla olleet ravitsemusopit ja lääketieteen paradigmat.

Ketogeeninen ruokavalio olettaa, että tyydyttyneisiin rasvoihin perustuva energiansaanti laihduttaa ja pitää kehon terveenä. Se sotii kaikkea oppimaamme vastaan.

Tieteen itseään korjaava periaate sopii huonosti ravitsemustieteen institutionalisoituihin dogmeihin. Jos tutkimukset antavat tuloksia, jotka eivät tue vallalla olevia käsityksiä, vanhoja oppeja pitää korjata vastaamaan uusia havaintoja.

Onko ketoilu vaarallista, koska siinä syödään paljon rasvaa?

Oppi rasvojen terveyshaitoista on rakennettu tieteellisesti hataralle perustalle. Rasvojen yhteys sydän- ja verisuonitauteihin on tieteellisesti kyseenalaistettu, mutta tämän paradigman asema ravitsemustieteessä on horjumaton.

Laajan kohorttitutkimusten meta-analyysin mukaan tyydyttyneet rasvat eivät lisää sydän- ja verisuonitautien riskiä.

” This current meta-analysis of cohort studies suggested that total fat, SFA, MUFA, and PUFA intake were not associated with the risk of cardiovascular disease. However, we found that higher TFA intake is associated with greater risk of CVDs in a dose-response fashion. Furthermore, the subgroup analysis found a cardio-protective effect of PUFA in studies followed up for more than 10 years.” Lue meta-analyysi tästä!

Olen laihtunut ketogeenisellä ruokavaliolla kolmessa kuukaudessa 9-10 kiloa. Ruokavalioni perusravinne on rasva, jota syön valtavasti virallisiin saantisuosituksiin nähden.  Verensokerini on hyvä 4,5-5,5. Verenpaineet ovat keskimäärin 135/85/80 -tasolla, mutta vaihteluväli on +/-10 suuntaansa.

Laihtuminen on ollut käsittämättömän helppoa, ja oloni on säilynyt koko ajan energisenä. Tältä osin uskallan suositella ruokavaliota muillekin. Tässä esiin tulevat lääketieteelliset havainnot ja väitteet perustuvat useisiin lähteisiin, joihin viittaan tekstissä ja tekstin jälkeen.

Kardiometabolinen syndrooma (CMS)

Kardiometaboliseen syndroomaan (CMS) sisältyy joukko aineenvaihduntaan, verenkiertoon ja munuaisiin assosioituvia häiriöitä. Yhteisiä nimittäjiä kardiometabolisille sairauksille ovat viskeraalinen rasva, keskivartalolihavuus ja insuliiniresistenssi.

Keskivartalolihavuuteen liittyy usein insuliinin heikompi vaikutus ääreiskudoksissa ja/tai seerumin korkea insuliinipitoisuus.

CMS:n oireisiin kuuluvat mm. korkea verenpaine, poikkeavuudet verenpaineen ja sykkeen vuorokausivaihtelussa, diabetekseen viittaavat rasva- ja sokeriaineenvaihdunnan muutokset, aikuistyypin diabetes, alkoholista riippumaton rasvamaksa, lisääntynyt verenhyytymistaipumus, kihti sekä sydän- ja verenkiertoelinten lisääntynyt tulehdusriski.

Epidemiologisissa tutkimuksissa on havaittu, että kardiometabolinen oireyhtymä kasvattaa sepelvaltimotauti-, aivohalvaus-, sydän- ja verisuonitautikuolleisuus- ja kokonaiskuolleisuus-riskejä.

Rohkeimpien lääkäreiden ja ketogeenisen ruokavalion puolestapuhujien, kuten Joseph R. Kraftin ja Ted Naimanin mukaan useimmat sydän- ja verisuonitaudit assosioituvat diagnosoituun tai diagnosoimattomaan diabetekseen. Tämä näkemys sopii hyvin havaintoon, että diabeetikoiden sydän- ja verisuonitautikuolleisuus on hyvin korkea.

Diabeteksen laboratoriodiagnoosin kehitykseen 1970-luvulla osallistuneen tri Joseph R. Kraftin mukaan hyperinsulinemia liittyy vahvasti verenpainetaudin, lihavuuden, ateroskleroosin, neurodegeneratiivisten sairauksien (Parkinsonin tauti, Alzheimerin tauti), eräiden syöpien ja verisuonitautien kehittymiseen.

Kardiometabolinen oireyhtymä ja kardiometaboliset sairaudet yleistyvät vauhdilla. Kraft varoitti diabetesepidemiasta ja hyperinsulinemiaan assosioituvista sairauksista jo 1970-luvulla.

Yhteinen nimittäjä kardiometabolisille sairauksille on samanaikainen insuliiniresistenssin aiheuttama hyperinsulinemia. Paikallinen insuliiniresistenssi ei yksistään yleensä aiheuta sairauksia, sillä aineenvaihdunta turvautuu siihen joskus tarkoituksella. Insuliiniresistenssi ja korkeat insuliinitasot yhdessä ovat vakava uhka terveydelle.

Lihavien prosentuaalinen osuus väestöstä Euroopassa

Synkkiä lukuja

Monet sairastuvat, vaikka he liikkuvat ja noudattavat yleisiä ravitsemussuosituksia. Länsimaissa on maailman paras sairaanhoitojärjestelmä, mutta samanaikaisesti todella sairas väestö.

Ylipainoisten ja lihavien määrä on Maailman terveysjärjestön (WHO) mukaan kolminkertaistunut vuoden 1975 jälkeen.

Kiinassa lihavia on 5-6 prosenttia väestöstä, mutta suurissa kiinalaiskaupungeissa, joissa syödään eniten pikaruokaa, lihavien osuus on lyhyessä ajassa kasvanut yli 20 prosenttiin; ylipainoisten ja lihavien kiinalaisten määrä on vain 10 viime vuoden aikana kolminkertaistunut. Keskivartalolihavien kiinalaisten määrä on samana aikana lisääntynyt 50 prosenttia.

Amerikkalaisista 35,4 prosenttia on lihavia, 61,5 % vyötärölihavia. Noin 100 miljoonaa amerikkalaista sairastaa tyypin 2 diabetesta tai esidiabetesta. Euroopan unionin alueella 30-70 % ihmisistä on jo ylipainoisia ja 10-30 % lihavia. EU:ssa lähes 30 miljoonaa ihmistä sairastaa diabetesta. Koko Euroopan (56 valtiota) alueella diabetesta sairastaa noin 60 miljoonaa ihmistä.

Diabetes

Aikuistyypin diabetesta sairastavien määrä on kasvanut noin 108 miljoonasta (1980) 422 miljoonaan (2014). Prosentuaalisesti maailman väestössä diabeteksen esiintyvyys on kasvanut 4,3 prosentista 8,8 prosenttiin neljässä vuosikymmenessä. Kasvun uskotaan jatkuvan. Nykyisen trendin perusteella vuonna 2045 joka kymmenes maailman ihminen sairastaa diabetesta.

Diabetesta sairastavien lisäksi jopa 352 miljoonan ihmisen glukoosin sieto on heikentynyt ja he sairastavat esidiabetesta. Mikä tällaisen selittää ja pitääkö tästä huolestua?

Minun mielestäni pitää huolestua. Diabetes yleistyy nopeimmin pieni- ja keskituloisten parissa, mutta se yleistyy myös muissa sosioekonomisissa väestöryhmissä. Diabetes on tärkein sokeutta, munuaisvaurioita, sydänkohtauksia ja alaraajojen amputaatioita aiheuttava sairaus.

Vuonna 2016 1,6 miljoonaa ihmistä menehtyi diabeteksen seurauksena ja näiden lisäksi 2,2 miljoonaa kuolemantapausta assosioitui vahvasti korkeaan verensokeriin (WHO).

IDF:n tilastojen mukaan diabetes ja siihen liittyvät komplikaatiot tappavat vuosittain noin 4 miljoonaa ihmistä. Tilastollisesti yksi ihminen kuolee diabeteksen seurauksena seitsemän sekunnin välein. Inhimillisen kärsimyksen lisäksi tyypin 2 diabetes tulee yhteiskunnille mahdottoman kalliiksi.

”The figures given in the IDF Atlas fit well with the estimates of an international consortium reporting worldwide trends in diabetes since 1980 based on a pooled analysis of 751 population-based studies with 4·4 million participants. According to this group global age-standardised diabetes prevalence increased from 4.3% (95% CI 2.4-7.0) in 1980 to 9.0% (7.2-11.1) in 2014 in men, and from 5.0% (2.9-7.9) to 7.9% (6.4-9.7) in women.”

Syitä diabetesepidemialle voidaan etsiä esimerkiksi vähentyneestä arkiliikunnasta, väestön lisääntymisestä ja ihmisten odotettavissa olevan elinajan kasvusta. Nämä eivät kuitenkaan selitä nykyistä diabetesepidemiaa riittävän hyvin, sillä miljoonat raskasta fyysistä työtä tekevät ja ravintosuosituksia noudattavat lihovat ja sairastuvat diabetekseen.

Eräs tärkeimmistä diabeteksen kasvua selittävistä tekijöistä on keskivartalolihavuuden nopea lisääntyminen lähes kaikissa sosioekonomisissa ryhmissä ympäri maailman.

Mistä tiedän, onko minulla diabetes?

Terveellä ihmisellä paaston jälkeinen plasman sokeri on 6 mmol/l tai vähemmän. Kahden tunnin sokerirasituksessa terveen ihmisen verensokeri pysyy alle 7,8 mmol/l.

Kun paastoverinäytteestä mitataan sokeria 6,1–6,9 mmol/l, kyseessä on kohonnut paastoplasman sokeri eli heikentynyt paastosokeri (IFG, impaired fasting glucose).

Heikentynyt sokerinsieto (IGT, impaired glucose tolerance) todetaan, kun verensokeripitoisuus on 7,8–11 mmol/l sokerirasituskokeessa 2 tunnin kohdalla tai 2 tuntia aterian jälkeen.

Tutkimuksessa ketogeeninen ruokavalio oli perinteistä vähärasvaista diabetesruokavaliota parempi:

”Individuals with type 2 diabetes improved their glycemic control and lost more weight after being randomized to a very low-carbohydrate ketogenic diet and lifestyle online program rather than a conventional, low-fat diabetes diet online program. Thus, the online delivery of these very low-carbohydrate ketogenic diet and lifestyle recommendations may allow them to have a wider reach in the successful self-management of type 2 diabetes.”

Hyvä uutinen on se, että tyypin 2 diabetes ei ole krooninen sairaus. Se on voitettavissa! Tyypin 2 diabetes voidaan hoitaa esimerkiksi vähäkalorisella tai ketogeenisellä ruokavaliolla. Näistä jälkimmäinen on tutkimusten perusteella parempi.

”A literature search was performed, and a total of 99 original articles containing information pertaining to diabetes reversal or remission were included. Results: Evidence exists that T2D reversal is achievable using bariatric surgery, low-calorie diets (LCD), or carbohydrate restriction (LC).” Lue tästä!

Lihavien määrän kasvu eri väestöissä

Pitääkö klassinen ruokapyramidi kaataa?

Perinteiset lautasmallit ja ravintopyramidit eivät selvästikään suojele meitä lihomiselta ja sairastumiselta. Sairaudet yleistyvät, vaikka ihmiset noudattavat suosituksia, liikkuvat ja lääketiede kehittyy. Missä vika?

Eräs perinteisen ravintopyramidin kaatajista on professori Tim Noakes, joka on elämänsä aikana juossut kymmeniä maratoneja ja ultramaratoneja. Noakes kirjoitti uransa alussa vähärasvaiseen ja runsaasti hiilihydraatteja sisältävään ruokavalioon kannustavia kirjoja.

Noakes käänsi oman ravitsemuksensa ylösalaisin sairastuttuaan aikuistyypin diabetekseen. Hän sairastui, vaikka vältteli rasvoja, liikkui hyvin aktiivisesti ja söi virallisten suositusten mukaisesti. Vallalla olevan mallin mukaan maailman ”timnoakesien” ei pitäisi lihoa tai sairastua aikuistyypin diabetekseen, mutta monet maailman ”timnoakesit” sairastuvat.

Tohtori David Unwin kertoo, että vuonna 1986 hänen vastaanotollaan kävi 57 aikuistyypin diabetesta sairastavaa. Tauti oli tuohon aikaan vielä melko harvinainen ja siihen sairastuivat lähinnä iäkkäät ihmiset. Vuonna 2012 samalla vastaanotolla tyypin 2 diabeetikkoja oli jo 472.


Insuliini on anabolinen hormoni

Verenpainetauti, lihavuus, dyslipidemia ja glukoosi-intoleranssi assosioituvat hyperinsulinemiaan. Oirekirjo tunnetaan metabolisena oireyhtymänä. Hyperinsulinemia vaikuttaa verenpaineeseen lisäämällä munuaisten natriumretentiota (natriumin säilytystä).

Insuliini on aminohapoista muodostuva hormoni. Hormonit ovat elimistön valmistamia endogeenisiä viestinvälittäjämolekyylejä, jotka kulkevat erittymispaikasta kohdesoluihin pääosin verenkierron välityksellä. Hormoni voi vaikuttaa pieninäkin määrinä soluun, jossa on hormonille spesifisiä reseptoreja.

Eri puolilla elimistöä sijaitsevat umpirauhaset erittävät hormoneja aivolisäkkeen ja hypotalamuksen säätelemänä. Insuliinin eritystä ohjaa veren sokeripitoisuus. Glukoosi aiheuttaa piikin insuliinin erityksessä. Proteiinit ja rasvat vaikuttavat insuliinin eritykseen paljon sokereita maltillisemmin.


Mitä hormonit ovat?

Hormonit, jotka voivat olla joko vesiliukoisia (katekoliamiinit, glukagoni ja insuliini) tai rasvaliukoisia (D-vitamiini, steroidit ja kilpirauhashormonit) säätelevät lähes kaikkia elimistön aineenvaihduntaprosesseja. Ne ovat aminohappo-, rasvahappo-, proteiini- ja peptidihormoneja tai steroideja.

Aminohappoyhdisteistä muodostuneet hormonit muodostuvat tyrosiinista ja tryptofaanista. näihin hormoneihin kuuluvat kilpirauhasen erittämät kilpirauhashormonit ja lisämunuaisytimen erittämät katekoliamiinit.

Solukalvojen fosfolipidi arakidonihappo toimii rasvahappoyhdisteisten hormonien lähtöaineena. Tällaisia ovat mm. eikosanoidit (esimerkiksi postglandiinit, tromoksiaanit ja leukotrieenit).

Proteiini- ja peptidihormonit ovat muodostuneet muutamista tai jopa sadoista aminohapoista. Tällaisia ovat esimerkiksi vasopressiini ja tyreoliberiini.

Proteiinihormoneja ovat mm. insuliini ja kasvuhormoni. Proteiinihormoneja, joihin on liittyneenä hiilihydraattiryhmä, kutsutaan glykoproteiineiksi. Glykoproteiineja ovat esimerkiksi follikkelia stimuloiva hormoni ja luteinisoiva hormoni. Steroidihormonien lähtöaineena toimii kolesteroli.

Insuliini ja insuliiniresistenssi

Terve aineenvaihdunta reagoi ruokailun kohottamaan verensokeriin erittämällä insuliinia haiman Langerhansin saarekkeiden β-soluista. Insuliinimolekyylit kulkeutuvat verenkierron mukana soluihin ja kiinnittyvät kudosten insuliiniherkkien solujen insuliinireseptoreihin.

Insuliinireseptoriin kiinnittynyt insuliinimolekyyli ”kutsuu” solukalvon läpäisevän kanavan, jota pitkin glukoosimolekyyli pääsee sujahtamaan solun sytoplasmaan.

Insuliini vaikuttaa insuliiniherkkiin kudoksiin, kuten lihas- ja rasvasoluihin sekä maksan soluihin. Sillä on merkittävä tehtävä kehon energiataloudessa ja erityisesti sokeriaineenvaihdunnassa, koska insuliini lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa. Insuliiniresistenssi vaikuttaa ensimmäiseksi lihassoluihin, joten rasvasolujen energian varastoiminen lisääntyy.

Normaalisti insuliinin eritys vähenee verensokerin laskiessa. Terveillä verensokeri pysyy noin 5 mmol /l (90 mg /dl) -tuntumassa. Esidiabeteksessa sokeritasot kohoavat lähelle 7 mmol /l -tasoa. Diabetekseen sairastuneilla yön yli paaston jälkeen mitattu verensokeri on toistuvasti 7,0 mmol/l tai sitä korkeampi. Normaalin verensokerin yläraja on 6,0 mmol/l.

Insuliini on kehon energiatalouden kapellimestari. Se ohjaa ravinteiden käyttöä energian tuotantoon tai varastoimiseen solujen kylläisyysasteen mukaisesti.

Insuliinipitoisuuden laskiessa glukagoni purkaa insuliinin rakentamia energiavarastoja maksan ja lihasten glykogeeneistä. Näiden hormonien pitoisuus veressä vaihtelee jatkuvasti. Välillä glukoosia puretaan glukagonin aktivoimana glykogeeneistä ja välillä glykogeeni- ja rasvavarastoja kootaan insuliinin avulla.

Insuliiniresistentillä henkilöllä insuliini ei laske verensokeria halutulla tavalla. Rasva- ja lihassolut, tarvitsevat insuliinia glukoosin sisäänottoon. Kun nämä solut eivät reagoi insuliiniin, verensokeri nousee.

Pitkään jatkuvalla korkealla verensokerilla on monia haitallisia terveysvaikutuksia: se mm. heikentää verisuonia.  Aterioiden välillä insuliinitasot laskevat. Insuliinin laskun vaikutuksesta haiman alfasolut erittävät vereen glukagonia. Tämä insuliinin vastavaikuttaja aktivoi sokerivarastojen purkamisen maksasta vereen ja lihaksista lihasten omaan käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.

Rasvasolujen insuliiniresistenssissä verenkierrossa olevien lipidien imeytyminen heikkenee ja varastoituneiden triglyseridien hydrolyysi kiihtyy. Tämä lisää vapaiden rasvahappojen määrää veriplasmassa ja voi edelleen pahentaa insuliiniresistenssiä.

Hyperinsulinemia


Lisääntynyt viskeraalinen rasva erittää tulehdusta aiheuttavia sytokiinejä vereen, ja nämä vaikuttavat insuliinireseptorien toimintaa heikentävästi.

Hyperinsulinemia

Insuliiniresistenssi voi johtaa hyperinsulinemiaan, eli tilaan, jossa veressä on aivan liikaa insuliinia. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, minkä vuoksi veren glukoosia varastoidaan rasvasoluihin.

Insuliiniresistenssin vaikutuksesta lihasten toiminta heikkenee, sillä lihassolujen glukoosinsaanti vähenee. Samalla insuliinin vaikutuksesta rasvakudoksen rakentaminen tehostuu ja ihminen lihoo.

Koska insuliini on ensisijainen hormonaalinen signaali energian varastoimiselle insuliiniherkkiin rasvasoluihin, se stimuloi uuden rasvakudoksen muodostumista ja kiihdyttää painonnousua.

Insuliiniresistenssi lisää haiman beetasolujen insuliinin tuotantoa. Tämä nostaa veren insuliinitasoja (hyperinsulinemia) korkean verensokerin kompensoimiseksi.

Kompensoidun insuliiniresistenssivaiheen aikana insuliinitasot kasvavat, mutta verenkierron lisääntynyt insuliini ei kuitenkaan laske verensokeria.

Jos lisääntynyttä verensokeria kompensoiva insuliinieritys epäonnistuu laskemaan verensokeria, paastoglukoosi ja aterianjälkeinen glukoosi näkyvät mittauksissa kohonneina glukoosipitoisuuksina. Normaali glukoosipitoisuus pysyy aina 5 mml/l tuntumassa. Esidiabeteksessa verensokeritasot ovat 6,0-6,9 mml/l ja diabeteksessa yli 7 mml/l. Heikentynyt insuliinisensitiivisyys eli insuliiniresistenssi vaikuttaa näin tyypin 2 diabeteksen kehittymiseen.

Insuliiniherkät rasvasolut maksassa ja haimassa säilyttävät insuliinisensitiivisyyden lihassoluja pidempään. Tämän vuoksi insuliini kompensoi kohonnutta verensokeria ohjaamalla glukoosia rasvasoluihin, jossa glukoosi de novo lipogeneesissä muutetaan triglyserideiksi.

Tämä lisää myös maksan ja haiman rasvoittumista. Maksan rasvoittuminen lisää alkoholista riippumattoman rasvamaksan riskiä, mutta sitä suurempi ongelma insuliiniresistenssin ja aikuistyypin diabeteksen kannalta on haiman rasvoittuminen, sillä se heikentää entisestään insuliinintuotantoa, kunnes lopulta beetasolujen toiminta lakkaa kokonaan.

Insuliiniresistenssi assosioituu vahvasti ihmisiin, joilla on runsaasti viskeraalista keskivartaloläskiä, verenpainetauti, hyperglykemia, dyslipidemia, kohonneet triglyseriditasot, kohonnut hyvin pienten matalan tiheyden lipoproteiinien (sdLDL) tasot ja pienentyneet HDL-tasot.

Viskeraalinen keskivartalorasva assosioituu tutkimusten perusteella vahvasti insuliiniresistenssiin kahdella tavalla:

Ensinnäkin toisin kuin ihonalainen rasvakudos, viskeraalinen rasva tuottaa tulehduksellisia sytokiinejä, kuten tuumorinekroositekijä-alfa (TNF-a), interleukiini-1 ja interleukiini-6. Monissa kokeissa on osoitettu, että nämä proinflammatoriset, eli tulehdusta edistävät sytokiinit, hajottavat insuliinia tai estävät insuliinin normaalia toimintaa. Suuri osa tulehduksellisten sytokiinien tuotannosta on keskittynyt IKK-beeta / NF-kappa-B-reitille, proteiiniverkolle, joka tehostaa insuliiniresistenssiä vaikuttamalla tulehduksellisten markkerien ja välittäjien transkriptioon.

Toisaalta viskeraalinen rasva vaikuttaa myös rasvan kerääntymiseen maksaan, mikä aiheuttaa alkoholista riippumattoman rasvamaksan kehittymistä (NAFLD). Tämän seurauksena verenkiertoon vapautuu liikaa vapaita rasvahappoja lisääntyneen lipolyysin seurauksena. Edelleen NAFLD:n seurauksena maksan glykogenolyysi (glykogeenien pilkkominen glukoosiksi) ja maksan glukoosin tuotanto kiihtyvät, mikä pahentaa perifeeristä insuliiniresistenssiä ja kasvattaa tyypin 2 diabeteksen riskiä.

Insuliiniresistenssiin liittyy usein myös hyperkoaguloituva tila (heikentynyt fibrinolyysi) ja lisääntyneet tulehdukselliset sytokiinitasot.

Molekyylitasolla

Molekyylitasolla solu havaitsee insuliinin insuliinireseptoreiden välityksellä signaalin kulkiessa signalointikaskadin läpi. Tämä tunnetaan nimellä PI3K / Akt / mTOR signalointireitti.

Tuoreet tutkimukset viittaavat siihen, että tämä signalointireitti voi toimia fysiologisista olosuhteista riippuvaisena kaksisuuntaisena eli bistabiilina kytkimenä tietyntyyppisille soluille, jossa insuliinivaste voi olla kynnysilmiö.

Tämän signalointireitin herkkyys insuliinille voi heikentyä monien tekijöiden, kuten vapaiden rasvahappojen aiheuttaman insuliiniresistenssin seurauksena. Laajemmasta näkökulmasta herkkyyden virittäminen (tai herkkyyden vähentäminen) on organismin normaali tapa sopeutua muuttuvan ympäristön tai aineenvaihdunnan olosuhteisiin. Eli insuliiniresistenssi voi joissain tilanteissa olla elimistön kannalta toivottava tila.

Esimerkiksi raskaus muuttaa odottavan äidin aineenvaihduntaa. Odottavan äidin elimistön on vähennettävä lihaksiensa insuliiniherkkyyttä varatakseen enemmän glukoosia aivan erityisesti sikiön aivojen kehitykselle. Tämä voidaan saavuttaa siirtämällä insuliinin vastekynnystä, eli herkkyyttä erittämällä vereen istukan kasvutekijää, joka estää insuliinireseptorisubstraatin (IRS) ja PI3K:n vuorovaikutusta. Tämä on ns. säädettävän kynnyshypoteesin ydin.

Insuliiniresistenssi superoksidaasidismutaasi

Insuliiniresistenssi voi olla lisääntyneen ravinnonsaannin aiheuttama solutason reaktio. Ylimääräinen energiansaanti vaikuttaa solujen mitokondrioissa superoksidaasidismutaasin toimintaan.

Superoksidisdaasimutaasi on yksi tärkeimmistä antioksidanteista. Tällaisesta molekyylitason vaikutuksesta on viitteitä erilaisissa insuliiniresistenssistä tehdyissä havainnoissa. Kokeissa on havaittu myös, että insuliiniresistenssi voidaan kääntää nopeasti altistamalla solut esimerkiksi elektronin kuljetusketjun estäjille tai mitokondrioiden superoksididismutaasia jäljitteleville aineille.

Superoksidaasidismutaasi

Insuliiniresistenssi on yhteydessä verenpaineeseen. Nakamura tutkijakollegoineen. osoitti insuliiniresistenteillä jyrsijöillä ja ihmisillä, että vaikka insuliinin stimuloiva vaikutus adiposyyttien glukoosin imeytymisen insuliinireseptorisubstraatin 1 (IRS1) välityksellä heikentyi voimakkaasti, IRS2 välittämä vaikutus suolan imeytymiseen munuaisten proksimaaliseen tubulukseen, säilyi.

Kompensoiva hyperinsulinemia yksilöillä, joilla on insuliiniresistenssi, voi lisätä natriumin kerääntymistä proksimaaliseen tubulukseen, mikä johtaa natriumin ylikuormitukseen ja verenpaineen kohoamiseen.

Superoksidaasidismutaasi (SOD3) on useimmissa kudoksissa esiintyvä antioksidanttientsyymi, joka muuttaa haitallista superoksidia vähemmän haitalliseksi vetyperoksidiksi. Sekin on reaktiivinen happiyhdiste, mutta se toimii myös solujen viestinnässä viestinvälitysmolekyylinä. SOD3 saattaa siis osallistua solujen viestintään.

FM, PhD Lilja Laatikainen selvitti väitöstutkimuksessaan, kuinka solunulkoinen superoksididismutaasi-entsyymi suojaa kudoksia tulehdusreaktion aiheuttamilta vaurioilta. Tutkimus osoitti, että kudokseen virusvektorin avulla siirretty SOD3 estää tulehdussolujen, erityisesti makrofagien, kulkeutumisen vaurioituneeseen kohtaan.

Mekanismi on Laatikaisen tutkimuksen perusteella tulehdussolujen tarvitsemien tarttumismolekyylien ja tulehdusta edistävien sytokiinien tuoton vähentäminen estämällä keskeisen NF-kappa-B-molekyylin toimintaa. Tämän lisäksi SOD3 voimisti viestien välitystä Erk- ja Akt-signalointireiteillä, jotka edistävät solujen eloonjääntiä stressitilanteissa, ja vastaavasti vähensi solukuolemaan johtavien tekijöiden ilmentymistä, vähensi kudosvaurion laajuutta ja nopeutti kudoksen paranemista.

Insuliiniresistenssi tai heikentynyt insuliiniherkkyys on olennainen piirre aineenvaihdunnan oireyhtymässä, johon assosioituvat liikalihavuus, heikentynyt glukoosin sieto, dyslipidemia ja verenpaine. Dyslipidemialla tarkoitetaan rasva-aineenvaihdunnan häiriötä, jossa jokin veren rasva-arvoista (LDL, HDL, triglyseridit) ei vastaa suosituksia. Dyslipidemiasta puhutaan, jos seerumin LDL on yli 3 mmol litrassa, triglyseridipitoisuus yli 2 mmol/l tai HDL-pitoisuus alle 1mmol/l.

Insuliinin toiminta

Heikentynyt insuliiniherkkyys johtaa kompensoivaan hyperinsulinemiaan normaalin verensokerin ylläpitämiseksi. Insuliiniresistenssi voi olla toissijainen vaste insuliinireseptorin (IR) ja telakointiproteiinien, kuten insuliinireseptorisubstraattien (IRS) vaimennussäätelyä tai inaktivaatiota ohjaavalle signaloinnille.

Insuliinilla on tärkeä tehtävä verensokerin säätelyssä, sillä se stimuloi glukoosin kuljetusta rasvasolujen ja luurankolihasten kudosten läpi insuliinireseptorisubstraattien aktivaation jälkeen.

Insuliini stimuloi glukoosin kuljettajien (GLUT) siirtämistä solunsisäisistä kalvo-osastoista plasmakalvoon lisäämällä sokerin imeytymistä. Rasva- ja luurankolihaskudoksissa vaikuttaa useita glukoosin kuljetusmolekyylejä, mutta havaintojen perusteella GLUT4 on glukoosin solukalvojen läpi kuljettamisen kannalta tärkein kuljetusmolekyyli.

Insuliini sitoutuu ja aktivoi insuliinireseptori-tyrosiinikinaasia (IR), mikä johtaa IRS1:n, IRS2:n, IRS3:n ja IRS4:n fosforylaatioon. Sitoutumalla signalointipartnereiden, kuten fosfoinositidi-3-kinaasin (PI3K) kanssa insuliini aktivoi Akt/proteiinikinaasi B- ja proteiinikinaasi C-ζ -kaskadit, joilla on tärkeä tehtävä insuliinin toiminnassa.

IRS-alatyypit jakautuvat kudosspesifisesti, ja niillä on selkeät signalointikanavat. IRS1 välittää insuliinin vaikutusta glukoosin imeytymiseen rasvasoluissa ja luurankolihaksissa. IRS2 toimii ensisijaisesti välittäen insuliinin vaikutusta munuaistiehyihin.

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssin ja verenpaineen välinen yhteys on joko kahden itsenäisen prosessin yhteys, joka ei ole ainakaan suoraan yhteydessä verenpaineeseen, tai syy-seuraussuhde, jossa insuliiniresistenssi aiheuttaa kohonneen verenpaineen.

Jos insuliiniresistenssi ei aiheuta kohonnutta verenpainetta, insuliiniresistenssi ja kohonnut verenpaine voivat olla saman soluhäiriön toisiinsa liittymättömiä seurauksia. Eli kyse voi olla solunsisäisen vapaan kalsiumin määrän lisääntymisestä, mikä johtaa verisuonten supistumiseen ja insuliinin heikentyneeseen toimintaan.

Insuliiniresistenssi on toisaalta myös moniin verenpaineen kohoamista aiheuttaviin aineenvaihdunnan poikkeamiin assosioituva molekyylimarkkeri.

Toinen vaihtoehto on, että hyperinsulinemia vaikuttaa verenpainetaudin syntyyn, lisäämällä natriumin imeytymistä munuaisiin, aktivoimalla sympaattista hermostoa ja muuttamalla verisuonten resistenssiä.

Kudoksen heikentynyt insuliiniherkkyys on yhteinen nimittäjä useille sairauksille, kuten metabolinen oireyhtymä, keskivartalolihavuus, hyperglykemia, dyslipidemia, hypertensio ja insuliiniresistenssi. Vaikka insuliiniresistenssin osuutta hyperglykemian ja dyslipidemian osalta on tutkittu, insuliiniresistenssin merkityksestä verenpainetaudin patogeneesissä tiedetään vähemmän kuin insuliiniresistenssin merkityksestä metabolisen oireyhtymän ja tyypin 2 diabeteksen sekä lihavuuden synnyssä.

Miten Suomessa?

Diabetesliiton mukaan Suomessa vajaat puoli miljoonaa ihmistä sairastaa aikuistyypin diabetesta. Arviolta 100 000 sairastaa diabetesta tietämättään. Joka vuosi yli 20 000 suomalaista sairastuu tyypin 2 diabetekseen.

Diabetes on suurin yksittäinen valtimotautien, aivoverenkiertohäiriöiden ja alaraaja-amputaatioiden syy. Se lisää myös munuais- ja silmäsairauksia. Suomessa diabeteksen hoitokustannuksiin kuluu ihan helvetisti rahaa. Diabeteksen hoitoon käytetään 15 % terveydenhuollon menoista.

FinTerveys 2017 -tutkimuksen mukaan yli 30-vuotiaista miehistä 72 % ja naisista 63 % oli vähintään ylipainoisia. Miehistä 26 % ja naisista 28 % oli lihavia. Melkein puolet suomalaisista on vyötärölihavia.

Jo noin puoli miljoonaa ihmistä käyttää verenpainelääkkeitä. Tuhansilla verenpaineet ovat jatkuvasti riskirajoilla.  

Ketogeeninen ruokavalio toimii painonhallinnassa, pitää verensokerin tasaisena ympäri vuorokauden ja laskee tutkitusti verenpainetta. Voisiko ketogeeninen ruokavalio auttaa verenpaineen, painon ja huonojen lipidiprofiilien kanssa kamppailevia myös Suomessa?

Miksi ketoilu laskee verenpainetta?

David J. Unwin kertoo hiljattain tehdystä pilottitutkimuksesta, jossa tutkijat havaitsivat, että hyvin vähän hiilihydraatteja sisältävään ruokavalioon assosioitui merkittäviä verenpaineen, painon ja lipidiprofiilien paranemista, minkä vuoksi potilaiden lääkitystä voitiin tutkimuksen aikana vähentää.

Kysymys on: Voidaanko samanlaisia positiivisia terveyshyötyjä saada laajemmassa tutkimuksessa? Unwin tutkijaryhmineen rekrytoi perusterveydenhuollon seurantatutkimukseen 154 potilasta, jotka sairastivat aikuistyypin diabetesta, tai joilla sokerin sietokyky oli merkittävästi heikentynyt.

Vähähiilihydraattisen ruokavalion vaikutuksia sydämen ja verisuonitautien riskitekijöihin tutkittiin keskimäärin kaksi vuotta. Seurattujen potilaiden verenpaine laski merkittävästi LCHF-ruokavaliolla:

* Systolinen verenpaine laski keskimäärin 10,9 mmHg
*Diastolinen verenpaine laski keskimääräinen 6,3 mmHg
*Tutkimukseen osallistuneiden potilaiden paino laski keskimäärin 9,5 kg    *lipidiprofiilit paranivat selvästi

Tutkimuksen aikana potilaiden verenpainelääkitystä vähennettiin 20 prosentilla.  Kansallinen terveydenhuollon huippuosaamisinstituutti (National Institute for Health and Care Excellence – NICE) määrittelee kohonneen verenpaineen riskirajaksi 140/90 mmHg ja sitä korkeammat tulokset. Kotioloissa mitatut päivittäiset verenpaineen keskiarvot, jotka ovat vähintään135/85 mmHg ovat korkean verenpaineen riskirajoilla. Ymmärtääkseni näitä arvoja noudatetaan myös suomalaisessa terveydenhuollossa.

Hiljattain julkaistun tutkimuksen (lue tästä) mukaan huonojen ravitsemustottumusten jälkeen korkea verenpaine on globaalisti merkittävin sairastumisen riskitekijä.

Isossa-Britanniassa korkea verenpaine on tupakoinnin ja huonojen ravitsemustottumusten jälkeen kolmanneksi merkittävin sairastumiselle altistava riskitekijä.

Usein korkean verenpaineen syy voi johtua esimerkiksi ylipainosta, tupakoinnista, runsaasta suolan käytöstä tai perinnöllisistä tekijöistä, mutta toisinaan kohonneelle verenpaineelle ei löydetä mitään suoraa kausaalista syytä. Tällöin puhutaan essentiaalisesta hypertensiosta. Se on viisaalta kuulostava diagnoosi, joka kertoo, että syytä kohonneelle verenpaineelle ei tiedetä.

Tutkijat laativat vuonna 2013 ohjeita vähähiilihydraattisen ruokavalion (vähemmän kuin 130 g hiilihydraattia / päivä) hoitosuosituksia tyypin 2 diabeteksen. 19 potilaan pilottitutkimuksen potilaat sairastivat aikuistyypin diabetesta tai heidän sokerinsietokykynsä (IGT) oli merkittävästi heikentynyt. Kahdeksan kuukauden tutkimuksen hämmästyttävimmät seuraukset olivat potilaiden verenpaineen merkittävä parantuminen.  è systolinen 148 ± 17–133 ± 15 mmHg, p <0,005 è diastolinen 91 ± 8–83 ± 11 mmHg, p <0,05).  Koehenkilöiden verenpaineet laskivat huolimatta verenpainelääkkeiden käytön lopettamisesta.

Hypoteesi vuoden 2013 pilottitutkimuksen tuloksille oli, että vähähiilihydraattiset ruokavaliot voivat toimia diabeteksen ja painonhallinnan hoidossa perinteisiä hoitomuotoja paremmin. Aluksi hypoteesi herätti lääketieteellisessä yhteisössä runsaasti kritiikkiä ja epäilyjä, mutta sittemmin ketogeeninen ruokavalio on laajemmin hyväksytty osaksi aikuistyypin diabeteksen hoitoa. (Lue tästä ja tästä).

Hiilihydraattien vähentämisen vaikutukset insuliinin aktiivisuuteen ja metabolisen oireyhtymän oireiden hoitoon osoitettiin jo vuonna 2005 (lue tutkimus). Lisätyn sokerin lisäksi kaikkien ravinnon glukoosilähteiden, kuten leivän, perunan, viljan ja riisin rajoittaminen vähentää insuliinin eritystä ja parantaa insuliiniherkkyyttä.

Metabolinen oireyhtymä, korkea verenpaine DB2, keskivartalolihavuus, dyslipidemia ja alkoholista riippumaton rasvamaksa (NAFLD) ovat vain jäävuoren huippu. Kaikki nämä sairaudet palautuvat pinnan alla vaanivaan insuliiniresistenssiin.

Vuonna 2013 valmistunut vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion ja vähärasvaisen ruokavalion pitkäaikaisia vaikutuksia selvittänyt satunnaistettujen kontrolloitujen tutkimusten (> 12 kuukauden kesto) meta-analyysi, osoitti vähän hiilihydraatteja sisältävällä ruokavaliolla selvää laskua diastolisessa verenpaineessa, mutta ei systolisessa verenpaineessa.

Samana vuonna valmistunut toinen satunnaistettu kontrolloitu tutkimus havaitsi, että sekä systolinen että diastolinen verenpaine laskivat kuuden viikon kuluttua.

Tyypin 2 diabetesta sairastavilla hyperinsulinemia lisää munuaisten natriumin pidättämistä. Samaa ei tapahdu terveillä verrokeilla. Vuonna 2017 satunnaistettujen vertailututkimusten systemaattinen katsaus ja meta-analyysi osoitti, että pienemmän glykeemisen kuorman ruokavalio laskee merkittävästi verenpainetta. (Lue tästä)

Huolimatta ketogeenisen ruokavalion hyötyjen laajemmasta hyväksynnästä, vähähiilihydraattisen ruokavalion pitkäaikaisvaikutukset herättävät yhä kysymyksiä.

Iso-Britannian diabetesyhdistyksen marraskuussa 2018 antaman lausunnon mukaan: vaikka vähän hiilihydraatteja sisältävän ruokavalion ”lyhytaikaiset” hyödyt diabetesta sairastavan painonhallintaan, parantunut glykeeminen kontrolli ja pienentynyt sydän- ja verisuonitautien riski on osoitettu, ketogeenisen ruokavalion pitkäaikaisvaikutuksista tarvitaan lisää tutkimuksia.

Tutkimus ja menetelmät

Tutkimuksessa analysoitiin retrospektiivisesti yleislääkäreiden tutkimusta varten keräämiä kliinisiä tietoja 9700 potilaasta Pohjois-Englannista.  Lääkärit ja sairaanhoitajat tarjosivat tyypin 2 diabetesta tai heikentynyttä glukoositoleranssia (IGT) sairastaville potilaille vaihtoehtoisena hoitomuotona vähän hiilihydraatteja sisältävää ruokavaliota.

Tutkimuksesta poissuljettiin: raskaana olevat, syömishäiriöiset, alipainoiset, tyypin 1 diabetesta sairastavat ja alle 18-vuotiaat. Tietoja kerättiin maliskuusta 2013 marraskuuhun 2018.

Ruokavalio-kokeeseen osallistuneille annettiin kirjalliset ohjeet ja lisätukea potilaan valinnasta ja kliinisestä tarpeesta riippuen.  Kokeeseen valikoitui monenkirjava joukko eri ikäisiä ja erilaisissa elämäntilanteissa eläviä ihmisiä.  Lääkärin ja sairaanhoitajan tapaamisten lisäksi kokeeseen osallistuville tarjottiin säännöllisiä 90 minuutin ”ryhmäistuntoja” lähes kuukausittain.

Ryhmäistuntoihin osallistui myös perheenjäseniä. Kohorttiin valikoitui 154 osallistujaa: 90 miestä ja 64 naista. Kunkin potilaan paino, verenpaine ja verenkuva tutkittiin ennen tutkimuksen alkua. 89 oli tyypin 2 diabetes. Kokeeseen osallistuvien ikähajonta oli 40-89 ja ryhmän keski-ikä 63 vuotta tutkimuksen alkaessa. Useimmat seurantaan osallistuvista olivat ylipainoisia (keskimääräinen painoindeksi 34).

Alkutiedot Lähtötason mittauksiin sisältyivät seuraavat: Paino, verenpaine, kokonaiskolesteroli, HDL-kolesteroli, paaston triglyseriditasot ja verenpainetaudit. Kaikki mittaukset kerättiin käyttämällä Yhdistyneen kuningaskunnan kansallisen terveyspalvelun standardilaitteita ja laboratorioanalyysejä.

Tutkittavia ohjeistettiin vähentämään merkittävästi ruokavalion sisältämiä piilosokereita ja tärkkelyspitoisia elintarvikkeita, kuten perunoita, leipää ja riisiä. Ohjeistuksessa käytettiin apuna tutkimusta varten kehitettyä sokeriekvivalenttijärjestelmää, joka edustaa erilaisten elintarvikkeiden glykeemistä kuormaa.

Esimerkiksi pieni viipale leipää aiheuttaa vastaavan verensokerin nousun kuin kolme teelusikallista sokeria, ja 150 g keitettyä riisiä nostaa verensokeria saman verran kuin kymmenen teelusikallista sokeria.  Sokeriekvivalenttijärjestelmän avulla potilaat ymmärsivät, että esimerkiksi maissihiutaleista, paahtoleivästä ja mehusta muodostuva aamiainen on käytännössä sokeria.

Tulokset

Kahden vuoden tutkimuksen aikana tutkittavien potilaiden verenpaine, paino ja lipidiprofiilit paranivat selvästi ketogeenisellä ruokavaliolla.

Tutkimus osoitti, että hiilihydraattien rajoittaminen on turvallinen ja tehokas tapa hoitaa tyypin 2 diabeteksen oireita.


Yhteenveto

Ketogeenisen ruokavalion vaaroja liioitellaan. Todennäköisesti näin tehdään, koska keto-dieetti ei mahdu perinteisiin oppeihin hyvästä ja terveellisestä ruokavaliosta.

Tutkimuksia ketogeenisen ruokavalion terveyshyödyistä julkaistaan kiihtyvään tahtiin ja yhä useammat lääketieteen ammattilaiset ovat ottaneet ketogeenisen ruokavalion osaksi lihavuutta, verenpainetautia, metabolista oireyhtymää, tyypin 2 diabetesta jne. sairastavien potilaiden hoitosuunnitelmaa.

Ketogeeninen ruokavalio pitää verensokerin ja veren insuliinipitoisuuden tasaisena. Korkea verensokeri ja korkea insuliini assosioituvat  kardiometabolisiin ja kroonisiin sairauksiin, kuten tyypin 2 diabetekseen. Ketogeeninen ruokavalio on paras tapa hoitaa insuliiniresistenssiä, joka on monien sairauksien perussyy. Ruokavalio hillitsee oksidatiivista stressiä ja inflammaatiota, jotka assosioituvat lukemattomiin kroonisiin sairauksiin.

Kansainvälisesti yhä suurempi joukko lääketieteen ammattilaisia ja ketogeeniseen ruokavalioon syvällisesti perehtyneitä ravintoterapeutteja, insinöörejä ja nörttejä luennoi ja kirjoittaa ketogeenisen ruokavalion hyödyistä.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6695889/

https://en.wikipedia.org/wiki/Insulin_resistance

https://www.sciencedirect.com/science/article/pii/S0085253815301745

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6359196/

https://lipidworld.biomedcentral.com/articles/10.1186/s12944-019-1035-2

https://www.ncbi.nlm.nih.gov/pubmed/28193599

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664869/

 




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Onnellista alkanutta vuotta kaikille vielä kerran ja viivästyneesti! Oma vointini on jo ihan kakskyt-kakskyt. Ehkä edessämme on paras vuosikymmen ikinä tai sitten kiinalainen korona pelaa meidät pandemiaan. Maailmanlopun kelloa on jälleen siirretty eteenpäin. Enää on vain 100 sekuntia keskiyöhön. Jatkan yksinäistä sokereiden vastaista ketoiluhömppää artikkelissa: Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Mutkaton 6:1-ketoiluni on tuottanut toivottuja tuloksia ja voin hieman paukutella henkseleitäni. Viiden viikon aikana painoni putosi tuskattomasti 5-6 kiloa. Seitsemännellä viikolla paino käväisi ujonoloisesti 85 kilossa, mutta otin sitten menetettyjä kiloja varovasti takaisin erilaisten tekosyiden varjolla. Se onnistui helposti hampurilaisilla ja oluella.

Vointini on pysynyt energisenä, eikä nälkä ole juuri vaivannut. Sehän se ongelma lienee; uskon nälän parantavaan voimaan. Syön ehkä vieläkin liikaa, vaikka luulen, että tehostuneen rasva-aineenvaihdunnan ohella myös päivittäinen kokonaisenergian saantini on ketoillen laskenut.

Oli painon putoamisen syy mikä tahansa, ketogeeninen ruokavalio toimii omalla kohdallani mainiosti. Jännää on, että en kaipaa perunoita, pastaa, leipää ja sokereita enää lainkaan. Ajatus esimerkiksi karkkien tai vaalean leivän syönnistä tuntuu melkeinpä vastenmieliseltä. Tai tuntui, kun kirjoitin nuo sanat. Tänään ahmin karkkia koko alkaneen vuoden edestä. Hyi minua!


Sokerina pohjalla:

Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Anahad O’Connor kirjoitti 12.9.2016 New York Times -lehdessä sokeriteollisuuden toteuttamasta suuresta vedätyksestä 1960-luvulla. En tiedä saiko tämä uutinen ansaitsemaansa näkyvyyttä suomalaisissa uutismedioissa, joten uutisoidaan tämä viiveellä Ruokasodassa.

Sokeriteollisuuden rahoittama härski pseudotutkimus on vaikuttanut ravintotieteisiin ja ravintosuosituksiin jo 50 vuotta ja vaikuttaa yhä. Se on vakava aihe, vaikkakaan ei yllättävä, eikä ehkä uutinenkaan.

Kaikkien aikojen huijaustilastoissa sokeriteollisuuden huijaus yltää neljännelle sijalle. Edelle menee kuuhuijaus, tai se kun amerikkalaiset päättivät lavastaa kuukäynnin, mutta se tuli niin kalliiksi, että he kuvasivat kuuhuijauksen kuussa ja huijasivat vain lavastuksen. Se oli yllättävän ovelaa.

Ei oikeasti! Se on hölmö juttu, mutta kuulostaa hauskalta. Sokeriteollisuuden vedätys jää vain hieman jälkeen öljyteollisuuden huijauksesta ja tupakkateollisuuden katalista toimista. Ne ovat vahvasti todennettuja faktuaalisia tapahtumasarjoja.

Tämän kupletin viheliäinen juoni on se, että sokeriteollisuus maksoi löytyneiden dokumenttien valossa kolmelle Harvardin tutkijalle tutkimuksesta, joissa valkopestiin sokerin ja sydäntautien välinen yhteys. Tämän ei pitäisi yllättää, sillä myös sokereiden ja syöpien yhteydestä haluttiin vaieta. Sen tarinan voit lukea tästä.

Samassa tutkimuksessa epäily sydän- ja verisuonitautien ravitsemuksellisesta syystä vieritettiin tyydyttyneille (koville) eläinrasvoille. Ensimmäiset amerikkalaiset ravitsemussuositukset laadittiin sokeriteollisuudessa kannuksensa ansainneen tohtori Hegstedin suosituksesta rasvavastaisiksi ja sokereita suosiviksi jo 1970-luvulla.

Nämä yhdysvaltalaiset ravitsemussuositukset levisivät ympäri maailman ja lopulta myös Suomeen. Mikä vaikutus huijauksella on ollut lihavuus- ja diabetesepidemioihin? Suoraa kausaalisuhdetta tuskin voidaan osoittaa, mutta korrelaatio on selvä: rasvan rajoittamisen ja sokereiden suosimisen seurauksena aikuistyypin diabetes ja lihavuus kääntyivät selvään kasvuun.

”Se, että sokerin terveyshaittoja vähäteltiin ja rasvojen haittoja liioiteltiin vuosikymmeniä, on suurella todennäköisyydellä vaikuttanut nykyisiin lihavuus- ja diabetesepidemioihin, kertoo Sanjay Basu Stanfordin yliopistosta. Lihavuus ja diabetes yleistyivät vähärasvaisten ja rasvattomien tuotteiden kulutuksen seurauksena.”


Tutkijat salapoliiseina

Tämä tieteellinen huijaus paljastui Kalifornian yliopiston tutkijan esiin kaivamista sokeriteollisuuden dokumenteista. Löydöstä on raportoinut mm. arvostettu lääketieteellinen julkaisu JAMA.

Keskustelu sokerin mahdollista terveyshaitoista vaiennettiin vuosikymmeniksi, kertoo eräs JAMAn julkaiseman raportin tekijöistä, professori Stanton Glantz (Kalifornian yliopisto).

Löydetyt dokumentit todistavat, että Sugar Research Foundation -niminen sokeriteollisuuden järjestö (nykyään Sugar Association), maksoi kolmelle Harvardin tutkijalle nykyrahassa 49 000 dollaria vastaavan summan sokeria, rasvoja ja sydäntauteja käsittelevän tutkimuksen julkaisemisesta 1967.

Sokeriteollisuuden rahoittama tutkimus ohjattiin sokereita suosivaksi

Sugar Research Foundation määritteli tutkijoille ennalta valitun sokerin terveysriskejä vähättelevän tutkimusmateriaalin. Sen lisäksi sokeriteollisuuden johtajat tarkistivat tutkimuksen ennen sen julkaisemista. Sokereiden terveysriskejä vähättelevä ja eläinrasvojen haittoja korostava artikkeli julkaistiin arvovaltaisessa lääketieteellisessä julkaisussa (New England Journal of Medicine).

Sokeriteollisuuden suuresta huijauksesta on vierähtänyt vuosikymmeniä, mutta sama meno jatkuu yhä. Ruokateollisuus rahoittaa ja ohjaa ravitsemusta käsitteleviä tutkimuksia.

2015 New York Times kertoi, että Coca-Cola Company on rahoittanut miljoonilla dollareilla tutkijoita ja tutkimuksia, joissa pyritään kumoamaan sokeria sisältävien juomien ja lihavuuden välinen yhteys. 2016 kesäkuussa AP (Associated Press) kertoi, että makeisvalmistajat rahoittavat tutkimuksia, joiden mukaan makeisia syövät lapset ovat terveempiä ja laihempia kuin lapset, jotka eivät syö makeisia. Tällaisen ei pitäisi hämmästyttää enää tässä totuudenjälkeisessä maailmassa, mutta on se aika härskiä ja järkyttävää toimintaa. Teollisuuden ahneus on ainoa asia, johon enää voi uskoa.

Huijaukseen osallistuneet Harvardin tutkijat ja sokeriteollisuuden johtajat ovat jo kuolleet. Eräs sokeriteollisuudelta rahaa saanut tutkija oli tohtori Mark Hegsted, joka myöhemmin nousi Yhdysvaltojen maatalousministeriön ravitsemusasioiden johtajaksi ja oli laatimassa ensimmäisiä ravitsemussuosituksia 1977. Toinen sokeriteollisuudelta rahaa saanut tutkija oli tohtori Fredrick J. Stare, Harvardin yliopiston ravitsemustieteellisen tiedekunnan johtaja.

Mitäpä sokeri vastasi?

Sugar Association vastasi JAMA:n julkaisemaan raporttiin toteamalla, että vuoden 1967 raportti julkaistiin aikana, jolloin lääketieteellisissä lehdissä ei edellytetty tutkimusten rahoittajien paljastamista. New England Journal of Medicine aloitti tieteellisten raporttien rahoittajien ilmoittamisen vasta vuonna 1984.

Sugar Association myönsi, että avoimuus ja läpinäkyvyys tutkimustoiminnan rahoittajien osalta olisi ollut aiheellista, mutta puolusti julkaistun tutkimuksen tärkeää ja informatiivista roolia tieteellisessä keskustelussa. Sokeriteollisuus painotti vastauksessaan, että vuosikymmenten tutkimukset eivät ole osoittaneet merkittävää korrelaatiota sokerin ja sydäntautien väliltä, toisin kuin American Heart Association ja World Health Organization uskovat.

Tausta

Sota tyydyttyneiden rasvojen ja sokerin terveyshaitoista on jatkunut vuosikymmeniä. Rasvasodan käynnisti Ancel Keysin myöhemmin kyseenalaistetut tutkimukset kovien rasvojen yhteydestä valtimonkovettumatautiin eli ateroskleroosiin. John Yudkin varoitteli sokereiden terveyshaitoista jo 1970-luvulla, mutta hänet leimattiin naurettavaksi pelleksi.

Keskustelu sokereiden ja tyydyttyneiden rasvojen haitoista jatkuu edelleen yhtä aiheellisena kuin 1970-luvulla. Vuosikymmenien ajan ravitsemussuosituksissa on kehotettu välttämään rasvaa ja erityisesti kovia rasvoja. 1970-luvulla alkanut vähärasvaisuutta suosiva buumi johti siihen, että rasvoja korvattiin elintarvikkeissa lisätyillä sokereilla. Monien tutkijoiden ja maallikoiden, kuten allekirjoittaneen, mielestä tämä on tärkein syy aikuistyypin diabeteksen ja ylipainon räjähdysmäiseen kasvuun.

Huijaus toimi – yllättääkö se?

Sokeriteollisuuden kannalta suunnitelma toimi erinomaisesti: huomio sokereiden mahdollisista terveyshaitoista unohdettiin käytännössä kokonaan. Arvostetussa julkaisussa raportoitu tutkimusraportti sai merkittävän näkyvyyden tieteellisessä yhteisössä.

Tohtori Hegsted käytti tutkimusraporttia vakuuttaakseen terveysviranomaiset tyydyttyneiden rasvojen haitoista sydän- ja verisuoniterveydelle. Sokereiden haitoista ei juuri puhuttu muuten kuin tyhjinä kaloreina, jotka saattavat pahimmillaan vahingoittaa hampaita.

Hegstedin raportti toimii yhä yleisimpien ravitsemussuositusten perustana, vaikka Amerikan sydänliitto (AHA) ja Maailman terveysjärjestö (WHO) ovat osoittaneet myös lisätyn sokerin kasvattavan sydän- ja verisuonitautien riskiä. Hölmöksi leimattu Yudkin oli siis oikeassa jo 1970-luvulla.

New Yorkin yliopiston ravitsemuksen, ruokatutkimuksen ja kansanterveyden professori Marion Nestle kirjoitti JAMA:n julkaiseman tutkimusraportin liitteessä, että löydetyt asiakirjat todistavat vakuuttavasti sokeriteollisuuden pyrkimyksestä valkopestä sokereiden rooli sydän- ja verisuonitautien riskitekijänä.

Tohtori Walter Willett, Harvardin TH Chanin kansanterveydenlaitoksen ravitsemusosaston puheenjohtaja, totesi, että akateemiset eturistiriitasäädökset ovat muuttuneet merkittävästi 1960-luvulta lähtien. Hänen mukaansa löydetyt dokumentit ovat tärkeä osoitus siitä, miksi tieteellistä tutkimusta tulisi tukea julkisella rahoituksella sen sijaan, että rahoitus on teollisuuden varassa.

Tohtori Willett lisäsi, että tutkijoilla oli vain rajoitetusti tietoa sokereiden ja rasvojen suhteellisten riskien arvioimiseksi. Tuoreet tutkimukset ovat osoittaneet, että puhdistetut hiilihydraatit ja erityisesti sokeroidut juomat ovat mm. sydän- ja verisuonitautien, lihavuuden ja aikuistyypin diabeteksen riskitekijöitä, mutta myös ravinnosta saatujen rasvojen laatu vaikuttaa sydän- ja verisuonitautien riskiin.

JAMA perusti artikkelinsa tuhansiin sivuihin kirjeenvaihtoa ja muita asiakirjoja, jotka tutkijatohtori Christin E. Kearns löysin Harvardin ja Illinoisin yliopistojen kirjastojen arkistoista. Löydettyjen asiakirjojen mukaan sokeriteollisuuden ylin johtaja John Hickson keskusteli vuonna 1964 muiden sokeriteollisuuden johtajien kanssa suunnitelmasta, jossa yleiseen mielipiteeseen vaikutettaisiin tutkimuksella, tiedotuksella ja lainsäädännöllisin keinoin. Samoja menetelmiä on onnistuneesti soveltanut tupakka- ja öljyteollisuus.

Imperiumin vastaisku

Tutkimukset olivat jo 60-luvulla havainneet merkittävän korrelaation runsaasti sokeria sisältävän ravinnon ja sydänsairauksien väliltä. Samaan aikaan muut tutkijat, kuten Ancel Keys, tutkivat oletusta, jonka mukaan sydänsairauksien riskiä kasvatti ensisijaisesti tyydyttyneet rasvat ja ravinnon sisältämä kolesteroli.

Hicksonin mukaan sokeriteollisuutta huolestuttaviin tutkimuksiin oli vastattava sokeriteollisuuden omalla tutkimuksella, joka kumoaa sokeriin liitetyt negatiiviset terveysväittämät.  Vuonna 1965 Hickson pyysi Harvardin tutkijoita kirjoittamaan raportin, joka kumoaa sokerin terveyshaittoja käsittelevät tutkimukset. Tutkijoille maksettiin 6500 dollaria, joka nykyrahassa vastaa 49 000 dollaria. Hickson valitsi tutkijoille lähdeaineiston ja teki selväksi, että tutkimuksen tulosten pitää suosia sokeria.

Kirjeenvaihdon perusteella Harvardissa työskennellyt tohtori Hegsted vastasi sokeriteollisuuden johtajille: ”Ymmärrämme ongelman ja teemme parhaamme sen korjaamiseksi”. Tutkijat esittelivät tutkimusluonnoksen Hicksonille, joka kertoi olevansa siihen erittäin tyytyväinen. Harvardin tutkijat sivuuttivat tutkimuksessa sokerin terveyshaittoihin viittaavat tiedot ja painottivat tyydyttyneiden rasvojen ja valtimonkovettumataudin välistä yhteyttä.

Tutkimuksen julkaisemisen jälkeen keskustelu sokerin ja sydäntautien välillä vaiettiin kuoliaaksi. Samalla monet terveysviranomaiset hyväksyivät ”terveelliset” vähärasvaisuutta korostavat ruokavaliot.

Nonni. Tämä nyt on tätä. Jos se ei ole totta, niin ainakin se on hyvä tarina!

https://www.nytimes.com/2016/09/13/well/eat/how-the-sugar-industry-shifted-blame-to-fat.html

https://academic.oup.com/ajcn/advance-article/doi/10.1093/ajcn/nqz276/5680464?guestAccessKey=e676e010-0638-423b-a731-6c760b460bd4

https://www.stmichaelshospital.com/media/detail.php?source=hospital_news/2019/1230

https://jamanetwork.com/journals/jamainternalmedicine/article-abstract/2548255




Jumalauta! Ilmastohuijaus on totta

Jumalauta! Ilmastohuijaus on totta ja se on jatkunut jo vuosikymmeniä. Moni ei vain tiedä, kuinka syvälle tämän huijauksen juuret yltävät. Vetäkää foliohatut tiukemmalle, varmistakaa turvavyöt ja pukekaa sadevaatteet päälle, koska aion huuhtoa teidät syvälle salaliittojen synkkään ja haisevaan vessanpyttyyn.

Jos luulit, että nykyinen ilmastohysteria on vihervasemmistolainen vedätys, jonka tarkoituksena on kurjistaa tavallisten ihmisen elämää kaiken kulttuurimarxistisen hapatuksen, valkoisen rodun hallitun kansanmurhan ja eurooppalaisten kulttuurien järjestelmällisen tuhoamisen ohessa, luulit väärin! Ilmastohuijaus on totta, mutta niin on ilmastonmuutoskin

 Misinformaatio ja disinformaatio

Misinformaatio on tahattomasti levitettyä virheellistä tietoa. Disinformaatio on tarkoituksellisesti vääristeltyä tietoa tai tiedottamista. Molemmat vääristävät maailmankuvaa ja ohjaavat ihmisten mielipiteitä toivottuun suuntaan.

Nykyään nämä kaksi virheellisen tiedon tasoa kietoutuvat iloiseksi sotkuksi, jossa hevonpaskan epäsymmetriaperiaatteen mukainen väärän tiedon korjaaminen edellyttää enemmän työtä kuin väärän tiedon levittäminen. Kenelläkään ei ole aikaa kumota kaikkea kirjoitettua ja sanottua paskaa, koska hevonpaskan määrä kasvaa lähes eksponentiaalisesti.

Ilmastohuijaus on monitasoinen disinformaatiokampanja, joka on johtanut valtavaan määrään misinformaatiota. Tämä vaikuttaa yhteiskunnan kaikilla tasoilla politiikan huipulta Matti Meikäläisen mielipiteisiin. Öljyteollisuus tiesi fossiilisten polttoaineiden vaikutuksista ilmaston lämpenemiseen viimeistään heinäkuussa 1977, eli 11 vuotta ennen kuin julkinen keskustelu ilmaston lämpenemisestä alkoi.

Teollisuuden rahoittamista dis- ja misinformaatiokampanjoista huolimatta ilmastonmuutos on käytännössä kiistaton tieteellisiin havaintoihin, matemaattisiin laskelmiin ja pitkäaikaisiin tilastoihin perustuva fakta. Valitettavan monet meistä taviksista on omaksunut tarkoituksella tai tahattomasti levitettyä vääristeltyä tietoa ilmaston lämpenemisestä ja uskoo, että kyseessä on uusi ilmiö ja vihervasemmistolaisen median ylläpitämä poliittinen agenda.Lue tästä!

Anthropogenic Global Warming (AGW)

Ihmisen aiheuttama ilmastonlämpeneminen eli AGW on teoria, joka selittää ilmakehän keskilämpötilan nousua pitkällä aikavälillä teollisuuden ja maatalouden vaikutuksesta. Jo yli vuosisadan ajan tutkijat ovat olleet huolissaan siitä, että kun kasvihuonekaasujen pitoisuus ilmakehässä kasvaa, niin myös planeetan kyky sitoa lämpöä lisääntyy.

1900-luvun jälkipuoliskolta lähtien lisääntynyt tieto ja tehostuneet ilmastomallit ovat vakuuttaneet useimmat ilmastotieteilijät siitä, että kasvihuonekaasupäästöjen lisääntyminen ilmakehässä vaikuttaa suoraan ilmakehän lämpötilan kasvuun.

Kasvihuonekaasujen päästöjen lähde vaihtelee. Kasvihuonekaasut koostuvat kaasuseoksesta, joka sisältää lähinnä vesihöyryä, metaania, hiilidioksidia ja typpioksideja. Vaikka jotkin kasvihuonekaasujen lähteet – kuten tulivuoret – ovat luonnollisia, niiden kokonaispäästöjen määrä verrattuna teollisuuden, liikenteen, maanviljelyn ja karjatalouden tuottamiin päästöihin on merkitykseltään hyvin vähäinen.

Kasvihuonekaasut koostuvat molekyyleistä, jotka absorboivat sähkömagneettista säteilyä, kuten esimerkiksi planeetan pinnalta heijastavaa valoa, ja emittoivat säteilyn lämpönä. Näitä kaasuja ovat metaani, hiilidioksidi, vesihöyry ja typpioksidi. Vaikka vahvat kasvihuonekaasut muodostavat vain pienen osan ilmakehän kaasuseoksesta, ne ovat erittäin merkittäviä lämmönsitomiskykynsä vuoksi.

Jos meillä ei olisi luontaisesti esiintyviä kasvihuonekaasuja ilmakehässä, maapallon keskilämpötila olisi paljon alhaisempi kuin se on, eli noin -18 celsiusastetta. Maapallon 15 asteen keskilämpötila on mahdollistanut monimutkaisen elämän kehittymisen. Se on kasvihuoneilmiön ansio.

Hiilidioksiditasot ovat nousseet tasaisesti viimeisen kahden vuosisadan aikana, mikä johtuu pääasiassa fossiilisten polttoaineiden polttamisesta, metsien hakkuista ja maanviljelystä. Nykyiset pitoisuudet ovat noin 415 miljoonasosaa (ppm), kun hiilidioksiditaso esiteollisena aikana oli noin 280 ppm.

Maapallon keskilämpötila on noussut noin yhden asteen viimeisen puolen vuosisadan aikana. Ennusteet maapallon keskilämpötilan tulevasta kasvusta vaihtelevat eri ilmastomalleissa ja riippuvat kasvihuonekaasupäästöjen määrän kehityksestä. Hallitustenvälisen ilmastomuutospaneelin (IPCC) konservatiivisimmat arviot ennustavat 4 celsiusasteen nousun vuosisadan loppuun mennessä nykyisellä päästökehityksellä.

Ilmastohuijaus ja kuinka se toteutetaan

Exxon Mobil on rahoittanut ajatushautomoita, tutkijoita ja PR-yrityksiä kehittämään ja levittämään disinformaatiota ja kyseenalaistamaan ilmaston lämpenemiseen liittyviä havaintoja jo ainakin 1970-luvulta alkaen.

Nykyiset ilmastonmuutoksen epäilijät käyttävät ilmastonmuutosta vastustavia argumentteja, jotka on laadittu vuosikymmeniä sitten suurten korporaatioiden palkkalistoilla työskentelevien tutkijoiden, PR-ammattilaisten, konsulttien ja johtajien kokouksissa. Exxonin tarkoitus oli kumota tieteellinen näyttö ihmisen aiheuttamasta ilmastonmuutoksesta (AGW). Siinä se on onnistunut pelottavan hyvin.

Monet vuosikymmeniä vanhat valheet elävät ja voivat hyvin. Öljyteollisuus käytti tuotteidensa todellisten haittojen vähättelemiseksi samoja oppeja ja menetelmiä kuin tupakkateollisuus omien tuotteidensa valkopesuun.

Savua ja peilejä

Tupakka- ja öljyteollisuus käyttivät samoja tutkijoita disinformaatiokampanjoissa, joiden tarkoituksena oli valkopestä tutkimusten esiin nostamia tuoteturvallisuuteen ja ympäristöasioihin liittyviä epäkohtia.

Washingtonissa toimiva kansainvälisen ympäristölainsäädännön keskus (CIEL) on analysoinut Kalifornian yliopistoon tallennetuttuja asiakirjoja, jotka osoittavat, että öljy- ja tupakkateollisuus ovat tehneet yhteistyötä vuosikymmenien ajan. Tästä kirjoittaa mm. Scientific American

Molemmat teollisuudenalat palkkasivat vaikutusvaltaisen suhdetoimintayhtiön (Hill & Knowlton Inc.) vastaamaan tiedottamisesta. Tupakkateollisuuteen suotuisasti suhtautunut matematiikan professori Theodor Sterling sai Philip Morrisilta 1990-luvulla yli 200 000 dollaria tupakointiin liittyvästä tutkimuksesta. Sterling työskenteli bensiinin sisältämää lyijyä koskevien tutkimuksien parissa Ethyl Corp. -nimisessä General Motors Corp:n ja Standard Oilin yhteisyrityksessä vuonna 1962.

”Vuodesta 1950 lähtien öljy- ja tupakkayritykset käyttivät paitsi samoja PR-yrityksiä ja samoja tutkimuslaitoksia, myös monia samoja tutkijoita”, CIELin presidentti Carroll Muffett totesi lausunnossaan.

”Löysimme jatkuvasti sekä PR-yrityksiä että tutkijoita, jotka olivat ensin työskennelleet öljyteollisuudelle ja siirtyneet sitten tupakkateollisuuden palvelukseen,” Muffett sanoi.

CIEL ilmoitti ClimateWirelle tupakka-asiakirjojen olemassaolosta ja on vuosien ajan tutkinut, kuinka paljon öljyteollisuus tiesi ilmastonmuutoksesta ja mitä se teki ilmastonmuutokseen liittyen.

Uusi tutkimus on osa keskustelunavausta öljy-yhtiöiden vuosikymmenien aikana laatimista ilmastonmuutokseen liittyvistä tutkimuksista. Se on myös ympäristöjärjestöjen pyrkimys saada fossiilisia polttoaineita tuottavan teollisuuden yrityksiä oikeudelliseen vastuuseen vuosikymmeniä kestäneestä disinformaatio- ja valekampanjasta, jonka mukaan fossiilisten polttoaineiden päästöt eivät vaikuta ilmaston lämpenemiseen.

Vastaavalla tavalla tupakkateollisuus valehteli vuosikymmenten ajan, että tupakka ei aiheuta syöpää, vaikka teollisuuden omat tutkimukset osoittivat syövän ja tupakoinnin välisen yhteyden kiistattomasti.

Vuonna 2016 republikaanien Lamar Smith (edustajanhuoneen tiede-, avaruus- ja teknologia-asioiden johtaja) haastoi todistajiksi New Yorkin ja Massachusettsin syyttäjäviranomaisia sekä ympäristöjärjestöjä, jotka tutkivat, johtiko Exxon Mobil Corp. sijoittajia ja kansalaisia harhaan ​​ilmastomuutoksen uhista. Smith ja hänen kollegansa väittävät, että syyttäjät tekivät yhteistyötä ympäristönsuojelijoiden kanssa, ja että sellainen toiminta rikkoo Yhdysvaltain perustuslain ensimmäistä lisäystä vastaan.

Toinen yhteys öljy- ja tupakkateollisuuden välillä on CIEL:n mukaan Stanford Research Institute, joka irtaannuttuaan Stanfordin yliopistosta 1970 on tunnettu nimellä SRI International. Vuonna 1946 perustettu SRI tutki teollisuuden ja liikenteen aiheuttamaa savusumua sekä ympäristön saastumista, ja sai tutkimusrahoitusta tupakka- ja öljyteollisuudelta. SRI teki myös ilmastomuutostutkimusta American Petroleum Institute -yritykselle 1960- ja 70-luvuilla.

Vuonna 1968 New York Cityssä API:lle laaditussa raportissa SRI-tutkijat Elmer Robinson ja R.C. Robbins olivat epävarmoja hiilidioksidipäästöjen ja nousevien lämpötilojen välisestä suhteesta, mutta arvelivat, että hiilidioksidi oli todennäköisin ”kasvihuoneilmiön” voimistumisen syy.

”Jos maan lämpötilat nousevat huomattavasti, voidaan odottaa joukko seurauksia, kuten Etelämantereen jäätiköiden sulaminen, merenpinnan nousu, valtamerten lämpeneminen ja fotosynteesin lisääntyminen”, he kirjoittivat.

”Jos joko saasteiden ja hiilidioksidin pitoisuudet lisääntyvät ilmakehässä pitkällä aikavälillä merkittävästi, maapallon ympäristölle mahdollisesti aiheutuvat vahingot voivat olla vakavia”, Robinson sanoi.

”Jopa tällaisen tapahtuman kaukainen mahdollisuus oikeuttaa huolen”, lisäsi Robinson, joka oli yksi ensimmäisistä tutkijoista, joka yhdisti fossiilisten polttoaineiden palamisen ilmaston lämpenemiseen.

Ilmastohuijauksen jälkipyykki

Trumpin hallinnossakin pikaisesti piipahtanut Exxon Mobilin entinen toimitusjohtaja Rex Tillerson todisti valaehtoisesti, että yhtiö tiesi vuosia. että ihmisten aiheuttama ilmaston lämpeneminen (AGW) muodosti vakavan uhan koko maailmalle.

”We knew, we knew it was a real issue,” Tillerson said. ”We knew it was a serious issue and we knew it was one that’s going to be with us now, forevermore, and it’s not something that was just suddenly going to disappear off of our concern list because it is going to be with us for certainly well beyond my lifetime.” ’We knew’: Ex oil boss says climate change ’with us forevermore’

Tutkimus vahvistaa väitteet!

Tärkein syy sille, että emme ole kansakuntina reagoineet ilmastokriisin aiheuttamaan uhkaan riittävällä vakavuudella, vaikka monikansallisella yhteistyöllä estettiin happosateiden aiheuttama tuhot ja otsonikerroksen peruuttamattomat vauriot, on se, että teollisuus rahoittaa edelleen ilmastonmuutoksen vastaista disinformaatiokampanjaa ja estää ilmaston lämpenemisen ehkäisyyn tähtääviä toimia. Harvardin, George Masonin ja Bristolin yliopistojen tutkijoiden julkaisema raportti havaitsi samankaltaisuuksia tupakkayritysten ja öljyteollisuuden käynnistämien disinformaatiokampanjoiden väliltä.

Kampanjoiden tarkoituksena oli johtaa suurta yleisöä harhaan ja esittää tupakka- ja öljyteollisuus positiivisessa valossa. Molempien disinformaatiokampanjoiden tavoite on ollut yhtiöiden tuottoihin vaikuttavan lainsäädännön hidastaminen. Lue tästä. Raportin laatijat korostavat disinformaatiokampanjoiden soveltaneen taktiikkaa, joissa hyödynnetään väärennettyjä asiantuntijalausuntoja, lahjottuja tutkijoita, viitataan salaliittoteorioihin ja painotetaan vain omia etuja tukevia tutkimuksia. Lue tästä.

”Two days before ExxonMobil goes to court Wednesday, facing New York state accusations the oil company misled investors about climate change, a team of researchers released a report Monday outlining the company and the broader fossil fuel industry’s decades-long campaign of deception, and its success at confusing the American public.”

Exxon tiesi ilmastonmuutoksesta lähes 40 vuotta, mutta jatkoi disinformaatiokampanjan rahoittamista

Tutkimus paljastaa, että Exxon ymmärsi ilmastonmuutoksen jo paljon ennen kuin se tuli yleiseen tietoon, mutta rahoitti väärän tiedon levittämistä miljoonilla dollareilla. Lue Scientific American-lehden artikkeli tästä.

InsideClimate News -lehden julkaiseman tutkimuksen mukaan Exxon tiesi ilmastomuutoksesta jo vuonna 1977, 11 vuotta ennen kuin siitä tuli julkinen aihe. Tämä tieto ei estänyt yritystä (nykyään maailman suurin öljy- ja kaasualan yritys ExxonMobil) salaamasta tietojaan vuosikymmeniksi.

Sen sijaan, että Exxon olisi tiedottanut havainnoistaan, yhtiö aloitti disinformaatiokampanjan, jota on aiheellisesti verrattu tupakkateollisuuden vastaaviin toimiin. Molempien teollisuudenalojen johtajat ymmärsivät, että julkinen tieto tuotteiden todellisista riskeistä romahduttaisi yhtiöiden tuottoa niin paljon, että yritykset päättivät taloudellisten menetysten torjumiseksi turvautua samoihin konsultteihin ja näiden laatimiin PR-strategioihin.

Asiantuntijat eivät olleet tästä kovin yllättyneitä: ”Ei ole täysin epäuskottavaa, että he eivät ymmärtäneet tekemiään havaintoja”, sanoi Naomi Oreskes, Harvardin yliopiston professori.

Mutta sen lisäksi, että Exxon ymmärsi yhtiön tutkijoiden havainnot, yhtiö oli aktiivisesti mukana fossiilisten polttoaineiden ilmastovaikutusten tutkimuksessa. 1970- ja 1980-luvulla Exxon palkkasi useita huippututkijoita tutkimaan empiirisesti ilmastonmuutosta ja siihen vaikuttavia tekijöitä. Se myös käynnisti aihetta tutkivan kunnianhimoisen tutkimusohjelman ja käytti yli miljoona dollaria selvittääkseen, kuinka paljon hiilidioksidia valtameriin sitoutuu.

InsideClimate News haastatteli kahdeksan kuukautta kestäneessä tutkimuksessaan Exxonin entisiä työntekijöitä, tutkijoita ja liittovaltion virkamiehiä ja analysoivat satoja sivuja yhtiön asiakirjoja. He havaitsivat, että yhtiön tieto ilmastomuutoksesta juontaa juurensa heinäkuulta 1977, jolloin sen vanhempi tutkija James Black toimitti paljonpuhuvan viestin aiheesta. ”Ensinnäkin on olemassa yleinen tieteellinen konsensus siitä, että ihmiskunnan todennäköisin vaikutus globaaliin ilmastoon on fossiilisten polttoaineiden käytöstä vapautuva hiilidioksidi”, Black kertoi Exxonin hallintokomitealle.

Vuotta myöhemmin Black varoitti Exxonia siitä, että hiilidioksidikaasujen kaksinkertaistaminen ilmakehässä nostaisi keskimääräisiä globaaleja lämpötiloja kahdella tai kolmella asteella – luku, joka on nykyisen tieteellisen konsensuksen mukainen. Hän jatkoi varoittaen, että ”nykyisen ajattelun mukaan ihmisen aikaikkuna on viisi – 10 vuotta ennen kuin tarve tehdä kovia päätöksiä energiastrategioiden muutoksista saavuttaa kriittisen pisteen.”


Varmaa on, että kesäkuussa 1988, kun NASA:n tutkija James Hansen kertoi kongressin kuulemisessa planeetan lämpenemisestä, Exxon pysyi julkisesti siinä kannassa, että tiede oli edelleen kiistanalaista.  Asiantuntijat ovat miltei yksimielisiä siitä, että Exxonista tuli johtava disinformaatiokampanjoiden rahoittaja. Vuoteen 1989 mennessä yhtiö osallistui mm. maailmanlaajuisen ilmastokoalition perustamiseen (Global Climate Coalition). GCC:n tehtävä oli kyseenalaistaa ilmastonmuutoksen tieteellinen perusta ja siten hälventää ilmaston lämpenemiseen liittyviä huolia. GCC hajosi vuonna 2001.

GCC:n lobbaus vaikutti osaltaan siihen, että Yhdysvallat ei allekirjoittanut Kioton ilmastokokouksen pöytäkirjaa vuonna 1998. Siinä laadittiin suunnitelmat kasvihuonekaasujen päästöjen vähentämisestä. Kiina ja Intia seurasivat Yhdysvaltojen esimerkkiä ja jättivät Kioton pöytäkirjan allekirjoittamatta.

Asiantuntijat selvittävät edelleen Exxonin disinformaatiovaikuttamisen laajuutta ja vaikutuksia ilmastopolitiikkaan. Huolestuneiden tutkijoiden liitto julkaisi InsideClimate News -sivustolle täydentävän tutkimuksen, joka tunnetaan nimellä Climate Deception Dossiers (pdf).

”Liitteenä oli muistio fossiilisia polttoaineita tuottavien yhtiöiden koalitiosta, jossa ne lupaavat pohjimmiltaan aloittaa suuren viestintäponnistuksen epäilyjen synnyttämiseksi”, sanoi ammattiliiton presidentti Kenneth Kimmel. ”Siinä on jopa lainaus, jossa sanotaan: ” Voitto saavutetaan, kun keskiverto ihminen on epävarma ilmastotieteestä.

Exxonin disinformaatiokampanjoiden vaikutusta ilmaston lämpenemiseen ei voida koskaan täysin selvittää. Aiheutettu vahinko on joka tapauksessa todella merkittävä. Koska puolet ilmakehän kasvihuonekaasupäästöistä on syntynyt vuoden 1988 jälkeen, kasvihuonekaasujen vähentämiseen tähtäävien toimien aloittaminen viimeistään 1980-luvulla olisi merkittävästi rajoittanut kasvihuonekaasujen pitoisuuden kasvua ilmakehässä.

Greenpeace on laskenut, että Exxon on sittemmin käyttänyt yli 30 miljoonaa dollaria ilmastonmuutoksen tieteellistä perustaa epäilevien ajatushautomoiden rahoittamiseen ja disinformaation levittämiseen. Asiantuntijat ovat yhtä mieltä siitä, että vahingot ovat huomattavia, minkä vuoksi he vertaavat Exxonin petosta tupakkateollisuuden valheisiin. Molemmat kylvivät epäilyksen siemenen omin keinoin, ja molemmat työskentelivät yhdessä samojen konsulttien kanssa disinformaation levittämiseen tähtäävän kommunikaatiostrategian laatimisessa. Tupakkayhtiöiden toiminta uhkasi ihmisten terveyttä, mutta öljy-yhtiöiden ahneus ja piittaamattomuus uhkaa koko planeetan terveyttä.


Videolla Exxonin tutkija myöntää, että he tiesivät fossiilisten polttoaineiden käytön vaikutuksista ilmastonmuutokseen jo 1970-luvulla.

Demokraatit esittivät kongressille todisteita siitä, että ExxonMobil ymmärsi ilmastokriisin uhan jo 1970-luvulta alkaen ja esti tietoisesti ilmastokriisin torjumiseen tähtääviä toimia. Yksi todistajista oli Martin Hoffert, joka toimi tutkijana ja konsulttina 1980-luvulla (Exxon Research and Engineering). New Yorkin kongressiedustaja Alexandria Ocasio-Cortezille vastatessaan Hoffert todisti, että Exxonin tutkijat ennustivat jo vuonna 1982, kuinka hiilidioksiditasot nousevat ja lämmittävät planeettaa samalla kun fossiilisten polttoaineiden käyttö kasvaa. Videon kohdassa 6:45 Exxon myöntää rahoittaneensa disinformaatiota tuottavia ajatushautomoita.

Exxonin oma tutkija vahvistaa, että hiilidioksidipäästöt vaikuttavat globaalisti maapallon keskilämpötilan kasvuun ja varoittaa ilmaston lämpenemisen tulevista vaikutuksista. Lue liitteenä oleva asiakirja.


Tämä on ensimmäinen vertailu Exxon Mobilin sisäiseen sekä vertaisarvioituun ilmastonmuutosta käsittelevään tutkimukseen. On melko selvää, että heidän strategiansa oli sama kuin tupakkateollisuudella. Tiedon pimittäminen ja disinformaatio perustuivat taloudelliseen motiiviin. Tarkoituksena oli hidastaa erilaisia rajoitteita tuovan lainsäädännön syntyminen.

Exxon ennusti jo 1982 hyvin tarkasti mille tasolle hiilidioksidipäästöt nousevat ilmakehässä vuosien mittaan.

Yhtiön graafi osoittaa, että Exxonin tutkijat ymmärsivät ilmakehän fossiilisten polttoaineiden kulutuksen, hiilidioksidipitoisuuden ja lämpötilan kasvun korrelaation erittäin hyvin. Exxonin tutkijat laskivat, että hiilidioksidin pitoisuus ilmakehässä kasvaa 400-420 ppm tasolle vuoteen 2020 mennessä. Tällä hetkellä hiilidioksidin määrä ilmakehässä on 415 ppm, mikä tukee pelottavan tarkasti Exxonin ennakkoarviota.

Exxon ennakoi käsittämättömän tarkasti ilmakehän hiilidioksidipitoisuuden kasvun ja ymmärsi millaisia vaikutuksia sillä voi olla.

”Joidenkin tutkijoiden mukaan hiilidioksidipitoisuuden kasvu voi aiheuttaa erittäin mittavia ympäristöhaittoja, kuten Etelämantereen jäätiköiden sulamisen aiheuttaman merenpinnan kohoamisen seurauksena rannikkoseutujen lisääntyvät tulvat.”

Kiinnostavaa kyllä, hiilidioksidin merkitys kasvihuoneilmiön ja maapallon keskilämpötilan kasvun tärkeänä tekijänä on tunnettu öljyteollisuudessa 1950-luvulta alkaen.

Mutta mitä teet, jos kaikki maailman asiantuntijat ovat eri mieltä kanssasi? Tupakkateollisuuden orkestroima vuosikymmeniä vanha tekniikka on saada aikaan jatkuva debatti näennäisten asiantuntijoiden välityksellä.

Ilmastomuutos on monimutkainen, monitieteellinen tutkimuksenala, mutta monet kovaäänisimmistä ilmastonmuutoksen kieltäjistä eivät ole koskaan julkaisseet yhtään ilmastotutkimuksen liittyvää tutkimusta.

Myös Shell tiesi fossiilisten polttoaineiden päästöjen vaikutukset ilmastonmuutokseen jo 1980-luvulla Hollantilaisen uutistoimiston paljastamat yhtiön sisäiset asiakirjat osoittavat, että myös öljyjätti Shell ymmärsi viimeistään 1980-luvulla fossiilisten polttoaineiden päästöjen aiheuttavan ilmaston lämpenemistä. Asiakirjoista selviää, että Shell pohti vastuutaan toimia ilmastonmuutoksen estämiseksi. Shellin tutkijat kehottivat yhtiötä huomioimaan varhaiset varoitusmerkit, mutta uskoivat samalla, että fossiilisten polttoaineiden ja ilmaston lämpenemisen välisen korrelaation todistaminen tapahtuu aikaisintaan vuonna 2000.  ”Kun huomioidaan erittäin pitkän aikavälin asteikot, olisi yhteiskunnallisesti houkuttelevaa odottaa todisteiden varmistumista, ennen kuin toimitaan”, yrityksen tutkijat kirjoittivat vuonna 1988 laatimaansa raporttiin, joka perustui vuonna 1986 tehtyihin tutkimuksiin.

”Mahdolliset vaikutukset maailmalle ovat kuitenkin niin huolestuttavia, että poliittisia vaihtoehtoja on harkittava paljon aikaisemmin. Energia-alan on pohdittava, kuinka sen tulisi tehdä oma osuutensa. ” Shell-asiantuntijoiden ryhmä sanoi myös: ”Voi olla liian myöhäistä ryhtyä tehokkaisiin vastatoimenpiteisiin vaikutusten vähentämiseksi tai tilanteen vakauttamiseksi” 

Shell julkaisi väkevän AGW-elokuvan vuonna 1991

Lopuksi: Tämä tarina ei ollut tässä. Kupletin juoni jatkuu. Hiiliteollisuus on tiennyt fossiilisten polttoaineiden yhteydestä ilmastonmuutokseen jo vuodesta 1966 alkaen. Koitan ehtiessäni jatkaa tästä mielenkiintoisesta todellisesta ilmastohuijauksesta.

Vaikka juttu noudattaa salaliittoteorian perinteistä rakennetta, se lienee totta!. Asianosaiset ovat tunnustaneet nämä asiat mm. Yhdysvaltain kongressin kuulemisissa, tarinaa tukevia yhtiön sisäisiä asiakirjoja on löydetty satoja sivuja  ja tästä ovat uutisoineet hyvin luotettavina pidetyt mediat.

Mielestäni Yhdysvaltojen hallituksessakin vierailleen Exxonin entisen toimitusjohtajan, Rex Tillersonin todistus on uskottava. Myös se, että Shell Oil tiesi fossiilisten polttoaineiden yhteydestä ilmaston lämpenemiseen jo 1980-luvulla, on melko raskauttavaa. Shellin tekemä video vuodelta 1991 osoittaa, että ilmaston lämpenemisestä tiedettiin myös öljyteollisuuden johdossa paljon ennen kuin se nousi yleiseksi huolenaiheeksi.  

https://www.climatechangecommunication.org/wp-content/uploads/2019/10/America_Misled.pdf

Exxon Knew about Climate Change Almost 40 Years Ago

Fossil Fuel Execs Lied to the Public About Climate Science for Years

Exxon: The Road Not Taken

ExxonMobil’s four decades of climate science research | ExxonMobil

https://insideclimatenews.org/si…

Exxon Confirmed Global Warming Consensus in 1982 with In-House Climate Models 

Smoke & Fumes

Shell Knew Fossil Fuels Created Climate Change Risks Back in 1980s, Internal Documents Show

Massachusetts Sues Exxon Over Climate Change, Accusing the Oil Giant of Fraud

Globally, how many warming/cooling cycles have occurred in the last 5,000 years?

 

 

 




Ketoherkut: Kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatti

Juu. Tiedetään. Ketoilu on hidas itsemurha. Ketoilijan päivän salaattina esittelen ihanan ja täydellisen kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatin. Bon Appetit!

Raaka-aineet:

Kylmäsavugraavilohi (n. 100 g jäi joulusta)
Tonnikala öljyssä (purkki)
Aurinkokuivatut tomaatit (kourallinen siivutettuina)
Marinoituja latva-artisokkia (kourallinen siivutettuina)
Kalamata-oliiveja (kourallinen puolikkaina)
Fetaa (n. 100 g kuutioituna)
Cosmopolitan-salaattia (aika paljon ja maun mukaan)
Eri värisiä kirsikkatomaatteja (n. 200 g puolikkaina)
Paprikaa (ohuina suikaleina yksi riittänee)
Kesäkurpitsaa (noin 15 cm pätkä)
Sipuli (pieneksi hienonnettuna)
Puolikkaan sitruunan mehu
Kreikkalainen jogurtti (pari runsasta ruokalusikallista)

Oma currymajoneesi

1 muna
2,5 dl öljyä
1 tl suolaa, mustapippuria ja valkosipulijauhetta
2-4 tl curryjauhetta
Korkillinen roseviinietikkaa tai etikkaa
1-2 rkl kreikkalaista jogurttia

Leikkasin raaka-aineet sopivan kokoisiksi siivuiksi isoon kulhoon. Puristin päälle puolikkaan sitruunan mehun ja lisäsin pari reilua ruokalusikallista kreikkalaista jogurttia. Majoneesin olin tehnyt aiemmin.

Helpoin tapa tehdä mahtavaa majoneesia on lisätä 2,5 dl rypsiöljyä ja 1 muna korkeaan ja kapeaan astiaan. Päälle lisätään korkillinen roseviinietikkaa tai etikkaa sekä muut mausteet. Annetaan seisoa lämpimässä 10-20 minuuttia. Asetetaan sauvasekoitin kapean astian pohjaan, käynnistetään ja nostetaan sauvasekoitinta hitaasti noin 10 sekunnin aikana ylöspäin. Jos käy niin ikävästi, että majoneesi juoksettuu, sen voi korjata lisäämällä yhden munan öljyyn ja sauvasekoittamalla uudestaan. Kun majoneesi valmistuu, siihen voi lisätä 1-2 rkl kreikkalaista jogurttia, joka tekee siitä hieman pehmeämmän.

Kruunasin salaatin currymajoneesilla ja sekoitin. Annoin salaatin makuuntua jääkaapissa tunnin verran. Tämä oli paras salaatti ikinä. Onnellista alkavaa vuotta kaikille!




Salaperäiset sirtuiinit

Salaperäiset sirtuiinit tehostavat solujen aineenvaihduntaa, hidastavat ikääntymistä, säätelevät geenien aktiivisuutta ja suojaavat aivoja. Mutta mitä sirtuiinit ovat ja miten ne vaikuttavat aineenvaihduntaan?

”Jo 1930-luvulta asti on tiedetty, että energiarajoitus pidentää jyrsijöiden elinikää. Nimenomaan energiamäärä (noin 60-70 % normaalista) eikä energian lähde näyttää tässä suhteessa olevan ratkaiseva tekijä. Energiamäärän vähentäminen saa aikaan kehon lämpötilan laskun sekä glukoosi- ja insuliinipitoisuuden, painon ja rasvamäärän vähenemisen (Guarente ja Picard 2005). Vähäinen energiansaanti tekee eläimet resistentiksi ulkoisille stressitekijöille, kuten oksidatiiviselle stressille. Tämä on tärkeä sopeutumismekanismi, sillä ikääntymisen uskotaan liittyvän ROS:n (reactive oxygen species) muodostukseen.”- Professori Markku Laakso / Duodecim


Johdanto

Nyt syntyviä sukupolvia odottavat ilmastonmuutoksen, hallitsemattoman väestönkasvun ja taloudellisesti yhä selvemmin jakaantuneen maailman asettamat haasteet.

Toisaalta lääketieteellinen kehitys ja ymmärrys geenien toiminnasta lupaa tuleville sukupolville pitkää ja tervettä elämää. Eräs mullistavimmista lääketieteellisistä keksinnöistä viime vuosina on ollut CRISPR-Cas-9 geenisakset, joilla DNA:sta voidaan leikata viallisia jaksoja ja korvata ne terveillä jaksoilla. Samaan aikaan ymmärrys ikääntymisestä ja siihen vaikuttavista aineenvaihduntamekanismeista on täsmentynyt.

Salaperäiset sirtuiinit ohjaavat ja tehostavat solujen rasva-aineenvaihduntaa silloin kun glukoosin saanti on vähäistä. Niukka energiansaanti käynnistää aineenvaihdunnan luonnollisen sopeutumismekanismin, johon osallistuu SIRT1-geeni. Sirtuiinit ovat NAD+ -riippuvaisia solujen apoptoosia, tulehdusvastetta, solujen elämänkaarta, geenitranskriptiota ja aineenvaihduntaa sääteleviä proteiiniasetylaaseja.



NAD+ eli nikotiiniamidiadeniinidinukleotidi ja proteiiniasetylaasit

Molekyylibiologiaan harjaannuttamattoman silmissä nämä sanat ovat silkkaa hepreaa. Mitä ne tarkoittavat ja mitä helvettiä ne meille tekevät? Vaikeilla sanoilla on miltei maagisia tarkoituksia. Mitä koentsyymit, kofaktorit ja entsyymit ovat?

NAD+ on kaikissa elävissä soluissa esiintyvä koentsyymi. Koentsyymit (tai kofaktorit) ovat orgaanisia molekyylejä tai epäorgaanisia metalli-ioneja, joka entsyymin on sidottava itseensä toimiakseen kemiallisia reaktioita katalysoivana entsyyminä.

Monet koentsyymeistä ovat vitamiineja, osa metalleja, kuten kofaktori-ionit Mn2+, Mg2+ ja Zn2+. Entsyymi, johon ei ole sitoutunut sen luontaista kofaktoria tai kofaktoreita on toimimaton apoentsyymi. Koentsyymi muodostaa entsyymin proteiiniosan eli apoentsyymin kanssa toimivan entsyymin.

Epäorgaanisia kofaktoreita ovat mm. ravinnosta saatavat metalli-ionit Cu2+, Fe2+ tai Fe3+, K+, Mg2+. Arvaatte varmaan, että näitä on paljon enemmän, mutta eiköhän pointti selvinnyt.

Nämä epäorgaaniset kofaktorit muodostavat apoentsyymien kanssa entsyymejä, kuten: sytokromi-c-oksidaasin, katalaasin, peroksidaasin, pyryvaattikinaasin, heksokinaasin ja glukoosi-6-fosfataasin.

Monet orgaanisista koentsyymeistä ovat vitamiineja tai niiden johdannaisia, kuten biosytiini, koentsyymi A, 5’-deoksiadenosyylikobolamiini, flaviiniadeniinidinukleotidi, lipoaatti, NADH/NAD+, pyriokdaalifosfaatti jne. Näiden koentsyymien esiasteet ovat vitamiineja, kuten biotiini (B7), pantoteenihappo(B5), B12, riboflaviini (B2), niasiini (B3), B6, folaatti (B9) ja tiamiini (B1).

Entsyymit ovat kemiallisia aineenvaihduntareaktioita nopeuttavia biologisia katalyytteja. Ne ovat yleensä proteiineja, mutta myös RNA-molekyylit eli ribotsyymit voivat olla entsyymejä. Entsyymien vaikutus perustuu niiden kykyyn alentaa substraattiin kohdistuvan reaktion aktivaatioenergiaa. Ilman entsyymejä kemialliset reaktiot tapahtuisivat soluissa liian hitaasti, eikä elämä olisi mahdollista. Nopeimmat entsyymit muuttavat jopa 40 miljoonaa molekyyliä reaktiotuotteiksi sekunnissa.


NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa biologisissa hapetus-pelkistysreaktioissa.

Nikotiiniamidiadeniinidinukeotidi muistuttaa kemialliselta rakenteeltaan toista tärkeää koentsyymiä, nikotiiniamidiadeniinidinukleodifosfaattia (NADP+). NAD+ osallistuu katabolisiin aineenvaihduntareaktioihin ja NADP+ on tärkeä koentsyymi anabolisissa reaktioissa.

Kataboliset aineenvaihduntareaktiot pilkkovat monimutkaisia molekyylejä yksinkertaisemmiksi ja anaboliset aineenvaihduntareaktiot rakentavat yksinkertaisemmista molekyyleistä suurempia ja monimutkaisempia molekyylirakenteita.

Eliöt tuottavat NAD+:a kahdella tavalla:

1. Geenien säätelemässä de novo-synteesissä tryptofaanista (aminohappo) syntetisoidaan ensin kinoliinihappoa, joka muutetaan nikotiinihappomononukleotidiksi ja edelleen nikotinaattinukleotidiadenyylitransferaasientsyymin avulla desamino- NAD+:ksi.
NAD+ syntaasientsyymi muuttaa desamino- NAD+:n nikotiiniamidiadeniinidinukleotidiksi.

2. NAD+-biosynteesiä tapahtuu myös nikotiiniamidista, joka prosessoidaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

Proteiiniasetylaasit ovat asetyyliryhmään kiinnittyviä proteiineja. Deasetylaasit poistavat osia asetyyliryhmästä. Nisäkkäillä tunnetaan seitsemän erilaista ja erilaisiin reaktioihin osallistuvaa sirtuiinia. Esimerkiksi SIRT1-3 ja SIRT5 ovat deasetylaaseja. Solun tumassa on SIRT1:tä, SIRT6:ta ja SIRT7:ää. Mitokondrioissa on puolestaan SIRT3-5:tä ja solulimassa SIRT2:ta.

Mitä ne sirtuiinit siellä soluissa tekevät?

SIRT1 säätelee aineenvaihduntaa ja solujen elinkaarta
SIRT2 ja SIRT6 saattavat vaikuttaa kasvaimien kehittymiseen ja syöpään
SIRT3 ja SIRT4 osallistuvan aineenvaihdunnan säätelyyn
SIRT4 liittyy aminohappovälitteiseen insuliinin eritykseen

SIRT1 vaikuttaa erityisesti energia-aineenvaihdunnan kannalta keskeisissä kudoksissa, kuten haimassa, maksassa ja rasvakudoksessa. SIRT1:n aktivoituminen lisää insuliiniherkkyyttä ja laskee glukoosi- ja insuliinipitoisuuksia.

Koska SIRT1 on PPAR*-estäjä (*peroxisome proliferator-activated receptor), se kiihdyttää rasvakudoksen lipolyysiä vapauttamalla rasvakudoksiin varastoituja rasvahappoja verenkiertoon.


Lipolyysi vs. lipogeneesi

Lipolyysi pilkkoo rasvasoluihin varastoituja triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu verenkierron mukana maksaan, ja rasvahapot energialähteiksi luurankolihaksille, maksalle ja sydämelle.

Lipolyysi aktivoituu paaston ja vähän hiilihydraatteja sisältävän ruokavalion yhteydessä hormonaalisesti lipolyyttisten hormonien: glukagonin, kortikotropiinin, adrenaliinin ja noradrenaliinin vaikutuksesta.

Lipolyysin tarkoitus on säästää glukoosia punasoluille ja hermosoluille, jotka eivät pysty käyttämään rasvahappoja energiantuotannossa. Lipolyysille vastakkainen aineenvaihduntareaktio on lipogeneesi, joka prosessoi ja varastoi ylimääräisiä sokereita rasvahapoiksi.

Insuliini osallistuu ravinnon soluun pääsyyn sekä ravinteiden varastoimiseen lihas-, maksa- ja rasvasoluihin. Glukagoni ja muut lipolyyttiset hormonit purkavat solujen sokeri- ja rasvavarastoja verenkiertoon, jolloin niitä voidaan käyttää solujen energiantuotannossa.

Lipolyysiä ohjaa lipaasi. Kun haima erittää vereen insuliinia, lipolyysi estyy. Rasvakudos on herkkä insuliinin säätelylle. Kun veren insuliinipitoisuus laskee, lipolyyttiset hormonit ohjaavat lipaasin toimintaa. Tämä käynnistää lipolyysin ja rasvahappoja vapautuu rasvasoluista vereen.

Veren mukana soluihin kulkeutuneista rasvahapoista tuotetaan beetaoksidaatiossa asetyylikoentsyymi-A:ta, joka on kaikille energiaravinteille yhteinen väliaine sitruunahappokierrossa. Asetyylikoentsyymi-A voi jatkaa solujen energiantuotantoa mitokondrioissa tapahtuvassa sitruunahappokierrossa, jos glukoneogeneesi ei ole käynnissä.

Kun SIRT1 aktivoituu, insuliinin eritys haimasta lisääntyy. SIRT1myös suojaa haiman beetasoluja oksidatiiviselta stressiltä.

PCG-1:n*-aktivoituminen (*peroxisome proliferator-activated receptor gamma coactivator-1) lisää glukoosin syntetisoimista maksassa osana SIRT1-aktivaatiota. PCG-1 kasvattaa mitokondrioiden määrää ja kokoa sekä kiihdyttää rasvahappojen hapettumista beetaoksidaatiossa. Nämä tekijät yhdessä vaikuttavat suotuisasti glukoosin aineenvaihduntaan.

SIRT1 suojaa keskushermoston soluja neurodegeneratiivisilta prosesseilta. Punaviinin, mustikoiden, viinimarjojen ja karpaloiden sisältämä fenoliyhdiste resveratroli on SIRT1-aktivaattori, joka lisää PCG-1-aktivaatiota. Tämä on tutkimuksissa tehostanut mitokondrioiden toimintaa, energiankulutusta ja hapenottokykyä. Se voi lisätä myös solujen insuliiniherkkyyttä ja laskea rasvamaksaan sairastumisen riskiä.

Resveratroli on eläinkokeissa suojannut runsaasti energiaa ravinnosta saavia hiiriä lihomiselta estämällä PPAR:n* (*peroxisome proliferator-activated receptor) aktivaation. SIRT1 voi vaikuttaa suotuisasti aikuistyypin diabetekseen, sillä se lisää solujen insuliiniherkkyyttä ja haiman insuliinin eritystä, sekä laskee painoa ja kehoon varastoituneen rasvan määrää.

Yhteenveto

SIRT1 (Silent Information Regulator 1) osallistuu useisiin aineenvaihduntaprosesseihin ja energia-aineenvaihdunnan säätelyyn. SIRT1 vaikuttaa lihavuuteen ja aikuistyypin diabetekseen säätelemällä rasvojen aineenvaihduntaa ja mitokondrioiden biogeneesiä.

Sirtuiinien hermoja ja aivosoluja suojaava vaikutus perustuu toisaalta SIRT1:n oksidatiivista stressiä vähentävään vaikutukseen ja toisaalta SIRT1:n kykyyn vähentää tulehdusvastetta sitoutumalla NF-kB*:en (Nuclear Factor-kappaB) ja siten ehkäistä hermosoluissa tapahtuvaa neurodegeneraatiota ja atrofiaa.


NF-kB


Hiirikokeissa sekä akuutit, että pitemmän ajan kuluessa syntyvät hermosoluvauriot johtavat lähes aina aivojen mikrogliasolujen aktivaatioon. M1-tyypin mikrogliat erittävät tulehdusta edistäviä sytokiineja, jotka lisäävät osaltaan hermosolujen atrofiaa, kun taas M2-tyypin solut poistavat kuolleita soluja ja erittävät vaurioituneisiin hermoston osiin erilaisia kasvutekijöitä.

Keskeisenä tulehdusreaktioiden välittäjänä toimii transkriptiotekijä, tumatekijä kappaB (NF-kB) ja erityisesti sen p50/105-alayksikkö. Hiirikokeissa havaittiin, että NF-kB p50/105-alayksiköllä on merkittävä rooli aivojen tulehdusreaktioiden välittäjänä ja sitä kautta aivojen uusien hermosolujen muodostumisessa. NF-kB p50/105-alayksikön puuttumisen vaikutus vaihtelee eri tautimalleissa ja eri ikäisillä hiirillä.  (Taisia Rõlova)

”Tulehdus on immuunijärjestelmän aikaansaama reaktio, jonka avulla elimistö pyrkii vastaamaan infektioon tai kudosvaurioon ja korjaamaan sen. Matala-asteinen krooninen tulehdus on häiriötila, joka voi ylläpitää tulehdusvasteita kudoksissa aineenvaihdunnan muutosten kautta ja johtaa edelleen kudosvaurioihin sekä altistaa monille sairauksille, kuten astmalle, Alzheimerin taudille, sydän- ja verisuonitaudeille ja erilaisille syöville.”- Anu Wiklund

VIDEO


OSA 1: Energia-aineenvaihdunnan perusteet


Evoluution seurauksena ihmiselle on kehittynyt tehokkaita selviytymismekanismeja toisaalta adaptiivisen immuunijärjestelmän kautta erilaisia taudinaiheuttajia vastaan, ja toisaalta turvaamaan välttämättömät elintoiminnot silloinkin, kun ravintoa ei ole riittävästi saatavilla.

Terve nuori aikuinen selviää pelkällä vedellä kolmisenkymmentä vuorokautta. Aineenvaihdunta käyttää energianlähteenä ensimmäiseksi elimistön sokeri- ja rasvavarastot, mutta ravinnonpuutteen jatkuessa myös lihasten proteiineja käytetään energian lähteenä välttämättömien elintoimintojen turvaamiseksi.

Nykyinen yltäkylläisyys ja ravinnon helppo saatavuus on uusi ilmiö. Meille ruoka ja sen vaivaton saatavuus on itsestäänselvyys, mutta kaukaiset esivanhempamme joutuivat elämään pitkiäkin aikoja hyvin niukalla ravinnolla tai kokonaan ilman ruokaa.

Varhaiset ihmiset söivät silloin, kun ravintoa oli tarjolla ja paastosivat, kun ruokaa ei ollut. Ravinnosta saatu ylimääräinen energia varastoitiin rasva- ja lihassoluihin. Lihominen auttoi ihmisiä selviämään niukoista ajoista.

Toisaalta ravinnon saatavuuden epävarmuus on ilmeisesti vaikuttanut erilaisten biologisten selviytymismekanismien kehittymisen lisäksi eräänlaisen psykologisen selviytymismoodin syntymiseen. Nälkäinen ihminen valpastuu, aistit tarkentuvat, keskittymiskyky paranee, ympäristön hahmottaminen tehostuu, päätöksenteko nopeutuu jne. Tälle on biokemialliset ja hormonaaliset syyt. Väitän, että hieman nälkäinen ihminen on älyllisesti ja fyysisesti parhaimmillaan. Se on asia, josta toki voi kiistellä.

Sokeria vai rasvaa? Kuinka solut saavat energiaa?

Kaikki solut voivat käyttää glukoosia energianlähteenä. Solujen sytoplasmassa tapahtuva glykolyysi pilkkoo glukoosimolekyylin kahdeksi pyruvaatiksi, mikä tuottaa kaksi runsasenergistä ATP-molekyyliä. Kummastakin pyruvaatista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Aminohapot, hiilihydraatit ja rasvahapot on muutettava asetyyliryhmiksi ja liitettävä koentsyymi-A:han, jotta ne pääsevät mitokondriossa tapahtuvaan sitruunahappokiertoon. Sitruunahappokierrossa pyruvaateista saadaan vielä kolmisenkymmentä ATP-molekyyliä. Tämän soluhengityksen lopputuotteena on vettä ja hiilidioksidia.

Myös rasvaa (ja proteiineja) voidaan käyttää energian tuottamiseen. Aineenvaihdunta osaa käyttää esimerkiksi eräitä proteiineista saatavia ja vapaita aminohappoja glukoosia tuottavassa glukoneogeneesissä.

Rasvojen energia-aineenvaihdunnan perusta on beetaoksidaatio, ketoosi ja ketogeneesi. Solujen kannalta hiilihydraateista saatava glukoosi on kaikkein helpoin ja nopein energianlähde. Siihen aineenvaihduntamme on totutettu lapsesta alkaen. Rasvan ja proteiinien muuttaminen energiaksi kelpaavaan muotoon edellyttää useita aineenvaihduntareaktioita.

Lähtökohtaisesti keho suosii siis hiilihydraatteja energianlähteenä. Hiilihydraatit pilkotaan sokereiksi, jotka imeytyvät ohutsuolen epiteelin läpi verenkiertoon. Glukoosi kohottaa verensokeria ja haima reagoi glukoosipitoisuuden kasvuun erittämällä vereen insuliinia. Insuliinimolekyyli kiinnittyy solun pinnassa olevaan insuliinireseptoriin ja toimii kuin avain, joka avaa solun glukoosimolekyyleille.

Fruktoosi prosessoidaan maksassa ensisijaisesti glykogeeneiksi eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi. Nämä ovat nopeita varastosokereita. Osa fruktoosista muutetaan glukoosiksi, joka vapautuu verenkiertoon ja 1-2 % fruktoosista muutetaan triglyserideiksi.

Myös veressä oleva ylimääräinen glukoosi muutetaan mahdollisuuksien mukaan lihasten glykogeeneiksi. Glykogeenivarastojen rajallisen koon vuoksi osa glukoosista varastoidaan rasvasoluihin ja muutetaan rasvasolussa tapahtuvassa lipogeneesissä triglyserideiksi.

Veren glukoosipitoisuuden laskiessa haiman alfasolut erittävät vereen glukagonia, joka vapauttaa maksan glykogeenivarastoista glukoosia vereen ja lihasten glykogeeneistä glukoosia lihasten käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.



Entä sitten kun sokerivarastot loppuvat?


Maksan ja lihasten sokerivarastot voivat loppua paastotessa, hyvin niukkaenergisellä ruokavaliolla tai hiilihydraattien saantia rajoitettaessa. Tällöin elimistön on turvauduttava varastoimaansa energiaan eli läskiin.

Veren glukoosipitoisuuden laskun seurauksena vereen erittyy lipolyyttisiä hormoneja: glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia. Näiden vaikutuksesta elimistön rasva-aineenvaihdunta tehostuu.

Ketoaineiden tuotanto

Lipolyysi purkaa rasvasolujen triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu maksaan, jossa sitä voidaan hyödyntää mm. glukoosia syntetisoivassa glukoneogeneesissä.

Soluihin kulkeutuvat vapaat rasvahapot pilkotaan beetaoksidaatiossa asetyylikoentsyymi-A:ksi. Glukoneogeneesin yhteydessä asetyylikoentsyymi-A:ta ei voida hapettaa normaalisti mitokondrioissa, vaan ylimääräisestä asetyylikoentsyymi-A:sta muodostetaan 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-syntaasin katalysoimana 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A:ta (HMG-KoA) ja edelleen mitokondrioissa 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-lyaasin (HMG-KoA-lyaasi) katalysoimassa reaktiossa ketoaineita: asetoasetaattia ja siitä edelleen betahydroksibutyraattia ja asetonia.

Asetyylikoentsyymi-A on kaikille ravintoaineille yhteinen väliaine solun valmistaessa energiaa. Sen asetyyliryhmän hiilet hapettuvat hiilidioksidiksi sitruunahappokierrossa (Krebsin sykli) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio

Oksidatiivinen fosforylaatio on elektroninsiirtoketjusta ja ATP-syntaasista koostuva aineenvaihduntareitti. Happea käyttävien solujen ATP-energiasta noin 90 % syntyy oksidatiivisessa fosforylaatiossa eli kun ravintoaineet hapettuvat ja energia sitoutuu suurienergisiin fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio, glykolyysi ja sitruunahappokierto päättävät solun katabolisen energiantuotannon. Glykolyysissä, rasvahappojen oksidaatiossa ja trikarboksyylihappokierrossa muodostuneiden pelkistyneiden koentsyymien (NADH ja FADH2) elektronit siirtyvät oksidatiivisen fosforylaation elektroninsiirtoketjuun. Nämä elektronit pelkistävät happimolekyylit vedeksi, jolloin vapautuva energia sitoutuu ATP:nä.

Yhdestä glukoosimolekyylistä saadaan noin 30 suurienergistä ATP-molekyyliä.

Katabolisessa aineenvaihdunnassa pienimolekyyliset yhdisteet (aminohapot, monosakkaridit, rasvahapot) pilkotaan ja ”poltetaan” solujen energiaksi. Kaikkien energiaravinteiden yhteinen väliaine on asetyylikoentsyymi-A.

Asetyylikoentsyymi-A voidaan pilkkoa sitruunahappokierrossa, jossa sen hiiliatomit hapettuvat hiilidioksidiksi ja vetyatomit siirtyvät hapetus-pelkistysreaktioissa keoentsyymeille (NADH ja FADH2) Nämä siirtävät vetyä sitruunahappokierron ja elektroninsiirtoketjun välillä. Koentsyymit menettävät elektronit ja hapettuvat NAD+:ksi ja FAD:ksi, jotka jatkavat kiertoa.

Osa 2: Ketoosi ja sirtuiinit

Ketoosi kiihdyttää sirtuiinien aktivaatiota soluissa. Sirtuiinit kuuluvat histonideasetylaaseihin (HDAC). Ne ovat proteiineja, jotka poistavat asetyyliryhmän geenin histonista ja näin ”sammuttavat” geenin ilmentymisen eli ekspression.

Jokainen solu sisältää yksilön jokaisen geenin, mutta geeni ilmentyy vain tietyissä soluissa, ja joskus vain tiettyyn aikaan. Sammutettua geeniä ei lueta proteiinin valmistuksessa.

Ketoosi lisää sirtuiini1:en (SIRT1) määrää hippokampuksen eli aivoturson alueella ohimolohkojen sisäosissa korvien lähellä. Kummankin ohimolohkon hippokampus on yhteydessä toiseen ja hypotalamukseen aivokaaren välityksellä.

Nyt liikutaan kiistanalaisilla vesillä. Vuosittain arviolta 2,8 miljoonaa ihmistä kuolee lihavuuden aiheuttamiin komplikaatioihin. Tutkimuksissa on havaittu, että väestöjen keskimääräinen älykkyys laskee. Voisiko olla niin, että runsasenerginen ravinto ei tuhoa vain terveyttämme, vaan myös kognitiiviset kykymme? Voisimmeko elää nälässä terveempinä ja älykkäämpinä. Siinä on provokatiivinen keskustelunaihe kahvipöytään.


Hippokampus ja deklaratiivinen muisti



Hippokampus osallistuu muistitoimintoihin. Erityisen tärkeä hippokampus on deklaratiivisen muistin eli säilömuistin toiminnassa. Deklaratiivinen muisti jakautuu semanttiseen ja episodiseen muistiin. Semanttiseen muistiin tallentuvat asiat, joiden merkitys ymmärretään. Episodimuistiin tallentuu välähdyksenomaisia muistoja tapahtumista. SIRT1-puutos aiheuttaa kognition, muistin ja suunnitelmallisuuden häiriötilan.

”Li-Huei Tsai’s group found that Sirt1 regulates memory by forming a complex that downregulates microRNA miR-134.  This microRNA targets mRNA transcripts for the key learning and memory genes CREB and BDNF, so by keeping miR-134 low, Sirt1 promotes memory formation by keeping CREB and BDNF levels high.”

2016 tehdyssä tutkimuksessa (Heyward et al.) havaittiin, että jatkuvasti liikaravittujen hiirien muistitoiminnot heikkenivät ja hippokampuksen sirt1-pitoisuudet laskivat. Muistia ja oppimista säätelevien geenien ekspression heikkeneminen assosioitui DNA:n lisääntyneeseen metylaatioon.

Tutkijat raportoivat myös SIRT1-geeniin liittyvän DNA:n hydroksimetylaation vähenemisestä. Runsaasti energiaa sisältävän ravinnon aiheuttama DNA:n metylaatio hiirillä alleviivaa ympäristövälitteisten epigeneettisten muutosten vaikutuksia geenin ilmentymiseen.

Hydroksimetylaation merkitys aivojen toiminnalle on yhä arvailujen varassa, mutta tutkijat uskovat, että hydroksimetyloitunut DNA estää eräiden repressiivisten kompleksien sitoutumisen DNA:han.

Kolmas ruokavalioon liittyvä havaittu epigeneettinen mekanismi on, että yksi kolmesta ketoainetyypistä, betahydroksibutyraatti on itsessään endogeeninen HDAC-estäjä. Vaikka sirtuiinit estävät muistin repressoreita (torjujat?), toiset HDAC-luokan histonideasetylaasit voivat estää muistia parantavien geenien toimintaa. Tällaisten histonideasetylaasien estäjät parantavat muistin toimintaa ja niillä on suuri terapeuttinen potentiaali.

Moses Chaon tutkijaryhmä havaitsi, että betahydroksibutyraatti lisää hippokampuksen BDNF-expressiota estämällä HDAC2:ta ja HDAC3-5:tä. Käänsin edellisen kappaleen niin sekavasti, että täsmennetään: betahydroksibutyraatti parantaa muistiin vaikuttavien geenien ilmentymistä estämällä eräitä histonideasetylaaseja.

Eläinkokeiden perusteella ravinnosta saadun energian rajoittaminen ja ketogeeninen ruokavalio suojaavat aivojen soluja, tehostavat muistia ja parantavat kognitiivisia toimintoja. Vastaavasti runsasenerginen ja hiilihydraattipainotteinen ravinto ylläpitää oksidatiivista stressiä ja kasvattaa neurodegeneratiivisten muutosten riskiä.  Eräässä lievistä muistivaikeuksista kärsivillä vanhuksilla toteutetussa tutkimuksessa kuuden viikon vähähiilihydraattinen ruokavalio paransi koehenkilöiden verbaalista muistia. Toisessa kokeessa terveille nuorille aikuisille annettiin annos glukoosia. Kognitiivisia kykyjä mitattiin ennen glukoosia ja sen jälkeen. Tässä tutkimuksessa nuorten kognitiiviset kyvyt heikkenivät 20 minuuttia glukoosiannoksen jälkeen.

Ketogeeninen ruokavalio säätelee NAD+-riippuvaisia entsyymejä ja vähentää DNA:n vaurioita hippokampuksen alueella

Ketogeenisen ruokavalion (KD) epileptisia kohtauksia vähentävät vaikutukset on hyvin dokumentoitu. Ketogeeninen ruokavalio on joillain lapsilla ainoa tehokas keino vähentää epilepsiaan liittyviä kohtauksia.

Hiljattain on havaittu ketogeenisen ruokavalion terapeuttinen potentiaali useiden neurodegeneratiivisten sairauksien hoidossa. Kokeellinen todistusaineisto ketoruokavalion hyödyistä on kuitenkin edelleen puutteellista.

Rotilla tehdyssä tutkimuksessa on osoitettu, että ketogeenistä ravintoa saavien rottien hippokampuksen alueen solujen nikotiiniamidiadeniinidinukleotidi+ (NAD+) -tasot kasvavat.

NAD+ on soluaineenvaihdunnan toiminnalle välttämätön koentsyymi, signalointimolekyyli, soluterveyden markkeri sekä pitkäikäisyyteen ja DNA:n vaurioiden korjaamiseen osallistuvien entsyymien, kuten sirtuiinien ja poly-ADP riboosi polymeraasi-1:n (PARP-1) substraatti.

NAD+-riippuvaisten entsyymien aktivaatio voi selittää laajemminkin ketogeenisen ruokavalion hyödyllisiä vaikutuksia. En mene tarkemmin tuon rottakokeen arviointiin, mutta sen tulokset olivat hyvin rohkaisevia aivojen terveyden osalta.

Miten ketogeeninen ruokavalio suojaisi aivoja?

Ketogeeninen (KD) eli LCHF-ruokavalio sisältää hyvin niukasti hiilihydraatteja, runsaasti rasvoja ja kohtuullisesti proteiineja. Hiilihydraattien määrä rajoitetaan noin 10 prosenttiin päivittäisestä energiansaannista. Suurin osa päivittäisestä energiasta saadaan rasvasta, jonka määrä voi olla 60-70 % päivittäisestä energiansaannista. Proteiinien saanti pidetään 20-30 prosentin tasolla päivittäisestä energiansaannista.

KD ohjaa energia-aineenvaihdunnan helpoista ja nopeista hiilihydraateista (glukoosista) enemmän energiaa kuluttavaan rasva-aineenvaihduntaan, jossa vapaista rasvahapoista valmistettuja ketoaineita käytetään solujen ATP:n lähteenä.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio on ainoa tehokas hoitomuoto lasten lääkeresistentin epilepsian epileptisten kohtausten hillitsemiseen. (Neal et al., 2009; Sharma et al., 2013; Cervenka et al., 2017)

Jatkuvasti kasvava tutkimusnäyttö osoittaa, että ketogeenisella ruokavaliolla on suotuisia vaikutuksia terveyteen (Yang and Cheng, 2010; Winter et al., 2017; Augustin et al., 2018) sekä pitkäikäisyyteen (Newman et al., 2017; Roberts et al., 2017).

Tuoreissa tutkimuspapereissa ketogeenisen ruokavalion terveysvaikutukset assosioituvat vahvasti NAD -koentsyymiin (Elamin et al., 2017), joka on välttämätön ATP:n prosessoinnille ja hapetus-pelkistys-reaktiolle. Ketoaine-perusteisessa aivosolujen energia-aineenvaihdunnassa pelkistyy vähemmän NAD-molekyylejä, kuin glukoosiin perustuvassa energia-aineenvaihdunnassa. Tämän seurauksena aivosoluihin jää korkeampia pitoisuuksia hapettuneita NAD+ -molekyylejä.

Ketogeeninen ruokavalio voi havaintojen perusteella indusoida nopeita ja pysyviä muutoksia NAD+ / NADH -suhteissa aivojen runsaasti energiaa kuluttavalla hippokampuksen alueella. Tämä aivojen osa tunnetaan leikkimielisellä nimellä – kohtausportti (seizure gate). Vastaavia havaintoja on tehty ikääntyneillä hiirillä. Sen sijaan ketoaineisiin nojaavan energia-aineenvaihdunnan ei havaittu vaikuttavan aivokuoren alueella.

Korkeammat NAD+ -tasot rajoittavat epileptisia kohtauksia ja kasvattavat koe-eläinten elinajan odotetta (Lin and Guarente, 2003; Mills et al., 2016; Liu et al., 2017). Kokeellisesti kohotetut NAD+ -arvot tehostavat mitokondrioiden toimintaa, suojaavat oksidatiivisen stressin aiheuttamilta vaurioilta ja vähentävät solujen kuolemaa (Kussmaul and Hirst, 2006). Nämä vaikutukset palautuvat alemman tason aineenvaihduntareitteihin.

NAD+ on kahden entsyymiryhmän, sirtuiinien ja poly-(ADP-riboosi) polymeraasien eli PARP:ien substraatti. Nämä entsyymiryhmät vaikuttavat solujen toimintaan geenien ilmentymisestä DNA:n vaurioiden korjaamiseen (Belenky et al., 2007).

NAD+-riippuvaiset sirtuiini-entsyymit ovat tärkeitä aineenvaihdunnan, tulehdusvasteiden ja DNA:n vaurioiden korjaamisen säätelijöinä. Sirt1 osallistuu transkriptiotekijöiden, kasvutekijöiden, anti-apoptisten (ohjattua solukuolemaa estävien) ja anti-inflammatoristen proteiinien deasetylaatioon, eli asetyyliryhmien purkuun.

Sirt1 on välttämätön kognitiivisten toimintojen, muistin ja neuroplastisuuden normaalille toiminnalle (Michan et al., 2010) ja sillä on havaittu epileptisia kohtauksia ehkäiseviä vaikutuksia. Ravinnosta saatavan energian (kaloreiden) rajoittaminen ja ketogeeninen ruokavalio assosioituvat solujen parempaan terveyteen ja ainakin eläinkokeissa odotettavissa olevan elinajan pidentymiseen. Sirt6 ja Sirt7 osallistuvat suoraan DNA:n emäsjaksojen korjaamiseen, mikä vähentää ikääntymisen aiheuttamia DNA-vaurioita.

Lopuksi

On kiinnostavaa seurata sirtuiinien ja ketogeenisen ruokavalion tutkimuksia. Väitteet karppauksen, rasvojen ja ketogeenisen ruokavalion haitallisuudesta ovat vähintäänkin liioiteltuja ja todennäköisesti jopa haitallisia. Tutkimusaineisto sirtuiinien molekyylibiologisesta roolista ja ketogeenisen ruokavalion terveysvaikutuksista karttuu vauhdilla. Minä palaan tähän aiheeseen Ruokasodassa varmasti vieläkin täsmällisempien tutkimusten kautta. Omalla kohdallani olen havainnut, että vähäisempi ravinnonsaanti kasvattaa motivaatiota, muistia ja aktiivisuutta. Nämä tutkimukset näyttävät vahvistavan omia huomioitani.

PS. Iloista ja rauhallista joulua!

Lähteinä olen käyttänyt erikseen ilmoitettujen lähteiden lisäksi mm. Duodecimia ja Wikipdiaa yleisimpien aineenvaihduntareaktioiden osalta. Kuvien lähde: Pixabay

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2928875/

https://www.jneurosci.org/content/36/4/1324.long

https://elifesciences.org/articles/15092

https://www.frontiersin.org/articles/10.3389/fncel.2018.00263/full

https://www.duodecimlehti.fi/lehti/2007/19/duo96781




Esidiabetes, diabetes ja ketoilu

Esidiabeteksessa verensokeri on selvästi koholla, mutta ei vielä niin korkea kuin diabetekseen sairastuneilla. Esidiabeteksen toteamisen jälkeen on tärkeää kiinnittää ravintoon ja elintapoihin enemmän huomiota. Todetuista esidiabetes-tapauksista jopa seitsemän kymmenestä johtaa aikuistyypin diabetekseen. Lue tästä.

Ruokavalio- ja elämäntapamuutokset pienentävät esidiabetes-diagnoosin saaneiden riskiä sairastua aikuistyypin diabetekseen jopa 40-75%.

Elämäntapamuutoksiin kuuluvat säännöllinen liikunta ja terveellinen ruokavalio. Terveellisestä ruokavaliosta on useita keskenään ristiriitaisia näkemyksiä. Eräiden tutkimusten mukaan ketogeeninen ruokavalio voi pienentää diabetekseen sairastumisen riskiä. Onko näin?


Uhkakuvia ja pelkokertoimia


Olen ketoillut alun kolmatta viikkoa. Sitä voi verrata laskuvarjohyppyyn ilman laskuvarjoa. Ketoilu tappaa yhtä varmasti kuin ydinsota ja marraskuun märkä pimeys Helsingissä. En laske leikkiä. Kaikki vähähiilihydraattista ruokavaliota noudattavat kuolevat sataprosenttisen varmasti.

Tämä on pelottavaa, sillä edes täyskäännös ruisleipään, vähärasvaisiin ruokiin, pehmeisiin rasvoihin ja kasviksiin ei pelasta kerran ketoillutta harhaoppista mitenkään. Vain Jumbo voi pelastaa.

Maailman yli 400 miljoonasta diabeetikosta ja 2,8 miljoonaa lihavuuteen vuosittain kuolevasta vain kourallinen sairastui tai kuoli vähähiilihydraattisen ruokavalion vuoksi. He sairastuivat ja kuolivat, koska se on Jumbon tahto. Tai ehkäpä ei.

LCHF-ruokavaliot eivät uhkaa kansallista tai edes monikansallista turvallisuutta. Joidenkin pohdintojen mukaan ketogeeninen ruokavalio voi tosin olla uhka sokeri-, lääke- ja elintarviketeollisuudelle. Se on kaiketi lööperiä.

Vähähiilihydraattista ruokavaliota demonisoidaan osin aiheettomasti. The Lancet julkaisi hiljattain tutkimuskatsauksen, jonka mukaan vähiten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi kohtuullisesti hiilihydraatteja syöviä verrokkeja enemmän. Clickbait-uutisen lopuksi mainittiin lyhyesti, että tosiasiassa U-käyrän toisella puolella myös eniten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi.

Miksi näin on? Mitä uutisella haluttiin kertoa?

Enkä sillä haluttiin kertoa, että ketoilu on helvetin vaarallista, moraalitonta ja halveksittavaa ja sitä vastaan on taisteltava kaikin kuviteltavissa olevin keinoin.

Kaikista uusitupalaisimpien näkemysten mukaan karppaus aiheuttaa, jos ei maailmanloppua, niin ainakin 10-15 miljoonaa uutta sydäntautitapausta pelkästään Suomessa. Näistä arviolta 83 % kuolee seuraavien 3-5 kuukauden sisällä. Jotkut onnettomuuksiin, toiset itsemurhiin ja useimmat hiilihydraattien välttämisen aiheuttamiin komplikaatioihin ja yleisvitutukseen. No niin. Siinäpä tuo saatanan sarkasmi taas tuli. Anteeksi.

Ehkäpä tärkeää ei ole niinkään makroravinteiden osuudet, vaan tasapuolinen ruokavalio ja mikroravinteiden  riittävä saanti. Sitä sietää harkita. Laihtumisen kannalta tällaiseen viittaa Stanfordissa tehty tutkimus, jossa verrattiin LCHF-ruokavaliota vähän kaloreita sisältävään ruokavalioon. Osallistujat laihtuivat molemmilla dieeteillä, mutta seuratuissa ryhmissä oli laihtumisen suhteen suuria sisäisiä eroja.


Ei ole vain yhtä tapaa syödä oikein tai väärin


Ihmiset syövät väärin ja sairastuvat. Se ei ole varsinaisesti kenenkään syy. Se on ennemminkin seuraus siitä, että ruokateollisuus tarjoaa yhä enemmän korkean glykeemisen kuorman ruokia, jotka sisältävät hyvin vähän elimistön tarvitsemia mikroravinteita.

Markkinointi ohjaa kuluttajat syömään halvemmalla, nopeammin, mutta laadullisesti heikompitasoista ruokaa. Sellainen maistuu lisättyjen sokereiden, transrasvojen ja viljojen ansiosta helvetin paljon paremmalta kuin parsa tai porkkana. Tämä johtaa lihomiseen ja kasvattaa sairastumisen riskiä.

Runsaasti energiaa sisältävä ruoka on helppoa, halpaa ja nopea valmistaa. Välttämättömiä ravinteita sisältävä ruoka vaatii enemmän työtä ja suunnittelua.  Kaikilla ei yksinkertaisesti ole aikaa ja energiaa valmistaa ruokaa itse, jolloin on houkuttelevaa turvautua nopeisiin ja halpoihin vaihtoehtoihin.

Ketogeeninen LCHF-ruokavalio ei ole täydellinen tai ainoa terveyttä ja painonhallintaa ylläpitävä ruokavalio, mutta jos sen toteuttaa monipuolisesti, se on ihan pätevä ja harkitsemisen arvoinen vaihtoehto.

Hiilihydraatit eivät pidä kylläisenä yhtä hyvin kuin rasvat. Hiilihydraatteja ja runsaasti huonoja rasvoja sisältävät herkut hampurilaisista donitseihin ja makeisista virvoitusjuomiin vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin päihteet.

On esitetty, että käytännöllisesti katsoen kaikkien riippuvuutta aiheuttavien aineiden addiktoiva vaikutus selittyy viime kädessä niiden kyvyllä vapauttaa dopamiinia aivojen nk. mielihyväkeskuksessa nucleus accumbensissa. (Duodecim)” Sokeri ja erityisesti fruktoosi vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin kokaiini tai alkoholi. Sokeririippuvuus on kokonaan toinen juttu.

Lihominen on vain yksi oire aineenvaihdunnan särkymisestä. Muita oireita ovat metabolinen oireyhtymä, aikuistyypin diabetes, tulehdukselliset suolistosairaudet ja alkoholista riippumaton rasvamaksa. Kaikki ovat lisääntyneet räjähdysmäisesti 1970-luvun jälkeen.

Melkein kaikki lihavat sairastuvat metaboliseen oireyhtymään, joka johtaa yleensä aikuistyypin diabetekseen. Useimmille diabetesta sairastaville kehittyy rasvamaksa. Huonot ravitsemustottumukset edesauttavat yleensä jonkin tulehduksellisen suolistosairauden kehittymistä. Näitä voi käsitellä yksittäisinä ilmiöinä, mutta mielestäni ne ovat osa laajempaa ravitsemukseen liittyvää ongelmaa. Kardiometabolisten sairauksien epidemia uhkaa jo terveydenhoidon kantokykyä ja kansantaloutta.


Oikotietä terveyteen ei ole, mutta jotain on syötävä


En laske hiilihydraatteja. Tiedän, että niiden määrä jää kohdallani 20-50 grammaan päivässä. Rasvaa voisin syödä ehkä hieman enemmän, mutta proteiinien saanti saattaa kohdallani olla hieman tarvetta runsaampaa. Haluan välttää lihomisen ja erityisesti vyötärölihavuuden aiheuttamat sairaudet. Yritän siis laihtua paetakseni aikuistyypin diabetesta. Multippeliskleroottisena en haluaisi uusia taakkoja kannettavakseni.

Näin ketoilun kolmannella viikolla huomaan noudattavani jonkinlaista 6:1-variaatiota. Syön siis kuutena päivänä vähähiilihydraattisesti ja yhtenä päivänä melkein mitä vain kohtuuden ja järjen sallimissa puitteissa. Tämä ei mene kirjan mukaan, mutta katsellaan mihin tämä johtaa.

Ketopäivinä syön kahdesti päivässä ja oloni on koko ajan kylläinen ja energinen. En kaipaa aamu- ja iltapalaa, välipaloja tai herkkuja. Juon vettä, kahvia ja teetä (tarvittaessa punaviiniä tai sokeritonta lonkeroa). Aiemmin napostelin pitkin päivää jotakin ja energiatasot olivat koko ajan aivan nollassa.

Ketogeenisen ruokavalion suuri hyöty laihtumisen kannalta onkin juuri siinä, että rasva pitää kylläisenä pidempään ja naposteluhalu vastaavasti vähenee. Näin päivittäinen energiansaanti laskee ilman näläntunnetta ja suuria uhrauksia.

Varoitus: Ketogeeninen LCHF-ruokavalio ei välttämättä sovi kaikille. Pitkäaikaistutkimuksia LCHF-ruokavalion vaikutuksista terveydelle ei ole. En halua hehkuttaa ketogeenistä ruokavaliota minään muuna kuin mitä se on.

Parantaako ketogeeninen ruokavalio kaikki vaivat? Ei helvetissä paranna. Sellaista väittävät puhuvat paskaa ja myyvät jotain. Aineenvaihdunnan tasolla ketogeenisen ruokavalion toiminta tunnetaan ja se on hyvin tehokas laihdutusruokavalio kahdesta syystä:

1) rasva pitää kylläisenä, jolloin kokonaisenergiansaanti laskee, ja
2) ketogeeninen ruokavalio pakottaa elimistön turvautumaan läskivarastoihin energian saamiseksi, jolloin rasvan ”poltto” tehostuu.

Viralliset mallit, kuten ruokapyramidit eivät ole aivan huonoja, mutta niissä hiilihydraattien eli sokereiden määrä pidetään tarpeettoman korkeana ja rasvojen saantia kehotetaan välttämään tai suosimaan rasvattomia tai vähärasvaisia elintarvikkeita, vaikka rasvat ovat solujen uusiutumiselle sekä aivojen ja hermoston toiminnalle välttämättömiä ravintoaineita. Aivojen kuivapainosta 60 prosenttia on rasvaa. Kolesterolista – jota elimistö tuottaa itse kolesterolisynteesissä, 25 prosenttia on aivoissa. Rasva ja kolesteroli ovat mm. hermoratoja suojaavien myeliinieristeiden rakennusaineita.

Vähän hiilihydraatteja sisältävään ravintoon liittyy monenlaisia ennakkoluuloja, joiden mukaan LCHF-ruokavaliolla syödään vain proteiinia ja rasvaa. Se ei ole aivan totta. Ketogeenisellä ruokavaliolla on mahdollista syödä terveellisesti ja monipuolisesti, jos vain jaksaa nähdä vaivaa ja valmistaa terveellistä ja monipuolista ruokaa.

Usein ketoilija korvaa paljon tärkkelystä sisältävät korkean glykeemisen kuorman hiilihydraatit, kuten perunat ruokavalion sallimilla vihanneksilla. Terveellisten vihannesten ja kasvisten päivittäinen saanti todennäköisesti kasvaa LCHF-ruokavaliolla aiempaan verrattuna.


Diabetes: 1 & 2


Hölöttäminen sikseen. Aiheena on diabetes ja erityisesti ketogeenisen ruokavalion vaikutus diabetesta ehkäisevänä ruokavaliona. Tyypin 1 ja typin 2 diabetes ovat hyvin erilaisia sairauksia.

Tyypin 1 diabeetikon kohdalla hiilihydraattien välttämisen tuottama ketoosi voi johtaa hengenvaaralliseen ketoasidoosiin. Ketogeeninen ruokavalio ei siis sovi tyypin 1 diabetesta sairastavalle, mutta voi vähentää lääkityksen tarvetta tyypin 2 diabetesta sairastavilla.

Diabetekseen sairastuvan sokeriaineenvaihdunta on häiriintynyt. Insuliinintuotanto on loppunut tai solujen insuliinisensitiivisyys on heikentynyt. Haiman Langerhansin saarekkeiden beetasolujen tuottama elintärkeä insuliini on eräänlainen avain, jonka glukoosi tarvitsee päästäkseen solun sisälle.


Insuliinin ja glukagonin vaikutus


Ruokailun jälkeen veren sokeripitoisuus kasvaa. Haima reagoi tähän erittämällä vereen insuliinia. Solujen pinnalla on insuliinireseptoreita, joihin kiinnittyvä insuliinimolekyyli tuo solun läpäisevän kanavamolekyylin solukalvolle. Näin glukoosimolekyyli pääsee soluun, jossa se muutetaan solun tarvitsemaksi energiaksi solulimassa tapahtuvassa glykolyysissä ja mitokondrioissa tapahtuvassa sitruunahappokierrossa. Aerobisessa energiantuotannossa eli soluhengityksessä sokerit (ja rasvat) poltetaan vedeksi ja hiilidioksidiksi.

Kun veren glukoosipitoisuus laskee, haiman alfasolut erittävät vereen glukagonia. Se on insuliinin vastavaikuttajana energia-aineenvaihdunnan kannalta elintärkeä hormoni. Glukagoni aktivoi maksan ja lihasten sokerivarastojen eli glykogeenien purkamisen. Näin veren sokeripitoisuus pysyy tasaisena myös aterioiden välillä.

Mitä tapahtuu, jos ja kun elimistön sokerivarastot loppuvat? Kuoleeko ihminen? Ei. Glukagoni purkaa rasvasoluista rasvahappoja vereen. Se käynnistää maksan ja munuaisten soluissa ketogeneesin ja glukoneogeneesin.

Ketogeneesi ja glukoneogeneesi

Ketogeneesi tuottaa vereen vapautuneista rasvahapoista ketoaineita, joita solut voivat käyttää energianlähteenä. Tähän täysin arkiseen aineenvaihduntaprosessiin ei liity mitään mystiikkaa. Se on elimistön eräs luonnollinen selviytymismekanismi.

Glukoneogeneesi tuottaa mm. sitruunahappokierron väliaineista ja eräistä vapaista aminohapoista glukoosia.

Glukagoni käynnistää beetaoksidaation, glukoneogeneesin ja ketogeneesin. Insuliini keskeyttää nämä aineenvaihduntaprosessit.

Glukagonin vaikutuksesta soluissa käynnistyvässä beetaoksidaatiossa rasvahapot pilkotaan asetyylikoentsyymi-A:ksi eli aktiiviseksi etikkahapoksi. Se on kaikkien energiaravinteiden yhteinen väliaine sitruunahappokierrossa.

Näin rasvasolujen sisältämä rasva muutetaan solujen energiaksi kelpaavaan muotoon ja rasvaa aletaan polttaa solujen energiaksi. Atkinsin hypoteesin mukaan jatkuvasti korkeat insuliinitasot estävät elimistön rasvavarastojen tehokkaan käyttämisen, koska beetaoksidaatio, ketogeneesi ja glukoneogeneesi eivät ehdi kuluttamaan rasvoja, kun tarjolla on jatkuvasti helppoja ja nopeita hiilihydraatteja.

Tyypin 1 diabetes on autoimmuunitauti, jossa kehon oma immuunijärjestelmä tuhoaa insuliinia valmistavat Langerhansin saarekkeiden beetasolut. Tämän seurauksena haima ei pysty tuottamaan riittävästi elintärkeää insuliinia.

Ennen insuliinilääkityksen keksimistä tyypin 1 diabetes oli käytännössä kuolemantuomio. Insuliinilääkityksen ansiosta diabeetikot saavat elää melko normaalisti, mutta se edellyttää jatkuvaa tasapainoilua veren glukoosipitoisuuden tasaisena pitämiseksi. Liian korkea ja liian matala veren glukoosipitoisuus aiheuttavat diabeetikoille jopa hengenvaarallisia komplikaatioita. Diabetesta kutsuttiin aiemmin sokeritaudiksi, koska se vaikuttaa sokerin aineenvaihduntaan.

Tyypin 2 diabeteksessa solujen insuliinireseptorien ”lukkomekanismi” rikkoutuu niin, että vaikka insuliinimolekyylit koettavat kiinnittyä insuliinireseptoreihin, ne eivät kiinnity siihen toivotulla tavalla. Haima voi tuottaa yhä insuliinia, mutta solut eivät reagoi insuliiniin niin kuin niiden pitäisi reagoida. Tätä kutsutaan insuliiniresistenssiksi.

Tyypin 1 diabetes on erityisesti lasten ja nuorten sairaus, vaikka siihen voi sairastua vanhempanakin. Se edellyttää perinnöllisen alttiuden sekä yhden tai useamman sairastumisen laukaisevan tekijän. Tyypin 1 diabetes on hoidettavissa insuliinilääkityksellä, mutta ei parannettavissa. Se on elinikäinen sairaus. Diabetesta sairastavista noin 5 % sairastaa tyypin 1 diabetesta.

Tyypin 2 diabetes on elämäntapoihin liittyvä sairaus, johon sairastutaan yleensä aikuisena. Tosin se yleistyy pelottavan nopeasti myös ylipainoisten lasten parissa. Myös tyypin 2 diabetekseen liittyy perinnöllinen alttius, mutta siihen sairastumista voidaan ehkäistä ja oireita helpottaa elämäntapamuutoksilla.

Molemmissa tapauksissa diabetes voi johtaa erilaisiin komplikaatioihin, kuten sydän- ja verisuonitauteihin, munuaisten sairauksiin, sokeuteen, erilaisiin neurologisiin häiriöihin sekä verisuoni- ja elinvaurioihin.

Yhdysvalloissa jo lähes joka kymmenes ihminen (noin 30 miljoonaa) sairastaa diabetesta, mutta sairastuneista 25 % ei tiedä sairastavansa.

Paistettua chilillä maustettua kanaa ja kasviksia, porkkanaraaste ja jogurttikastike

Raskausaikainen diabetes paranee usein synnytyksen jälkeen, mutta joissain tapauksissa se voi johtaa aikuistyypin diabetekseen myöhemmin elämässä.


Diabeteksen syyt


Tyypin 1 ja tyypin 2 diabetes johtuvat eri syistä, mutta molempiin liittyy insuliini. Insuliini on haiman tuottama sokeriaineenvaihdunnalle elintärkeä hormoni.

Tyypin 1 diabetes

Autoimmuunitautien tarkkaa syntytapaa ei tunneta. Niissä immuunijärjestelmän virheellinen toiminta kohdistaa aktivaation kehon omia kudoksia vastaan. Diabeteksessa immuunijärjestelmä tuhoaa haiman Langerhansin saarekkeiden insuliinia tuottavia beetasoluja. Autoimmuunitaudit edellyttävät perinnöllisen sairastumisalttiuden sekä yhden tai useamman sairastumisen laukaisevan ympäristötekijän. Tyypin 1 diabeteksen saattaa laukaista jokin lapsuudessa sairastettu infektio. Tutkimus.

Sairastumisen riskiin vaikuttavat mahdollisesti:

  • perinnölliset tekijät; suvussa esiintyy diabetesta
  • eräät geenimuutokset
  • muut sairaudet, kuten kystinen fibroosi ja perinnöllinen hemokromatoosi
  • altistuminen infektioille, kuten sikotaudille, vihurirokolle ja tavalliselle herpesvirukselle (cytomegalovirus)
  • matalat sikiöaikaiset D-vitamiinitasot

Tyypin 2 diabetes

Aikuistyypin diabeteksessa solut alkavat vieroksua insuliinia. Hiljalleen tauti etenee pisteeseen, jossa insuliinin tuotanto vähenee ja solut eivät pysty käyttämään glukoosia tehokkaasti. Glukoosi ei pääse soluihin ja sitä alkaa kerääntyä verenkiertoon. Insuliiniresistanssi ilmenee mittauksissa selvästi kohonneena verensokerina.

Insuliiniresistenssi voi syntyä, jos veren glukoosipitoisuus on jatkuvasti korkea ja veressä on runsaasti insuliinia. Solut ylikuormittuvat ja ”kyllästyvät” insuliiniin, jolloin ne reagoivat insuliinin vaikutuksiin huonommin.

Tyypin 2 diabeteksen selkeiden oireiden ilmenemiseen voi mennä vuosia. Taudin varhaisvaiheessa sairauden etenemistä voi vielä hidastaa ja oireita hillitä lääkkeiden, ruokavalion ja liikunnan avulla. Insuliinia ei sairauden alkuvaiheessa tarvita, mutta taudin edetessä insuliinin tarve kasvaa veren glukoosipitoisuuden tasaisena pitämiseksi.

Tyypin 2 diabeteksen riskitekijöihin kuuluvat:

  • perinnöllinen alttius; suvussa esiintyy aikuistyypin diabetesta
  • ylipaino ja lihavuus
  • tupakointi
  • huonot ruokatottumukset
  • liikunnan puute
  • eräät lääkkeet

Riskitekijät

Geneettiset tekijät sekä eräät ympäristömuuttujat voivat laukaista tyypin 1 ja tyypin 2 diabeteksen, mutta aikuistyypin diabeteksen voi välttää laihduttamalla, syömällä terveellisesti ja liikkumalla riittävästi. JAMA Oncology -julkaisu kertoo, että kuitujen ja maustamattoman jogurtin saanti laskee keuhkosyövän riskiä merkittävästi. Aiemmissa tutkimuksissa on havaittu jogurtin ja kuitujen vähentävän aikuistyypin diabeteksen riskiä.

D-vitamiini

On jonkin verran tutkimusnäyttöä siitä, että riittävä D-vitamiinin saanti laskee diabetekseen sairastumisen riskiä. Erityisesti odottavan äidin ja sikiön matalat D-vitamiinitasot voivat altistaa sairastumiselle myöhemmin elämässä. 2017 julkaistun tutkielman mukaan D-vitamiinin vajaus heikentää mm. immuunijärjestelmän säätelyä ja solujen insuliiniherkkyyttä; tämä puolestaan lisää diabetekseen sairastumisen riskiä.

Rintaruokinta

Rintaruokinta voi laskea lapsen riskiä sairastua tyypin 1 diabetekseen. 2012 julkaistu tutkimus tulkitsi rintaruokinnan suojaavan lasta tyypin 1 diabetekseen sairastumiselta, mutta tieteellinen näyttö rintaruokinnan suojaavasta vaikutuksesta jäi melko ohueksi.

Oireet

Diabeetikko voi kärsiä monenlaisista alhaisen verensokerin aiheuttamia oireita ja komplikaatioita.

Aikuistyypin diabetekseen liittyy metaboliseen oireyhtymään viittaavia piirteitä, kuten lihavuutta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja. Inflammaatio vaikuttaa metaboliseen oireyhtymään ja aikuistyypin diabetekseen.

Ketoilijan jauhelihasalaattia

Tyypin 1 diabetes Tyypin 2 diabetes
Ennen tautia Painoindeksi on tasolla (19–24.9) Painoindeksi (25 tai suurempi)
Taudin aikana Useita viikkoja jatkuva nälän- ja janontunne sekä lisääntynyt virtsaamisen tarve, näön hämärtyminen.

Näön hämärtyminen, väsymys, käsien ja jalkojen puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon äkillinen putoaminen.

Lisääntynyt janon- ja nälän tunne, lisääntynyt virtsaamisen tarve, näön hämärtyminen

Väsymys, jalkojen ja käsien puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon selittämätön lasku.

 

Komplikaatiot

Riskinä sydän- ja verisuonitaudit, sydänkohtaus, halvaus, munuaistauti ja munuaisen vajaatoiminta.

Silmävauriot ja sokeus, hermovauriot, hitaasti paranevat haavat, ketoasidoosi

Riskinä sydän- ja verisuonitaudit, sydänkohtaus ja halvaus, munuaistauti ja munuaisten vajaatoiminta, näön heikkeneminen, hermovauriot.
Hitaasti paranevat haavat, kuoliot (amputaation riski), ketoasidoosi.

Hyperglykemia

Jos diabeetikon veren sokeripitoisuus kasvaa liian korkeaksi, seurauksena on hyperglykemia. Tämä voi johtaa pitkäkestoisiin komplikaatioihin, sokeutumiseen, sydän- ja verisuonitauteihin ja elinvaurioihin. Hyperglykemiaan liittyy usein lisääntynyt virtsaamisen tarve ja kova jano.

Hyperglykemia voi johtaa ketoasidoosiin, eli happomyrkytykseen, joka on diabeetikoilla hengenvaarallinen ja lääkärin hoitoa vaativa tila.

Ketoasidoosin yleiset oireet:

  • hengitysvaikeudet
  • makealta ja hedelmäiseltä haiseva hengitys
  • pahoinvointi ja oksentelu
  • kuiva suu
  • kooma

Hypoglykemia

Diabetesta sairastavien pitää seurata veren sokeritasoja säännöllisesti. Diabetesta sairastavan verensokerin lasku liian alhaiselle tasolle viittaa hypoglykemiaan. Hypoglykemian voi aiheuttaa liian suuri annostus insuliinia tai insuliinia tuottavaa lääkettä.

Hypoglykemian oireita ovat:

  • hikoilu, vilunväreet, kalpeus
  • heikotus, vapina, hermostuneisuus, ahdistus
  • kiihtynyt pulssi
  • huimaus
  • pahoinvointi
  • väsymys
  • päänsärky
  • kihelmöinti

Hypoglykemian hoitamiseksi diabetesta sairastavan on saatava jotakin nopeaa hiilihydraattia, sokerivettä, makeisia tai glukagonitabletti. Hypoglykemia on hengenvaarallinen tila, jossa potilas tarvitsee nopeasti lääkärin apua.

Ilman asianmukaista hoitoa hiilihydraateilla tai glukagonilla hypoglykemia voi aiheuttaa:

  • kohtauksia
  • tajunnan menetyksen
  • kooman

Diagnoosi

Tyypin 1 diabetes alkaa usein nopeasti ja varoittamatta. Kun oireita ilmenee, potilaan on syytä hakeutua lääkärin vastaanotolle, jotta diagnoosi varmistuu ja asianmukainen hoito voidaan aloittaa.

Esidiabetesta ja alkavaa tyypin 2 diabetesta sairastavalla ei välttämättä ole minkäänlaisia sairauteen viittaavia oireita. Aikuistyypin diabetes varmistuu verikokeilla mitattavalla glukoosilla.

Lihavien sekä muiden aikuistyypin diabeteksen riskiryhmään kuuluvien olisi hyvä tarkistuttaa veren glukoosipitoisuus säännöllisesti. Kohonneisiin glukoositasoihin on tärkeää reagoida nopeasti, koska näin taudin kehittymisen voi parhaimmillaan estää ja usein ainakin hidastaa. Testejä:

Verikokeiden tulosten perusteella tutkittavan verensokeritaso selvittää mahdollisen esidiabeteksen tai aikuistyypin diabeteksen.

Tyypin 1 diabeteksen hoitomahdollisuuksia immunosuppressiivisilla lääkkeillä tutkitaan, mutta vaikutukset ovat vielä epäselviä. Myöskään aikuistyypin diabetekseen ei tunneta parantavaa hoitoa, mutta elämäntapamuutokset ja suolen ohitusleikkaus voivat kääntää taudin suunnan ja johtaa remissioon.

Silputtu paprika, sipuli, valkosipuli ja chili


Kannattaisiko ketoilu?


1. Vähähiilihydraattinen ruokavalio auttaa painonpudotuksessa

Rasvan muuttaminen energiaksi edellyttää enemmän työtä kuin hiilihydraattien käyttäminen energiaksi. Kun elimistölle ei tarjota helppoa energiaa hiilihydraattien muodossa, elimistön on turvauduttava rasvavarastoihin. Tämä nopeuttaa laihtumista. Rasva myös pitää kylläisenä, mikä vähentää kokonaisenergian saantia. Brasilialaistutkimus osoitti, että vähän hiilihydraatteja sisältävä ruokavalio on kaloreita rajoittamista tehokkaampi laihduttamisessa:

”The role of very-low-carbohydrate ketogenic diets (VLCKD) in the long-term management of obesity is not well established. The present meta-analysis aimed to investigate whether individuals assigned to a VLCKD (i.e. a diet with no more than 50 g carbohydrates/d) achieve better long-term body weight and cardiovascular risk factor management when compared with individuals assigned to a conventional low-fat diet (LFD; i.e. a restricted-energy diet with less than 30% of energy from fat). Through August 2012, MEDLINE, CENTRAL, ScienceDirect,Scopus, LILACS, SciELO, ClinicalTrials.gov and grey literature databases were searched, using no date or language restrictions, for randomised controlled trials that assigned adults to a VLCKD or a LFD, with 12 months or more of follow-up. The primary outcome was bodyweight. The secondary outcomes were TAG, HDL-cholesterol (HDL-C), LDL-cholesterol (LDL-C), systolic and diastolic blood pressure,glucose, insulin, HbA1c and C-reactive protein levels. A total of thirteen studies met the inclusion/exclusion criteria. In the overall analysis,five outcomes revealed significant results. Individuals assigned to a VLCKD showed decreased body weight (weighted mean difference -0·91 (95% CI -1·65, -0·17) kg, 1415 patients), TAG (weighted mean difference -0·18 (95% CI -0·27, -0·08) mmol/l, 1258 patients) and diastolic blood pressure (weighted mean difference -1·43 (95% CI -2·49, -0·37) mmHg, 1298 patients) while increased HDL-C(weighted mean difference 0·09 (95% CI 0·06, 0·12) mmol/l, 1257 patients) and LDL-C (weighted mean difference 0·12 (95% CI 0·04,0·2) mmol/l, 1255 patients). Individuals assigned to a VLCKD achieve a greater weight loss than those assigned to a LFD in the longterm; hence, a VLCKD may be an alternative tool against obesity.”

2. LCHF voi suojata aivoja

Joidenkin tutkimusten mukaan ketoilu suojaa aivoja mm. ikääntymiseen liittyviltä muistisairauksilta kuten dementialta ja Alzheimerin taudilta sekä neurodegeneratiiviselta Parkinsonin taudilta. Kirjoitin aiemmin tutkimuksesta, jonka mukaan vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio voi vaikuttaa suotuisasti etenevään multippeliskleroosiin. Tutkimuksia tarvitaan enemmän. On kuitenkin viitteitä siitä, että ketogeenisellä ruokavaliolla on aivojen hyvinvointia suojaavia ominaisuuksia. Tutkimuksissa on havaittu, että ketogeeninen ruokavalio parantaa unen laatua ja lisää lasten tarkkaavaisuutta ja oppimiskykyä. Kyllä vain. En keksinyt omasta päästäni. Lue tästä.

Entä se diabetes ja ketoilu?

Ketogeeninen LCHF-ruokavalio auttaa aikuistyypin diabetesta sairastavaa ylläpitämään terveitä verensokeritasoja.

Hiilihydraatit kohottavat veren glukoosipitoisuutta enemmän kuin muut ruoat ja sen vuoksi haiman on eritettävä vereen enemmän insuliinia.

Hiilihydraattien vähentäminen auttaa tasapainottamaan veren glukoositasot ja estämään verensokerin suuria heilahduksia. LCHF ruokavalio laihduttaa ja vaikuttaa myös elimistön hiljaista tulehdusta (inflammaatio) hillitsevästi.

Tästä huolimatta LCHF ei ole yksinkertaisesti helvetin hyvä ruokavalio. Se voi helposti johtaa välttämättömien vitamiinien, mineraalien, kuitujen ja antioksidanttien liian vähäiseen saantiin, mikä voi aiheuttaa monia muita terveysongelmia. Tähän jokaisen ketoilijan on syytä suhtautua riittävällä hartaudella ja vakavuudella. Välttämättömät ravintoaineet ovat välttämättömiä, koska elimistö ei toimi oikein ilman niitä.

Yleisesti ottaen erittäin vähän hiilihydraatteja sisältävä ruokavalio sisältää vain 10-50 grammaa hiilihydraatteja vuorokaudessa, vähän hiilihydraatteja sisältävä ruokavalio on sellainen, jossa hiilihydraattien saanti rajoitetaan 50-100 grammaan päivässä ja kohtuullisesti hiilihydraatteja sisältävä ruokavalio sisältää 100-225 g hiilihydraatteja päivässä. Nämä ovat lukuja ja luvut ovat abstrakteja. Ihmisten tarpeet vaihtelevat ja omaa kehoa on syytä kuunnella tarkasti. Ilman varavarjoa ei pidä hypätä tuntemattomaan. On ihan järkevää ensin selvittää mistä on kyse ja millaisia mahdollisia riskejä radikaaliin ruokavaliomuutokseen voi liittyä.

Eräs varteenotettava vaihtoehto on laskea päivittäistä hiilihydraattien saantia tasaisesti ja seurata samalla millaisia vaikutuksia hiilihydraattien vähentämisellä on veren glukoositasoihin, verenpaineeseen, painoon, yleiseen jaksamiseen jne. Tällaiseen päästään pienillä muutoksilla. Lisätyistä sokereista, valkoisista jauhoista, makeisista, virvoitusjuomista, mehuista yms. on helppo luopua, eikä se edellytä radikaalia elämäntapamuutosta. Leivän voi korvata täysjyväleivällä, pastan ja riisin täysjyväversioilla ja runsaasti tärkkelystä sisältäviä perunoita voi vähentää.

Mitä sitten saa syödä ja mitä ei?

Tästä vallitsee lukemattomia koulukuntia ja jokainen on aivan ehdottomasti omasta mielestään täysin oikeassa. Viime aikoina LCHF-skeneen on liittynyt virallisia ravitsemussuosituksia painottavia virallis-vähähiilihydraattisia tendenssejä.  Eli hiilihydraattien rajoittamisen ohella kehotetaan myös välttämään rasvoja ja suosimaan rasvattomia lihoja. Ei kai siitä haittaa ole, mutta LCHF-ruokavalio lähtee ajatuksesta, että hiilihydraateista saatava energia korvataan rasvasta saatavalla energialla. Siihen ei vähärasvaiset tuotteet sovi.

  • sallittuja vihanneksia (kaalit, parsa, vihreät lehtivihannekset, kesäkurpitsa, tomaatit, paprika jne.)
  • esimerkiksi liha, kana, kala, pähkinät,
  • virallisesti suositellaan rasvoiksi margariinia, oliiviöljyä, rypsiöljyä, mutta minä syön myös voita
  • chia-siemenet (kuituja, proteiinia ja hyviä rasvoja)
  • lanttu

Ruokavalion tavoitteista riippuen hedelmiä voi syödä niukasti. Hedelmät sisältävät sokeria, mutta myös monia kehon tarvitsemia ravintoaineita hyvässä muodossa. Hedelmä on kuitenkin terveellisempi vaihtoehto kuin makeiset.

Ruokavaliossa tulisi välttää:

  • valmisruokia ja suolaisia snacksejä
  • runsaasti sokeria sisältäviä herkkuja: kakkuja, makeisia, leivoksia, keksejä, virvoitusjuomia, mehuja
  • tärkkelystä sisältäviä vihanneksia: peruna, maissi, riisi
  • olutta ja alkoholia, mutta erityisesti olutta ja sokeria sisältäviä alkoholeja
  • valkoista pastaa

Täysjyväleivät, linssit ja pavut sisältävät runsaasti hiilihydraatteja, mutta ruokavalion tavoitteista riippuen niitä voi satunnaisesti syödä niiden sisältämien tärkeiden ravintoaineiden vuoksi.


Kuinka hiilihydraatit vaikuttavat diabetekseen?


Vähähiilihydraattinen ruokavalio on eräs tehokkaimmista tavoista hallita verensokeria aikuistyypin diabeteksessa. Insuliiniresistenteillä ihmisillä veren glukoositasot voivat pysyä korkeina tunteja syömisen jälkeen. Runsaasti hiilihydraatteja sisältävä ruoka ei pidä kylläisenä, vaan ruokahalu palaa pian, vaikka elimistöllä ei olisi energiantarvetta. Tämä johtaa helposti naposteluun ja lihomiseen. Lue tästä.

LCHF

  • lisää energiaa, tarkkaivaisuutta ja parantaa unenlaatua
  • laskee veren keskimääräistä glukoositasoa ja HbA1c-tasoja
  • vähentää napostelua ja makeanhimoa
  • pienentää hypoglykemian riskiä
  • auttaa pudottomaan painoa tehokkaasti ja ilman nälkää
  • laskee diabetekseen liittyvien komplikaatioiden riskiä
  • laskee kolesterolia

Ketoosi on normaali aineenvaihduntaprosessi. Kun elimistöllä ei ole riittävästi glukoosia solujen energian tuotantoon, aineenvaihdunta turvautuu varastorasvoihin, joista valmistetaan energiantuotantoon kelpaavia ketoaineita.

Ketogeenisellä ruokavaliolla (kuten Atkinsin ruokavalio) tavoitellaan ketoosia, jossa keho pakotetaan käyttämään läskiä polttoaineena. Hiilihydraatit ovat elimistön tärkein polttoaine, koska olemme opettaneet kehon käyttämään hiilihydraatteja energianlähteenä.

Elimistö osaa kuitenkin tuottaa energiaa varastoimastaan rasvasta. Se on oikeastaan rasvan keräämisen eli lihomisen tärkein pointti: rasva on varastoenergiaa.

Elimistö käyttää varastoenergiaa sitten, kun helppoja hiilihydraatteja ei ole saatavilla. Niin pitkään, kun elimistöä hemmotellaan herkullisilla sokereilla, rasvasolujen purkaminen energiaksi ei pääse alkamaan. Oleellista on veren insuliinipitoisuus. Kun veressä on insuliinia, glukagonia ei vapaudu. Glukagoni kuitenkin on välttämätön hormoni sokeri- ja rasvavarastojen purkamisessa. Vasta kun glukoosi loppuu ja insuliinin määrä laskee, glukagoni aloittaa rasvan muuttamisen energianlähteeksi kelpaavaan muotoon.

Käytännössä myös kaloreita rajoittamalla (vähärasvaisella) ruokavaliolla päästään samaan, mutta siinä hiilihydraateilla ”tekohengitetään” sokeripolttoista konetta, joten laihtuminen on ensimmäisten kuukausien aikana hitaampaa, ja nälkä sekä ruokaan liittyvät mielihalut suurempia. Myös vähärasvainen ruokavalio pakottaa elimistön turvautumaan varastorasvoihin, mutta hitaammin, koska helppoa glukoosia tarjotaan kokoa ajan.

Totesin aiemmin, että ketogeeninen ruokavalio ei ole suositeltava tyypin 1 diabetesta sairastaville. Ketoasidoosin riski siinä on suurempi kuin terveillä ja tyypin 2 diabetesta sairastavilla.

Tyypin 1 diabetesta sairastavat voivat hieman vähentää hiilihydraattien saantia välttääkseen verensokerin piikkejä, mutta vähähiilihydraattisella ruokavaliolla ei kannata leikkiä. Diabetes on hyvin vakava sairaus ja hiilihydraatit tyypin 1 diabeteksessa voivat olla elämän ja kuoleman asia.

Ketoosi

  • Ketoosi käynnistyy, kun elimistöllä ei ole riittävästi glukoosia solujen energiantuotantoon
  • Ketoosissa varastorasvoja muutetaan solujen energianlähteeksi kelpaaviksi ketoaineiksi
  • Ketoaineet ovat happoja ja niiden lisääntyminen lisää veren happamuutta
  • Hallitsematon ketoosi tyypin 1 diabetesta sairastavilla voi johtaa ketoasidoosiin eli happomyrkytykseen, joka on diabetesta sairastavalle hengenvaarallinen tila.

Onko LCHF sitten terveellistä?

On ja ei ole. Jos ketogeeniseen ruokavalioon saa lisättyä välttämättömät ravintoaineet, kuituja ja antioksidantteja, ketogeeninen ruokavalio voi olla hyvin terveellinen. Jos ruokavaliosta karsii kaikki kasvikset ja syö vain rasvaa ja proteiineja, se ei ole pidemmän päälle hyväksi. LCHF saattaa vaikuttaa suotuisasti esimerkiksi:

  • sydän- ja verisuonitauteihin
  • diabetekseen
  • metaboliseen oireyhtymään
  • aivojen terveyteen
  • kolesteroliarvoihin
  • verensokeriarvoihin
  • verenpaineeseen

Terveyshyödyt ovat seurausta terveellisempien ruokavalintojen, laihtumisen ja elimistön hiljaisen tulehduksen helpottamisen yhteisvaikutuksesta. Kuitujen ja hyvien rasvojen lähteeksi suosittelen esimerkiksi chia-siemeniä.

Ketogeenistä ruokavaliota hyödynnetään lääkärin valvonnassa epilepsiaa sairastavien lasten hoidossa, sillä se vähentää sellaisten lasten epileptisiä kohtauksia, joilla muista hoidoista ja lääkkeistä ei ole apua. On jonkin verran tutkimusnäyttöä myös siitä, että aikuiset epileptikot hyötyvät ketogeenisen ruokavalion noudattamisesta, mutta tämä edellyttää laajempia ja kattavampia tutkimuksia.

Ketoosi ja diabetes

Diabeetikoilla ketoosi kertoo siitä, että veressä ei ole riittävästi insuliinia glukoosin prosessoimiseen. Virtsanäytteen ketoaineet kertovat, että potilaan diabetes-hoidot eivät pure toivotulla tavalla.

Tyypin 2 diabetesta (non-insulin dependent diabetes eli NIDDM) sairastaville voidaan suositella ketogeenistä ruokavaliota. Heillä haima tuottaa yhä jonkin verran insuliinia, mutta solut eivät pysty hyödyntämään insuliinia tehokkaasti sokeriaineenvaihdunnassa.

Ketogeenisessä ruokavaliossa ravinnon sisältämien hiilihydraattien määrää vähennetään. Hiilihydraattien vähentämisen tarkoitus on laskea veren glukoositasoja. Kaikki hiilihydraatit muutetaan glukoosiksi tai tuhansista glukoosimolekyyleistä muodostuviksi glykogeeneiksi. Hiilihydraatit siis kohottavat veren sokeripitoisuutta.

Ketogeenistä ruokavaliota noudattavien diabeetikkojen on seurattava tunnollisesti veren ketoaineiden tasoja. Jos ketoaineiden määrä nousee liian korkeaksi, seurauksena voi olla ketoasidoosi.

Ketoosissa ketoaineiden määrä on noin kymmenesosa ketoasidoosiin verrattuna. Tyypin 1 diabetesta sairastavien riski saada ketoasidoosi on merkittävästi suurempi kuin tyypin 2 diabetesta sairastavilla.

Ketoasidoosi

Ketoasidoosissa veren ketoaineiden määrät nousevat poikkeuksellisen korkeiksi ja myrkyttävät elimistöä. Tämä on äärimmäisen vakava tila, joka diabeetikoilla edellyttää lääkärin hoitoa.

Ketoasidoosin voi laukaista useampikin tekijä. Usein siihen vaikuttaa jokin sairaus ja sen seurauksena häiriintynyt hormonien tuotanto, jolloin insuliinin vastavaikuttajia voi muodostua normaalia enemmän.

Ketoasidoosi voi myös aiheutua liian vähäisestä insuliinilääkityksestä tai

  • huumeiden käytön
  • stressin
  • fyysisen vamman
  • leikkauksen

seurauksena. Ketoasidoosi on selvästi yleisempi tyypin 1 diabetesta sairastavilla, koska näillä haima ei tuota insuliinia.

Ketoasidoosin varhaisia oireita ovat:

  • vatsakipu
  • sekavuus ja keskittymisvaikeudet
  • kuiva ja punoittava iho
  • kova jano ja kuiva suu
  • makeahkolta tai hedelmäiseltä haiseva hengitys
  • lisääntynyt virtsaamistarve
  • pahoinvointi ja oksentelu
  • hengen ahdistus, nopea hengitys

Esidiabetes: Mitä syödä ja mitä vältellä?

Diabeteksen ehkäisyyn tähtäävä ohjelma (Diabetes Prevention Program) on osoittanut, että laihtuminen laskee diabeteksen riskiä 16 % jokaista vuodessa laihdutettua painokiloa kohden.

Perinteisesti esidiabetekseen sairastuneita kehotetaan syömään vähärasvaisia, vähäkalorisia ja runsaasti kuituja sisältäviä ruokia. Onko sellainen hyvä ruokavalio? Ravinnosta saadun kokonaisenergian vähentäminen laihduttaa ja ylläpitää kyllä terveyttä.

Jo muutaman kilon karistaminen elopainosta laskee huomattavasti diabeteksen riskiä. Vuonna 2001 julkaistu suomalainen diabeteksen ehkäisytutkimus osoitti, miten esidiabetes-vaiheessa diabeteksen syntyä voidaan ehkäistä. Tutkimuksessa seurattiin 500 esidiabetes-diagnosoitua lihavaa henkilöä. Puolet heistä sai ohjausta- ravinto ja liikuntatottumuksiin ja puolet toimi vertailuryhmänä. Koeryhmän tavoitteina oli: 5 prosentin painonpudotus, ruoan rasvan vähentäminen (alle 30 prosenttiin päivittäisestä energiasta), kovien rasvojen välttäminen ja vähärasvaisten tuotteiden suosiminen, ravinnon kuitujen lisääminen (täysjyväviljat) ja kohtuullinen liikkuminen (esim. puolen tunnin kävelylenkki päivittäin). Vuoden seurannan jälkeen koeryhmä oli laihtunut 4 kiloa enemmän kuin vertailuryhmä. Neljän vuoden seurannan jälkeen diabetes todettiin koeryhmässä 11:lla ja vertailuryhmässä 23:lla.

Esidiabetes ja diabetes

Terveillä paaston verensokeri on aamulla vähintään 8 tunnin syömättömyyden jälkeen alle 6 mmol/l tasolla, eikä verensokeri nouse laboratoriossa tehtävässä sokerirasitustestissä yli 7,7 mmol/l.

Esidiabeteksessa aamun paastoverensokeri on välillä 6,1-6,9 mmol/l tai kun verensokeri nousee sokerirasitustestissä välille 7,8-11,0 mmol/l.

Diabeteksessa paaston verensokeri (IP-gluc) on aamulla 7 mmol/l tai korkeampi kahtena eri päivänä tai verensokeri sokerirasitustestissä ylittää arvon 11,0 mmol.

Niin kutsuttu ”pitkäaikaissokeri” voidaan mitata verinäytteestä määrittämällä veren punasolujen hemoglobiinin sokeroituminen sokerihemoglobiini- eli HBA1c-kokeessa. Tämä kuvaa noin parin kuukauden verensokeritasoa. Jos HBA-1c on yli 48 mmol/mol, todetaan diabetes.

Glykeeminen indeksi ja glykeeminen kuorma

Glykeeminen indeksi (GI) kuvaa ruoka-aineen imeytyvien hiilihydraattien aiheuttamaa muutosta verensokerissa verrattuna referenssiruoka-aineeseen. Tällä pyritään seuraamaan hiilihydraattien imeytymisnopeutta. Suuri GGI tarkoittaa sitä, että verensokeri nousee nopeasti ja vereen vapautuu paljon insuliinia. Pieni GI kertoo hiilihydraatin tasaisemmasta imeytymisestä ja vähäisemmästä vaikutuksesta verensokeriin. Korkean glykeemisen indeksin elintarvikkeita ovat mm. perunat, valkoinen riisi, leipä, keksit, makeiset, sokeri jne.

Verensokeria säätelee monet tekijät. Elimistö pyrkii ylläpitämään tasaista verensokeria sillä, että maksan glykogeeneista vapautuu glukagonin vaikutuksesta glukoosia verenkiertoon aterioiden välillä. Syöminen kohottaa verensokeria, jolloin haimasta vapautuu insuliinia verenkiertoon. Insuliini pysäyttää maksan glykogeenien purkamisen ja käynnistää sokerivarastojen täydentämisen.

GI-taulukko (100 kuvaa suurinta vaikutusta verensokeriin. GI 0 ei vaikuta verensokeriin)

Ruoka-aine GI Ruoka-aineen määrä, joka
sisältää 50 g hiilihydraattia
Hiilihydraattien määrä
100 g:ssa ruoka-ainetta
GK/ 100 g ruoka-ainetta
A                   
Ananas 81 462 11 9
Appelsiini 58 545 9 5
Appelsiinimehu 63 481 10 6
B
Banaani 72 250 20 14
Bataatti 77 268 19 15
C
Cashewpähkinät 30 192 26 8
Cornflakes 112 58 87 97
Croissant (voisarvi) 92 110 46 43
D
Dextrosol-rypälesokeri 146 55 91 133
G
Greippi 35 545 9 3
Greippimehu 66 625 8 5
H
Hapanleipä, ruis- 83 100 50 42
Hedelmäsokeri (fruktoosi) 26 50 100 26
Herneet, tuoreet 66 571 9 6
Hunaja 76 69 72 55
J
Jogurtti, kevyt,
hedelmiä ja sokeria
46 323 16 7
K
Kaali 99 750 7 7
Kauralese 76 100 12 9
Kauraryynipuuro 80 568 9 7
Kiivi 73 500 10 7
Kikherneet 39 250 20 8
Kirsikka 30 500 10 3
Ksylitoli 11 50 100 11
Kurpitsa keitetty 104 1000 5 5
Kuskus 90 431 12 11
L
Laktoosi 63 50 100 63
Lanttu 99 750 7 7
Leipä, hampurilais- 84 100 50 42
Leipä, täysjyväruis- 80 107 47 38
Linssit, punaiset 36 417 12 4
Linssit, vihreät 41 441 11 5
Luumu 54 500 10 5
M
Maapähkinät 19 417 12 2
Maissi, pakaste 67 270 18 67
Maissi, tuore 73 234 21 15
Maito, 0,5 % 44 962 5 2
Maito, 0,1 % 44 962 5 2
Makaronit 65 188 27 18
Mango 70 353 14 10
Mansikat 55 2000 3 2
N
Nektari 94 500 10 9
Nuudelit, mungopapu- 46 200 25 11
Nuudelit, pika- 65 225 22 14
Nuudelit, riisi- 84 231 22 19
Näkkileipä 95 63 79 75
O
Ohraleipä, täysjyvä- 39-66 100 50 20-33
Omena 52 400 13 7
Omenamehu 55 431 12 7
P
Pannukakut 92 69 73 67
Papaija 81 353 14 11
Patonki 131 100 50 66
Pavut, kidney- 39 300 17 7
Pavut, säilykekidney- 72 441 11 8
Pavut, mung- 43 441 11 5
Pavut, idätetyt mung- 35 441 11 4
Pavut, musta- 28 300 17 5
Pavut, mustasilmä- 58 250 20 12
Pavut, pinto- 54 288 17 9
Pavut, ruskeat 33 100 50 17
Pavut, soija- 25 1250 4 1
Pavut, säilykesoija- 19 1250 4 1
Pavut, valkoiset,
tomaattikastikkeessa
66 500 10 7
Pavut, vihreät 52 242 21 11
Persikka 58 545 9 5
Persikka, säilyke sokeriliemessä 79 353 14 11
Peruna, keitetty, jauhoinen 90 300 17 15
Peruna, keitetty, kiinteä 80 300 17 14
Peruna, raaka 79 357 14 11
Perunamuusi 102 375 13 13
Porkkana, keitetty 80 667 8 6
Porkkana, raaka 22 500 10 2
Porkkanamehu 59 543 9 5
Popcorn 99 91 55 55
Punajuuri 88 571 9 8
Päärynä 52 545 9 5
R
Ranskalaiset perunat 104 259 19 20
Riisi, basmati- 80 197 25 20
Riisi, esikeitetty 65 208 24 16
Riisi, jasmin- 150 179 28 42
Riisikakut 126 60 83 104
Ruisleipä, kokojyvä- 69 125 40 28
Ruisleipä, pellavansiemenillä 57 78 100 50
Ruisleipä, täysjyvä- 89 100 50 45
Rusinat 88 68 73 64
Rypäleet 63 333 15 10
Rypälesokeri (glukoosi) 138 50 100 138
S
Soijamaito, kevyt- 61 735 7 4
Soijamaito, täys- 55 694 7 4
Sokeri 94 50 100 94
Spagetti, keitetty 10 – 15 min. 59 188 27 16
Spagetti, täysjyvä- 51 214 23 12
Sushi 72 135 37 27
T
Taatelit, kuivatut 142 75 67 95
Tattari 75 205 20 15
Tomaattimehu 52 1389 4 2
U
Uuniperuna 117 250 20 23
V
Vesimeloni 99 1000 5 5
Viikunat, kuivatut 84 15 43 36
Viili 15 136 4 1
Viinimarjat 30 500 10 3
Vohvelit 105 135 37 39

Taulukon lähde: Keittotaito

Glykeeminen indeksi on hyödyllinen työkalu hiilihydraattien ja niiden vaikutusten arviointiin. Esidiabetesta ja diabetesta sairastavien on tärkeää seurata hiilihydraattien määrää ja laatua. Mitä korkeampi GI, sitä nopeammin hiilihydraatit nostavat verensokeria.

Glykeeminen kuorma (glycemic load /GL)

Glykeeminen kuorma määrittelee ravinnon sisältämien hiilihydraattien laatua ja määrää. Sitä voidaan hyödyntää, kun lasketaan aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen. Pelkkä GI ei kerro koko totuutta. Vähäisellä määrällä korkean GI-arvon ruokia ei ole suurta vaikutusta verensokeriin, ja siksi on tärkeämpää arvioida koko aterian vaikutusta verensokeriin ja insuliinivasteeseen eli glykeemista kuormaa. GL lasketaan seuraavasti:

GI x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa arvioitaessa lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Mitä tämä tarkoittaa?

Täysjyväviljat ja runsaasti kuitua sisältävät ravintoaineet imeytyvät ruoansulatuskanavasta verenkiertoon hitaammin kuin ”nopeat hiilihydraatit”. Elimistö prosessoi sokerit ja raffinoidut hiilihydraatit nopeasti. Se kohottaa verensokerin nopeasti.

Korkea verensokeri ja happomyrkytys

Korkea verensokeri eli hyperglykemia aiheuttaa yleensä väsymystä, janon tunnetta, lisääntynyttä virtsaamistarvetta, pahoinvointia ja kuivumista. Pitkään jatkuessaan korkea verensokeri lisää riskiä sairastua diabeteksen lisäsairauksiin. Korkea verensokeri on 10-13,9 mmol/l ja hyvin korkea verensokeri yli 13,9 mmol/l.

Rasvahappojen aineenvaihdunta tuottaa ketoaineita, eli beetahydroksivoihappoa, asetetikkahappoa ja asetonia. Näiden määrä kasvaa elimistössä paastotilassa ja insuliininpuutoksen seurauksena. Ketoaineiden tuotanto on elimistön luontainen prosessi, mutta diabeetikoilla insuliinin puute voi johtaa elimistön happamoitumiseen ja happomyrkytykseen eli ketoasidoosiin, joka diabeetikoilla voi olla hengenvaarallinen tila. Ketoosi ja ketoasidoosi ovat kaksi eri asiaa.

Esidiabetesta sairastavien on tärkeää välttää sokeripiikkejä.

  • ruoat, joiden GI on 55 tai vähemmän, nostavat verensokeria hitaasti
  • ruoat, joiden GI on 56-69, kohottavat verensokeri keskinopeasti
  • ruoat, joiden GI on 70 tai suurempi, nostavat verensokeria nopeasti
  • Puhtaiden (raffinoitujen) sokereiden GI on yleensä korkeampi kuin luonnollisia sokereita sisältävien elintarvikkeiden, kuten hedelmien GI.
  • Täysjyväviljojen GI on matalampi kuin raffinoitujenviljojen GI.
  • Bataattien, useimpien vihannesten ja palkokasvien GI on pienempi kuin tärkkelystä sisältävien perunoiden ja maissin GI.
  • Hedelmien kypsyminen lisää hedelmän sokeripitoisuutta ja GI-arvoa.
  • Pastojen tärkkelyssidokset voivat olla sellaisia, että niillä on matalahko GI.
  • Esikiehautetun (parboiled) riisin, basmati-riisin ja täysjyväriisin GI on pienempi kuin lyhytjyväisten puuroriisien ja jasmiiniriisin GI.

Hiilihydraattien laskeminen

Hiilihydraattimäärien laskeminen voi helpottaa ruokavalion seuraamista. Hiilihydraattien täydellinen poistaminen ruokavaliosta ei ole suositeltavaa, sillä monet hiilihydraatteja sisältävät vihannekset sisältävät tärkeitä terveyttä ylläpitäviä ravintoaineita.

Toisaalta monet vähän hiilihydraatteja sisältävät ravintoaineet voivat korvata runsaasti hiilihydraatteja sisältävät ravintoaineet.

Esimerkiksi:

Seuraavat ruoat sisältävät runsaasti tärkkelystä eli hiilihydraatteja:

  • perunat
  • pavut ja linssit
  • riisi
  • viljat
  • maissi

Paljon hiilihydraatteja sisältävät kasvikset voi korvata mm. seuraavilla ravinne- ja kuitupitoisilla vähän hiilihydraatteja sisältävillä kasviksilla:

  • parsa
  • parsakaali
  • porkkanat (vähän)
  • selleri
  • vihreät pavut
  • salaatit ja tummanvihreät lehtivihannekset
  • paprika
  • pinaatti
  • tomaatti
  • kesäkurpitsa

Syö tasaisin väliajoin

Esidiabetesta sairastavan tulee pitää verensokeri mahdollisimman tasaisena.

Paastoaminen voi vaikuttaa merkittävästi verensokeritasoihin, joten pienet matalan- tai keskitason GI-arvon omaavat ruoat tasaisesti pitkin päivää pitävät verensokerin tasaisena ilman suuria piikkejä.

Asiantuntijat suosittelevat:

  • syömään kolmesti päivässä. Aterioiden välillä ei tulisi olla yli 6 tunnin jaksoa.
  • syömään tasapainoisesti ravinteiltaan rikasta, sopivassa suhteessa hiilihydraatteja, rasvoja ja proteiineja sisältävää ruokaa

Lautasmalli

Yksi tapa syödä terveellisesti ja tasapainoisesti on ns. lautasmalli, jota Yhdysvalloissa suosittelee paikallinen Diabetesliitto. Siinä puolet lautasesta täytetään vihanneksilla, neljännes proteiinia sisältävillä ruoka-aineilla ja neljännes hiilihydraateilla, kuten ruskealla riisillä tai kvinoalla.

Lautasmallissa jokaisen aterian tulee sisältää kolmea seuraavista neljästä ruoka-aineryhmästä.

  • hedelmä tai vihannekset
  • täysjyväviljat
  • maito- ja meijerituotteet
  • liha, kala, palkokasvit, linssit tms.

Laihtumisessa auttaa terveellisen ruokavalion lisäksi pienempi lautanen ja se, että välttää santsaamista ja ähkyksi syömistä.

DASH-dieetti

DASH on laajalti suositeltu ja terveelliseksi todettu ruokavalio. Sen tiedetään laskevan verenpainetta, mutta se voi myös ehkäistä diabetesta seuraamalla yhtäältä hiilihydraattien saantia ja toisaalta ravintoaineiden glykeemistä indeksiä.

DASH ei perustu kaloreiden vähentämiseen, vaan terveellisiin valintoihin.

DASH suosittelee syömään:

  • vihanneksia
  • hedelmiä
  • täysjyväviljoja
  • rasvattomia tai vähärasvaisia meijerituotteita
  • kalaa
  • siipikarjaa
  • papuja
  • pähkinöitä
  • kasvisöljyjä

Vältettäviä ruokia DASH-ruokavaliossa ovat esimerkiksi:

  • rasvaiset lihat
  • täysirasvaiset meijerituotteet
  • trooppiset öljyt, kuten kookosöljy ja palmuöljy
  • makeiset
  • vaaleat leivät
  • leivonnaiset, snacksit, keksit
  • makeat juomat

Pahoittelut, jos tekstiin jäi ylettömästi toistoa, asia- ja/tai kirjoitusvirheitä. Siinä oli tiistain ja keskiviikon välisen yön anti Ruokasodalle. Ehkä tuosta jotain oppi. Jokseenkin noin homma toimii ketogeenisen ruokavalion ja diabeteksen kanssa, mutta toki asioita  voi käsitellä toisesta näkövinkkelistä ja laajemminkin.

Ravitsemuksen osalta konsensuksen löytäminen on mahdotonta. Todetaan siis sama, mitä totesin aiemmin: On monta tapaa syödä oikein ja monta tapaa syödä väärin.

Kuvat: Pixabay tai ja huonommat kuvat ovat omia




Ketoherkut: Lassaka

Lassaka on vähähiilihydraattinen ja ihanan rasvainen ketoherkku. Ruoka on lasagnen ja moussakan kesäkurpitsapohjainen variaatio. Lassaka maistuu myös useimmille ketoilua vierastaville. Tästä on olemassa monenlaisia versioita. Tämä on yksi:


Raaka-aineet


Kesäkurpitsa
Sipuli
Valkosipuli
Chili
Paprika
Jauheliha
Kerma
Tomaattipyre tai -murska
Mozzarella tai Emmental-raaste
Suola, pippuri, oregano


Ohje


Viipaloi ja itketä kesäkurpitsat. Itkettäminen kannattaa, sillä kesäkurpitsat sisältävät niin paljon nestettä, että jos sitä ei poista, tuloksena on keitto. Eli levitä viipaloidut kesäkurpitsat liinalle ja ripottele päälle suolaa. Viipaleet kannattaa pyyhkäistä kuiviksi ennen käyttöä.


Silppua sipuli, valkosipulia (maun mukaan), chili ja puolikas paprika.


Ruskista jauheliha. Mausta suolalla ja pippurilla ja lisää silputut sipulit, valkosipulit, paprikat ja chili. Chilin voi korvata silputulla jalapenolla. Paista hetkinen ja lisää tomaattipyre tai murska. Täyte kannattaa keittää hyvin kokoon. Lopuksi täytteeseen voi lisätä reilusti oreganoa.


Perinteisen valkokastikkeen tilalla on kermasta ja mozzarellasta tehty kastike,joka maustetaan suolalla ja pippurilla. Erittäin kivan vivahteen antaa feta ja sinihomejuusto, joita voi lisätä maun mukaan kermaan.


Hifistelijöillä on varmasti jokin tiukka järjestys, jossa ainekset ladotaan uunivuokaan. Minä laitoin kolmessa kerroksessa keskurpitsaa, jauhelihatäytettä ja mozzarellakastiketta. Lopun mozzarella kerman lorottelin vuoan päälle ja lisäsin vielä reilusti juustoraastetta.

Lassakaa paistetaan 200-asteisessa uunissa 30-45 minuuttia tai kunnes juustokuorrutus on saanut kauniin kullanruskean värin.




Mitä, miten ja miksi LCHF-ruokavalio?

Mitä, miten ja miksi LCHF`Vähän hiilihydraatteja ja runsaasti rasvoja sisältävässä ruokavaliossa (LCHF) hiilihydraattien saantia korvataan hyvillä rasvoilla. LCHF-ruokavaliot (ketogeeninen ruokavalio ja Atkinsin dieetti) ovat suosittuja etenkin laihduttajien keskuudessa, sillä ne laihduttavat nopeasti ja tehokkaasti.

Vähän hiilihydraatteja sisältävässä ruokavaliossa elimistö opetetaan käyttämään energianlähteenä sekä ravinnosta saatua että rasvasoluihin varastoitua rasvaa, josta aineenvaihdunta valmistaa energiaravinteiksi kelpaavia ketoaineita.

Lääketieteellisesti suhtautuminen LCHF-dieetteihin on hyvin kaksijakoinen. Perinteisemmän rasvateorian mukaan rasvat ovat syypäitä lähes kaikkiin terveysongelmiin ja kaikkiin maailman muihinkin ongelmiin nälänhädästä Antti Rinteen hallitukseen.

Kasvavan tutkimusaineisto haastaa perinteiset ja fakkiutuneet opit rasvojen haitallisuudesta. Yleistä tieteellistä konsensusta rasvojen terveyshaitoista ja -hyödyistä ei kuitenkaan vallitse.


Miten noin niin kuin aikuisten oikeasti? Kannattaako ketoilu?


Täällä Ruokasodan ketonurkkauksessa haluan tarjota objektiivisen ja kattavan kuvan ketogeenisistä ruokavalioista, Atkinsin dieetistä ja muista pahamaineisista moraalia ja terveyttä turmelevista LCHF-ruokavalioista. Yritän tarjota terveellisiä LCHF-reseptejä ja vinkkejä ketoiluun. Katsotaan kuin tämä etenee.

Lähdin tähän seikkailuun 02.12.2019. Aiemmat kokemukseni vähähiilihydraattisesta ruokavaliosta olivat hyvin rohkaisevia, mutta niistä on jo vuosia. Sen jälkeen vyötärönympärys on harpannut kolme paitakokoa ja paino 20 kiloa. Tervetuloa mukaan!

Asetun itse ruokavalion keskiöön koekaniiniksi. Kommentoin ketonurkkauksessa viimeaikaista keskustelua ketogeeenisten ruokavalioiden ympärillä, tuoreita tutkimuksia ja uutisia sekä omia havaintojani. Lähtöpainoni on 92 kg ja vyötärölihavuus alkaa olla hengenvaarallisella tasolla. Lisäksi sairastan etenevää multippeliskleroosia, mikä vaikuttaa fyysiseen aktiivisuuteen sitomalla minut käytännössä tuoliin. Tavoitepainoni on 72 kg. Verenpaineeni ovat nyt riskirajoilla (keskimäärin 80-90 alapaine ja yläpaine 135-150 tasolla).

Vähän hiilihydraatteja, mutta runsaasti rasvaa ja proteiineja sisältävä ruokavalio ylläpitää kylläisyyden tunnetta hiilihydraatteja paremmin. Tämän seurauksena ravinnosta saatu kokonaisenergia yleensä laskee, mikä edistää laihtumista. Kaikissa ruokavalioissa on kuitenkin muistettava turvata välttämättömien ravintoaineiden saanti. Se on terveyden kannalta olennaista.

Laihtumisen lisäksi LCHF-dieetti auttaa ylläpitämään terveyttä, kuten European Journal of Clinical Nutrition kertoo katsauksessaan. Tuoreiden tutkimusten valossa LCHF-ruokavaliolla on suotuisia vaikutuksia

  • aikuistyypin diabetekseen
  • eräisiin syöpiin
  • munasarjojen monirakkulaoireyhtymään (PCOS)
  • Alzheimerin tautiin
  • sydämen terveydelle
  • etenevään multippeliskleroosiin

Varoituksen sana on paikallaan: tutkimukset ovat antaneet ristiriitaisia tuloksia LCHF-ruokavalioiden terveysvaikutuksista. Vähän hiilihydraatteja, kohtuullisesti proteiineja ja runsaasti rasvoja sisältävien ruokavalioiden pitkäaikaisvaikutuksia ei vielä tunneta.

Lääketieteellisessä Lancet-julkaisussa esitetyn tutkimuksen mukaan LCHF lisää kuolleisuutta kaikkiin syihin, mutta sama ilmiö toteutuu U-käyrän toisessa päässä; myös eniten hiilihydraatteja syövien kuolleisuus kasvaa saman tutkimuksen perusteella verrokkeihin nähden. Mistä tällainen voisi johtua?

On luultavaa ja jopa todennäköistä, että molemmissa ääripäissä ruokavalion yksipuolisuuden vuoksi syntyy puutoksia välttämättömistä ravintoaineista. Erään toisen tutkimuksen mukaan terveyden kannalta tärkeintä ei ole se, kuinka monta pizzaa tai hampurilaista syö, vaan se, että samalla saa kaikki välttämättömät ravintoaineet. Välttämättömien ravintoaineiden merkitystä terveydelle ei voi korostaa liikaa.

On jännä, että varsin monille LCHF-ruokavalio on punainen vaate, joka herättää suoranaista raivoa. Samanlainen vihainen asennoituminen on havaittavissa suhtautumisesta kasvisruokaan, lihan rajoittamiseen, vegaanisuuteen ja paleo-dieetin noudattamiseen. Yhteistä kaikille näille ruokavalioille on se, että niillä pyritään ylläpitämään terveyttä. Jonkin rajatun ruokavalion noudattaminen johtaa nopeasti paljon syvällisempään ravintoaineiden ja aineenvaihdunnan ymmärtämiseen, kuin mihin raivokkaimmat ruokavalioiden vastustajat koskaan yltävät. Miksi sortua trendikkäisiin ruokavalioihin, jotka muuttuvat nopeammin kuin muoti?

En halua asettaa ruokavalioita paremmuusjärjestykseen. Useimmat niistä painottavat välttämättömien ravintoaineiden saantia ja karsivat epäterveellisiä tai elimistön kannalta turhia ravintoaineita pois. On valtavasti tutkimusnäyttöä siitä, että esimerkiksi kasvisruokavaliot ja vegaanisuus ovat oikein noudatettuina hyvin terveellisiä.


Tärkeimmät syyt miettiä mitä suuhunsa laittaa ovat


Aikuistyypin diabetes

The International Diabetes Federation arvioi maailmanlaajuisesti aikuistyypin diabetekseen sairastuneiden määräksi yli 400 miljoonaa vuonna2015. Sairastuneiden määrä lisääntyy nopeasti.

Tutkimusten mukaan Yhdysvalloissa esidiabetesta sairastaa yksi kolmesta aikuisesta ja yhdeksän kymmenestä esidiabetesta sairastavasta ei tiedä olevansa sairas ennen kuin esidiabetes pahenee diabetekseksi. Pelkästään Yhdysvalloissa aikuistyypin diabetesta sairastavia on lähemmäksi 10 % väestöstä ja joka vuosi diagnosoidaan 1,4 miljoonaa uutta sairastunutta. Yhdysvalloissa diabeteksen hoitomenot olivat 245 miljardia dollaria vuonna 2012 ja kasvavat vuosittain.

Maailmanlaajuisesti diabetes aiheutti arviolta 1,5 miljoonaa ennenaikaista kuolemantapausta vuonna 2012. Sairastuneiden määrä, hoidon hinta ja kuolleisuus lisääntyvät joka vuosi.

Tyypin 2 diabetes on elintaso- ja elintapasairaus, johon vaikuttavat mm. lihavuus (erityisesti vyötärölihavuus), ikä, vähäinen liikunta ja huonot ravitsemustottumukset. Tutkimusten mukaan LCHF-ruokavaliot pienentävät sairastumisen riskiä ja vähentävät aikuistyypin diabetesta sairastavien lääkkeiden tarvetta. Esimerkiksi Ruotsissa LCHF on aikuistyypin diabeteksen hoidossa hyväksytty ruokavalio.


Lihavuus

Lihominen on maailmanlaajuinen ongelma. Se tappaa jo enemmän ihmisiä kuin aliravitsemus. Vuoden 1975 jälkeen lihavien määrä on kolminkertaistunut. Ylipainoisia aikuisia maailman väestöstä oli vuonna 2016 yli 1,9 miljardia. Näistä 650 miljoonaa eli 39 % oli lihavia. Alle 5-vuotiaista lapsista jopa 41 miljoonaa ja 5-19-vuotiaista 340 miljoonaa oli samana vuonna ylipainoisia tai lihavia. Luvut ovat käsittämättömiä. (WHO)

WHO:n mukaan ylipainoisia ovat ihmiset, joiden BMI (painoindeksi) on 25 tai suurempi. Lihavia ovat ihmiset, joiden BMI on 30 tai suurempi.

Lihavuus on lisääntynyt dramaattisesti. Lihavien ja ylipainosten osuus lapsista oli 4 % vuonna 1975. Nyt lapsista lähes viidennes (18 %) on ylipainoisia tai lihavia. Vuonna 1975 ylipainoisten ja lihavien 5-19-vuotiaiden osuus ikäryhmässä oli vain 1 %, vuonna 2016 saman ikäisten ylipainoisten ja lihavien osuus oli ikäryhmän tytöistä 6 % ja pojista 8 %.

Lihavuus kasvattaa mm. sydän- ja verisuonitautien, metabolisen oireyhtymän, aikuistyypin diabeteksen, syöpien, luunmurtumien ja erilaisten nivel- ja selkävaivojen sekä ennenaikaisen kuoleman riskiä.


Suolistotulehdukset (ärtyvän suolen oireyhtymä eli IBS)

Ärtyvän suolen oireyhtymä (IBS) vaivaa jopa 10-15 prosenttia maailman aikuisväestöstä. IBS ei sinänsä ole hengenvaarallinen sairaus, mutta sen vaikutukset elämänlaatuun ja terveydenhoidolliset kustannukset ovat merkittäviä. IBS on suurin sairauspoissaolopäivien syy tavallisen flunssan jälkeen.

Tulehdukselliset suolistosairaudet yleistyvät nopeasti. Suomessa myös paksusuolen syöpä lisääntyy, mutta lisääntymisen syytä ei tunneta.

Crohnin tauti ja haavainen paksusuolentulehdus ovat kroonisia suoliston tulehduksellisia sairauksia, jotka oireilevat mm. ripulina, verisenä ulosteena ja vatsakipuina. Molemmat edellyttävät perinnöllisen alttiuden sairastua, mutta sairastuminen käynnistyy usein jonkin infektion (kuten turistiripulin) tai stressin seurauksena. Riskitekijöitä ovat lisäksi runsaasti eläinperäistä proteiinia sisältävä ja rasvainen ruoka sekä D-vitamiinin puutos.

Ärtyvän suolen oireyhtymää sairastaa Suomessa jo noin 300 000 henkilöä ja esiintyvyys aikuisväestössä on 10 %. Diagnosoitujen keliakiatapausten ja tulehduksellisten suolistosairauksien esiintyvyys on 1 prosentin luokkaa molempien kohdalla.

Ärtyvän suolen oireyhtymän tavallisia oireita ovat: vatsan turvotus, vatsakipu sekä ummetus- ja ripulioireet. Oireiden taustalla voi olla mm.

Tavallista herkempi vatsan alueen kipuaistimus (alhainen kipukynnys)

  • Lisääntynyt kaasun tuotto paksusuolessa ja mahdollisesti ohutsuolessa
  • Häiriöitä suoliston mikrobitasapainossa
  • Matala-asteinen tulehdus suolessa
  • Suoliston voimakas ja kivulias supistelu tai suolen toiminnan laiskistuminen


    FODMAP-hiilihydraattien (fermentoituvien hiilihydraattien) rajoittaminen helpottaa viimeaikaisen tutkimusnäytön perusteella ärtyvän suolen oireyhtymää. FODMAP-hiilihydraatit ovat kasvikunnan tuotteissa esiintyviä huonosti ohutsuolessa imeytyviä kuitumaisia hiilihydraatteja. FODMAP-hiilihydraattien huono imeytyminen ohutsuolessa päästää näitä paksusuoleen, jossa ne fermentoituvat paksusuolen mikrobien vaikutuksesta. Fermentaatio on sinänsä aivan luonnollinen ja hyvä reaktio, mutta IBS-potilailla se aiheuttaa oireita.

    Laktoosi-intoleranteilla ihmisillä oireita aiheuttaa maitotuotteet. Ksylitoli, sorbitoli, laktitoli, maltitoli, mannitoli ja isomalti, luumut ja kivelliset hedelmät, omenat, sienet, raffinoosi, inuliini, vehnä, ruis, ohra, palkokasvit, sipulit, kaalikasvit ja vesimelonit, jogurtit ja fruktoosi selittävät oireita monilla ärtyvän suolen oireyhtymää sairastavilla.

Kesäkuussa 2009 Clinical Gastroenterology and Hepatology -lehdessä julkaistun tutkimusraportin mukaan hyvin vähän hiilihydraatteja sisältävä ruokavalio helpottaa ärtyvän suolen oireyhtymän oireita. On jonkin verran tieteellistä näyttöä siitä, että suolisto-oireet helpottavat LCHF-ruokavaliolla.

Alkoholista riippumaton rasvamaksa (NAFLD)

Alkoholista riippumaton rasvamaksa yleistyy nopeasti myös Suomessa. Maksan vähäinen rasvoittuminen ei välttämättä ole vaarallista, mutta se voi johtaa vakavampiin sairauksiin, kuten NASH (non-alcoholic steatohepatitis), jossa maksan rasvoittuminen assosioituu maksan tulehdukseen. Se voi johtaa maksan arpeutumiseen ja maksakirroosiin. Rasvamaksa ei välttämättä juuri oireile ennen kuin se pahenee maksatulehdukseksi.

NAFLD liittyy lihomiseen, metaboliseen oireyhtymään, esidiabetekseen ja aikuistyypin diabetekseen. Mikä maksan rasvoittumista aiheuttaa. Tästä vallitsee useita tieteellisesti perusteltuja näkemyksiä. Tutkimuksissa on havaittu, että vakavampaan NASH-tautiin vaikuttavat mm.

– Oksidatiivinen stressi
– Inflammaatio
– Maksasolujen nekroosi eli maksasolujen kuoleminen
– Rasvakudoksen inflammaatio
– Suoliston mikrobiomin epätasapaino (huono bakteerikanta)

Alkoholista riippumattoman rasvamaksan riskitekijöistä lihavuus on ylivoimainen ykkönen. Lihavista kahdella kolmanneksella on rasvoittunut maksa. Insuliiniresistenssi ja aikuistyypin diabetes sekä PCOS kasvattavat myös maksan rasvoittumisen riskiä.

Tehokkain tapa hoitaa rasvoittunutta maksaa on laihduttaminen. Myös lisättyjen sokereiden ja aivan erityisesti teollisen fruktoosisiirapin saannin vähentäminen päivittäisestä energiansaannista on järkevää, koska fruktoosin aineenvaihdunta tapahtuu maksassa ja pieni osa fruktoosista muutetaan aina triglyserideiksi maksassa.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävistä LCHF-ruokavalioista ja niiden terveysvaikutuksista voidaan toki olla montaa mieltä, mutta varmaa on se, että oheiset ravitsemukseen liittyvät epidemiana leviävät sairaudet eivät johdu siitä, että kourallinen ihmisiä rajoittaa hiilihydraatteja ja korvaa merkittävän osan päivän energiansaannista rasvoilla.

Jos LCHF ei paranna mainittuja sairauksia, on todennäköistä, että oksidatiivisen stressin ja inflammaation hillitseminen sekä laihtuminen helpottavat oheisten sairauksien oireita ja laskevat sairastumisriskiä LCHF-ruokavaliolla.

Nykyiset elintavat, energiatiheät ja ravitsemukseltaan köyhät ruoat sekä stressi ja jatkuva kiire ylläpitävät ja levittävät lihavuusepidemiaa, metabolista oireyhtymää, suolistosairauksia, diabetesta, rasvamaksaa jne. Siksi mikä tahansa ruokavalio kasvisruokavaliosta välimerelliseen tai LCHF-ruokavalioon sekä ymmärrys ravintoaineista ja aineenvaihdunnasta voi laskea sairastumisen riskiä ja ylläpitää terveyttä ja terveellistä painonhallintaa.

Joskus lääketieteessä tuntuu olevan vallalla ajatus, että jos auto liikkuu, ei autolla kannata ajaa ennen kuin tiedetään mihin sen liikkuminen perustuu. Tarvitaan siis lisää tutkimuksia. Se on hyvä asia. LCHF toimii ja sitä noudattavat ihmiset raportoivat jatkuvasti laihtumisesta ja terveyden kohenemisesta, mutta teoriassa sitä ei kannata noudattaa, koska vielä ei sataprosenttisesti ymmärretä, miksi se toimii. LCHF-ruokavalion pitkäaikaisvaikutuksista ei ole olemassa tutkittua tietoa ja siksi siihen suhtaudutaan vielä hyvin varovaisesti. Jokaisen on järkevää kuunnella ja seurata oman elimistönsä lähettämiä viestejä.

Ruokasotaa aloitellessani vuosia sitten uskoin, että jos kysyn oikeat kysymykset, löydän myös oikeat vastaukset. Nykyään olen paljon skeptisempi. Uskon, että ei ole oikeita kysymyksiä ja oikeita vastauksia. Kaikkiin lupauksiin, joita nettivideoissa ja kirjoituksissa annetaan, kannattaa suhtautua terveen skeptisesti.

Helppoja ja yleispäteviä vastauksia vaikeisiin kysymyksiin ei ole. LCHF ei ole ruokavalio, joka soveltuu kaikille tai parantaa kaikki vaivat. Se on tehokas laihdutusruokavalio, joka tutkimusten mukaan voi vähentää oksidatiivista stressiä ja inflammaatiota. Stanfordin yliopistossa tehdyn tutkimuksen mukaan sekä kaloreita rajoittamalla että runsaasti rasvaa sisältävällä ruokavaliolla laihtuu, mutta molemmissa tutkimusryhmissä esiintyi paljon vaihtelua seurattujen henkilöiden laihtumisen suhteen.

Kesäkurpitsanuudelit


Okei, miten aloitan?


Aineenvaihdunta on mutkikas järjestelmä. Ihmisten painonhallintaan vaikuttaa lukemattomia tekijöitä stressistä hormoneihin ja perinnölliseen lihomisalttiuteen. Jotkut eivät liho ja toiset keräävät varastorasvoja luokattoman helposti ja nopeasti. Toisaalta joillekin arkiliikunta ja tasapainoinen ruokavalio riittävät hyvän terveyden ylläpitoon, kun taas sairaalloisen lihavien laihtuminen vaikuttaa jo mahdottomalta.

Jörn Donner totesi, että lukeminen kannattaa aina. Hän oli oikeassa. Sama pätee laihduttamiseen ylipainoisilla. Laihtuminen parantaa terveyttä ja lisää terveitä elinvuosia. Se, miten ihminen laihtuu, on vähemmän tärkeää kuin se, että ihminen laihtuu. Tavallaan on ristiriitaista, että ihmisiä syyllistetään ja pelotellaan onnistumisesta, perustuu onnistuminen sitten vegaaniruokavalioon tai Atkinsin dieettiin. Jos ihmisen verenkuva, paino, verenpaine, verensokeri ja yleinen hyvinvointi kohenevat, onko sillä väliä, päästiinkö tulokseen LCHF-ruokavaliolla vai kasvisruokavaliolla.

Tärkeintä on, että ihminen saa ravinnostaan kaikki välttämättömät ravintoaineet. Laajemmin on havaittu, että vähemmän energiaa sisältävä ravinto (syödyistä makroravinteista riippumatta) ylläpitää terveyttä ja terveitä elinvuosia. Tämä johtunee sirtuiineista (histonideasetylaaseista). Esimerkiksi SIRT1 säätelee keskeisiä metabolisia prosesseja ja sillä on tärkeä merkitys aineenvaihdunnan säätelyssä.

SIRT1 säätelee mm. mitokondrioiden biogeneesiä sekä energia- ja rasvametaboliaa, oksidatiivista stressiä ja vaikuttaa esimerkiksi lihavuuteen ja diabetekseen. SIRT1 säätelee todennäköisesti tulehdusvaisteita ja kudosten atrofioitumista sitoutumalla NF-kB:en. SIRT2 vaikuttaa solunjakautumiseen.

Henkilöiden, jotka päättävät kohentaa terveyttä ja laihtua LCHF-ruokavalion avulla, on syytä syödä hiilihydraattirajoitteista riippumatta mahdollisimman monipuolisesti.

On jonkin verran tutkimusnäyttöä, jonka mukaan kasviperäisten proteiinien ja rasvojen saanti LCHF-ruokavaliossa ylläpitää terveyttä paremmin kuin eläinperäiset rasvat ja proteiinit. Ruokavalion sallimia kasviksia on hyvä syödä runsaasti. Niistä saa kuituja, antioksidantteja, polyfenoleita, vitamiineja, mineraaleja jne., joita elimistö tarvitsee. Rasva on LCHF-ruokavaliossa polttoaine, mutta keho tarvitsee myös aminohappoja, kuituja, vitamiineja jne.

Ensimmäinen ja kenties yksi tärkeimmistä ravintoon liittyvistä valinnoista koskee lisättyjen sokereiden, valkoisten jauhojen ja voimakkaasti raffinoitujen elintarvikkeiden välttämistä. Pelkästään tämä pieni muutos elämäntavoissa voi auttaa laihtumaan ja parantamaan yleistä hyvinvointia. Vaaleat leivät kannattaa korvata täysjyväviljoista leivottuihin leipiin, makeisista ja virvoitusjuomista on hyvä luopua kokonaan jne.

Minä en laske kaloreita tai hiilihydraatteja lainkaan. Tiedän suurin piirtein, mitä kasviksia voin syödä ja sen jälkeen seuraan vain omaa kylläisyyttäni. Luultavasti saan päivittäisestä energiastani nyt yli puolet rasvasta, 30 prosenttia proteiineista ja 10-20 % hiilihydraateista. Se ei aivan noudata ketogeenistä ruokavaliota tai Atkins-ruokavaliota, mutta toisaalta olen luopunut lisätyistä sokereista, runsaasti tärkkelystä sisältävistä perunoista ja riisistä sekä viljoista ja korvaan noiden rajoittamisen tuottaman energiavajeen rasvoilla.

Tämä on kolmas päivä ruokavaliomuutokseni jälkeen. Kaksi ateriaa päivässä on pitänyt minut kylläisenä ja energisenä kahtena ensimmäisenä päivänä. Olen syönyt lounasbrunssin puolen päivän tienoilla ja päivällisen 17-18 aikaan.

Molempien päivien ruoka on koostunut suuresta määrästä sallittuja kasviksia (tomaatit, kurkku, kaali, paprika, salaatti, kesäkurpitsa), rasvasta ja proteiinista (jauheliha, kana). Mitään välipaloja tms. ei ole tehnyt mieli. Yhtenä huomiona olen havainnut, että suoli on toimin poikkeuksellisen hyvin ja täsmällisesti. Se on ilahduttavaa, sillä minulla on ollut ärsyttäviä suolistovaivoja.

Eilinen ruoka (0.12.2019)

Heräsin viiden aikaan. Join aamun ja aamupäivän aikana 4 kupillista mustaa kahvia. En ole koskaan ollut aamupalan ystävä.

Nälkä tuli kello 11 ja 12 välillä, jolloin tein kanasalaattia lounaaksi. Salaattiin tuli jäävuorisalaattia, kurkkua, tomaatteja ja keitettyjä vihreitä papuja. Paistoin ja maustoin (pippurilla, suolalla ja chilillä) kanafileistä leikkaamani suikaleet runsaassa voissa. Tein majoneesin itse: 2 dl rypsiöljyä, muna, korkillinen etikkaa, 0,5 tl suolaa, 1 tl mustapippuria, 1 tl valkosipulijauhetta, 1 tl chilimurskaa öljyssä, 2 tl currya. Näin syntyy hyvin kiinteä majoneesi, jota pehmensin 1,5 desillä rasvaista maustamatonta turkkilaista jogurttia. Sekoitin ainekset keskenään ja hyvää tuli. Se oli lounas.

Iltapäivällä join melkoisesti vettä. Päivälliseksi tein ison täytetyn kesäkurpitsan, johon tuli täytteeksi mm. paistettua jauhelihaa, tomaattikastiketta ja runsas juustokuorrutus. Päivällisen jälkeen join vielä 4 kupillista teetä.

Ruokavalion noudattamisessa on tärkeää seurata ja kuunnella omaa elimistöä

LCHF sisältää useita koulukuntia ja erilaisia ravintohifistelijöitä mahtuu jokaiseen koulukuntaan ruokavalioista riippumatta. En pidä hifistelyä tarkoituksenmukaisena. Pääpiirteitten ollessa selvät henkilön tulee kuunnella omaa elimistöään, eikä jotain gurua. Hiilihydraattien määrä LCHF-ruokavaliossa lasketaan maksimissaan 50 grammaa päivätasolle, mutta mieluummin vieläkin alemmalle tasolle, jos tarkoituksena on ketoosiin pääsy.

Atkinsin ruokavalio

Atkinsin ruokavalio koostuu neljästä vaiheesta:

  • Vaihe 1: Hiilihydraattien määrä lasketaan 20 grammaan päivässä. Tämä jatkuu 2 viikkoa.
  • Vaihe 2: Päivittäiseen syömiseen lisätään pähkinöitä, vähäisiä määriä hedelmiä ja vähähiilihydraattisia vihanneksia.
  • Vaihe 3: Asetetun painotavoitteen lähestyessä hiilihydraattien saantia voidaan lisätä.
  • Vaihe 4: Ruokavalioon otetaan mukaan täysjyväviljoja ja muita terveellisiä hiilihydraatteja sen verran, että paino pysyy tasaisena.

The ketogeeninen ruokavalio

Ketogeeninen ruokavalio rajoittaa hiilihydraatteja merkittävästi ja tähtää ketoosiin, jossa elimistö alkaa tehokkaasti käyttää rasvoja solujen energian lähteenä.

Ketogeeniset ruokavaliot jakautuvat opillisten ja tavoitteellisten erojen puitteissa eräänlaisiin koulukuntiin. Tavallisesti tavoitteena on laskea päivittäinen hiilihydraattien saanti 5-10 prosenttiin päivittäisestä energiasta. Määrällisesti tämä tarkoittaa noin 20-50 grammaa hiilihydraatteja/päivässä.

Ruokavalion tavoitteena on ketoosi, joka on luonnollinen tila, kun elimistö ei saa riittävästi energiaa hiilihydraateista. Ketoosissa elimistö alkaa pilkkomaan varastoimiaan rasvahappoja ketoaineiksi, joita solut voivat hyödyntää energian tuotannossa. Ketoosia ei tule sekoittaa vaaralliseen happomyrkytykseen, ketoasidoosiin. Ketoasidoosissa veren ketoainepitoisuudet nousevat jopa kymmenkertaisiksi ketoosiin verrattuna.

Kanasalaatti


Hyvin suunniteltu on puoliksi tehty


Kaikki ruokavaliot edellyttävät hieman valmistelua ja suunnittelua. Ongelmia syntyy, jos ruokavalio yksipuolistuu liikaa. Silloin se ruokavalion noudattamisesta tulee vaikeaa ja laihduttaminen loppuu nopeasti alkuinnostuksen jälkeen. Siksi on tärkeää suunnitella ruokavaliota niin, että se sisältää vaihtelua, monipuolisia raaka-aineita ja tarjoaa kaikki tarvitut ravinteet.


Mitä söisin tänään?


LCHF-ruokavalioissa hiilihydraattien rajoittaminen rajoittaa syötävien ruokien määrää. Tämä voi tuottaa motivaatio-ongelmia.

Alkavan ketoilijan kauppalista

– Cashew-pähkinät (hyviä rasvoja ja proteiineja)
– Lihat (possu, nauta, kana, kalkkuna, lammas)
– Kalat (erityisesti rasvaiset lohi, sardiinit ja makrilli)
– Juustot
– Voi
– Avokadot
– Öljyt (oliivi-, kookos-, avokado- ja pellavansiemenöljy)
– Pähkinät (maapähkinät, mantelit, cashew-pähkinät)
– Siemenet (auringonkukan siemenet, chia ja pellavansiemenet)
– Munat
– Pinaatti ja muut tummanvihreät lehtivihannekset
– Marjat (mustikat, mustaviinimarjat, mansikat )
– Parsakaali
– Kukkakaali
– Valkokaali
– Ruusukaali
– Parsa
– Kesäkurpitsa
– Tomaatit
– Paprika
– Myskikurpitsa
– Juomaksi (vesi, kahvi, tee)

Seuraavia voi ketogeenisella ruokavaliolla syödä hieman ruokavalion tavoitteista riippuen:

– Porkkanat (vähän)
– Punajuuret (vähän)
– Omena, vesimeloni tai persikka (vähän)
– Kvinoa (vähän)
– Bataatti (vähän)
– Pavut ja palkokasvit (vähän)
– Kauraa (vähän)
– Täysjyviä (vähän)

Rajoitettavia ruokia ovat

Kaikilla LCHF-ruokavalioilla rajoitetaan hiilihydraatteja ja aivan erityisesti puhtaita sokereita ja runsaasti tärkkelystä sisältäviä kasviksia, kuten perunoita ja riisiä. Ruokavalio ei suosittele virvoitusjuomia, mehuja, kakkuja, leivoksia, makeisia, fruktoosisiirapilla tai millään teollisilla makeutusaineilla makeutettuja raffinoituja elintarvikkeita tai alkoholisokereita. Muita rajoitettavia ovat:

  • valkoinen pasta
  • valkoinen riisi
  • leipä, sämpylät ja patongit
  • leivonnaiset, pullat, muffinssit jne.
  • makeiset
  • virvoitusjuomat, mehut
  • olut
  • dieettijuomat ja yleensäkin dieetti-mitkä tahansa
  • vähärasvaiset elintarvikkeet, sillä niissä rasvat on korvattu sokereilla

Kaikkia hiilihydraatti- ja tärkkelyspitoisia ruokia ei ole pakko poistaa ruokalistalta. LCHF-ruokavaliota voi noudattaa, jos siihen sisältyy rajoitetusti papuja ja muita palkokasveja sekä täysjyväviljoja. Niiden määrien tulisi olla vähäisiä, eikä niitä suositella päivittäiseen ruokavalioon.

Ja lopuksi

LCHF-ruokavaliot vaikuttavat eri ihmisiin eri tavoin. Korostan jälleen, että välttämättömien ravintoaineiden saannista tulee huolehtia, vettä tulee juoda riittävästi ja elimistöä pitää kuunnella. LCHF-ruokavaliot voivat aiheuttaa (ainakin kuurin alkuvaiheessa)

  • väsymystä ja heikkoutta
  • kramppeja
  • päänsärkyä
  • ummetusta tai ripulia
  • kutinaa
  • pahanhajuisen hengityksen

Kun elimistö sopeutuu ruokavalion muutoksiin, sivuoireet vähenevät ja katoavat. Tsemppiä ja hyvää terveyttä kaikille, jotka tämän tien valitsevat. Omat kokemukseni olivat ja ovat rohkaisevia, mutta nähtäväksi jää. Oli LCHF-ruokavalio terveellinen tai ei, se ei ainakaan voi olla huonompi vaihtoehto kuin ravinneköyhien ja energiatiheiden transrasvoja runsaasti sisältävien eines- ja pikaruokien, makeisten ja makeiden virvoitusjuomien ahmiminen pitkin päivää.

Kuvat: Pixabay




Ketogeeninen ruokavalio ja MS

Noudatin vähähiilihydraattista ruokavaliota vuosia sitten. Kokeilu jäi vain vajaan vuoden mittaiseksi, mutta kokemukseni olivat sekä painonhallinnan että yleisen hyvinvoinnin kannalta rohkaisevia. Oloni oli erinomaisen hyvä ja painoni laski.

Ruokavalion noudattaminen kaatui jouluherkkuihin. Noiden aikojen jälkeen olen lihonut 20 kiloa ja rasvaa on kerääntynyt erityisesti keskivartalolle haitallisena viskeraalisena läskinä. On aika tehdä jotain.

Ketogeeninen ruokavalio ja MS selvittää vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion vaikutuksia etenevää MS-tautia sairastavan terveyteen. 

Ketogeeninen ruokavalio herättää voimakkaita tunteita. Monien on yhä vaikea hyväksyä sitä, että syöty rasva voi laihduttaa. Ketogeeninen ruokavalio kuitenkin toimii mainiosti laihdutusruokavaliona.

MS on siinä mielessä viheliäinen sairaus, että se vaikuttaa vääjäämättä fyysiseen aktiivisuuteen. Painoa alkaa kertyä huomaamatta. Minä olen nauttinut invaliditeetin tuomasta joutenolosta syömällä epäterveellisesti ja juomalla pikkukylän vuosittaista vedenkulutusta vastaavan määrän olutta. Siinäpä tekosyyt.

Mitä ketogeenisella ruokavaliolla tarkoitetaan?

Ketogeeninen dieetti on vähähiilihydraattinen ja runsaasti rasvaa sisältävä ruokavalio. Proteiinien määrä pidetään ruokavaliossa maltillisena.

Evidenssiä tämän ruokavalion hyödyistä laihdutusruokavaliona on runsaasti. Sen sijaan näyttö siitä, että ketogeeninen ruokavalio helpottaisi etenevän multippeliskleroosin oireita, on vähäistä.

Laihtumisella ja elimistön hiljaisen tulehduksen – inflammaation – hillitsemisellä on terveyttä edistäviä vaikutuksia. En usko, että ruokavalio tekee ihmeitä sairaudelleni, mutta toivon laihtuvani sen avulla.

Ruokavaliossa hiilihydraattien, kuten tärkkelyksen ja sokereiden määrää rajoitetaan. Tämä tarkoittaa, että monet yleiset ruoka-aineet, kuten perunat, pastat, riisi, leivät ja hedelmät ovat rajoitettavien ravintoaineiden listalla.

Lihakasvis-vartaat

Ruokavalion puolestapuhujat korostavat, että ketogeeninen ruokavalio voi auttaa laihtumaan ja hillitsemään keskushermostoa degeneroivia tulehdusreaktioita.

Ketogeenisen aineenvaihdunnan perusteet ja toivotut hyödyt

Ketogeeninen ruokavalio voi mahdollisesti hillitä multippeliskleroosin oireita. Mihin ruokavalio ja tällaiset väitteet perustuvat?

Ketogeenisen ruokavalion tarkoituksena on ohjata solujen energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Kehon energiantuotantoa säätelee monet hormonit ja entsyymit, joista ketogeenisen ruokavalion kannalta mielenkiintoisimpia ovat insuliini ja glukagoni.
Ketogeeninen ruokavalio perustuu pitkälti juuri insuliinin ja glukagonin toiminnan ymmärtämiseen ja hyödyntämiseen.

Solujen energiantuotanto

Solut rakastavat glukoosia, sillä se on helppo ja nopea energianlähde. Ruoansulatuskanavassa hiilihydraatit, kuten tärkkelystä sisältävät perunat ja riisi, pilkotaan sokereiksi ja muiksi ravinteiksi. Glukoosi kulkee ohutsuolen endoteelin läpi verenkiertoon eräiden glut-molekyylien kuljettamana ja kohottaa verensokeria.

Haima reagoi sokeripitoisuuden lisääntymiseen erittämällä vereen insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, jolloin solun sisältämät solukalvon läpäisevät glukoosia kuljettavat kanavat tulevat solukalvolle. Näiden avulla glukoosi pääsee soluun.

Solun sytoplasmassa käynnistyy glykolyysi, jossa glukoosimolekyyli pilkotaan kahdeksi pyruvaatiksi. Reaktiossa syntyy myös kaksi korkeaenergistä ATP-molekyyliä ja kuusi vetyionia kumpaakin pyruvaattia kohden. Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit.

NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen. Anaerobinen (hapeton) energiantuotanto loppuu siihen, että pyruvaatit pelkistyvät laktaatiksi.

Sitruunahappokierto
Kuvan lähde: Wikipedia

Aerobinen (hapellinen) energiantuotanto jatkuu soluhengityksenä sitruunahappokierrossa sellaisissa soluissa, joilla on käytettävänään happea ja mitokondrioita. Sitruunahappokierto (Krebsin sykli, trikarboksyylihappokierto (TCA-kierto)) käynnistyy sitraattisyntaasientsyymin katalysoidessa sitraatin muodostumista oksaaliasetaatista ja asetyylikoentsyymi-A:sta.  

Sitraatista kierto etenee isositraattiin, siitä alfa-ketoglutaraattiin, edelleen sukkinyyli-koentsyymi-A:han, sitten sukkinaattiin, edelleen fumaraattiin, sitten malaattiin, kunnes kierto palaa oksaaliasetaattiin. Tuloksena asetyyliryhmä on hapetettu täydellisesti hiilidioksidiksi ja kolme NADH:ta, yksi FADH2 ja yksi GTP on tuotettu. Ketoilijoiden kannalta oleellista on, että rasva muutetaan sitruunahappokierron väliaineeksi – asetyylikoentsyymi-A:ksi.

Ennen kuin hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi.

 Mitokondrioissa tapahtuvassa sitruunahappokierrossa syntyy vielä parikymmentä korkeaenergistä ATP-molekyyliä ja protoneja elektroninsiirtoketjuun. Soluhengityksen lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat ihon ja hengityksen kautta. Sokerit ja rasvat siis palavat solujen mitokondrioissa vedeksi ja hiilidioksidiksi. Glukoosi kelpaa sellaisenaan solujen energiantuotantoon. Rasvat ja proteiinit on ensin muokattava asetyylikoentsyymi-A:ksi ja sokerit glukoosiksi.

Kun elimistö pakotetaan hyödyntämään rasvasoluihin varastoitua rasvaa energianlähteenä, läskin palaminen tehostuu huomattavasti.

Kaikki sokerit eivät kelpaa suoraan energiantuotantoon, vaan ne pitää ensin muuttaa glukoosiksi ja glykogeeneiksi, jotka muodostuvat jopa kymmenistä tuhansista yksittäisistä glukoosimolekyyleistä. Ravinnosta saatavan fruktoosin aineenvaihdunta eli fruktolyysi tapahtuu maksassa. Suurin osa fruktoosista syntetisoidaan glykogeeneiksi maksan nopeisiin sokerivarastoihin. Osa fruktoosista muutetaan maksassa glukoosiksi, joka vapautuu verenkiertoon ja ravitsee solujen energiantarvetta. Pari prosenttia fruktoosista muutetaan maksassa suoraan triglyserideiksi eli varastorasvaksi. Fruktoosin aineenvaihdunta rasittaa ja voi pahimmillaan rasvoittaa maksaa. Ilmeisesti epidemiaksi äitynyt alkoholista riippumaton rasvamaksa palautuu väestön ylettömään sokerin kulutukseen.

Jos veressä on liikaa glukoosia solujen ravinteiksi sekä lihasten ja maksan glykogeenivarastoihin, aineenvaihdunta alkaa muuttaa sokereita triglyserideiksi eli varastorasvaksi de novo lipogeneesissa. Insuliini osallistuu myös rasvanhappojen varastoimiseen rasvasoluihin. Tähän perustuu sokereiden lihottava vaikutus.

Kun veren sokeripitoisuus laskee, haima erittää vereen glukagonia. Glukagoni on insuliinin vastavaikuttaja ja sillä on monia tärkeitä tehtäviä aineenvaihdunnan säätelyssä.

1. Glukagoni purkaa maksan glykogeenivarastoja glukoosiksi verenkiertoon solujen energiantuotannon turvaamiseksi ja lihasten glykogeenivarastoja lihasten energiantuotantoon.

2. Glukagonin vaikutuksesta rasvasoluihin varastoituja triglyseridejä vapautuu verenkiertoon. Maksassa ja munuaisissa käynnistyvät ketogeneesi ja glukoneogeneesi. Ne valmistavat verenkiertoon vapautuneista vapaista rasvahapoista yms. aineista solujen energiantuotantoon kelpaavia ketoaineita ja glukoosia. Glukoneogeneesi syntetisoi mm. vapaista aminohapoista ja sitruunahappokierron välituotteista glukoosia.

Verensokerin kohotessa insuliini keskeyttää ketogeneesin ja glukoneogeneesin.

3. Rasvahappojen beetaoksidaatio käynnistyy

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Sen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta, kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Ketogeenisessä ruokavaliossa elimistö alkaa aktiivisesti muuttaa varastoimiaan rasvoja energiaksi kelpaavaan muotoon, koska soluille ei tarjota helppoa ja nopeaa glukoosia energianlähteeksi. Keho siis pakotetaan polttamaan rasvaa. Tästä ketoosissa ja ketogeenisessä ruokavaliossa on kyse.

Aineenvaihduntaprosessi on täysin luonnollinen. Elimistö osaa käyttää rasvaa polttoaineena, mutta koska solut on lapsuudesta lähtien tehokkaasti opetettu käyttämään polttoaineena sokeria, rasvavarastoja ei juurikaan pureta; lihominen jatkuu niin kauan kuin tarjolla on helppoja hiilihydraatteja ja veren insuliinipitoisuus säilyy korkeana. Elimistö alkaa purkaa rasvavarastoja, kun sille ei tarjota helppoa energiaa. Tavallaan kaloreita merkittävästi rajoittamalla päädytään samaan tilanteeseen, jossa kehon on turvauduttava varastoenergiaan.


Ketoosin hyödyt

Elimistö menee ketoosiin, kun veren sokeripitoisuus ja sen seurauksena insuliinipitoisuus ovat matalat. Varsinainen ketoaineita tuottava ketoosi käynnistyy muutamassa vuorokaudessa, jos hiilihydraattien saantia rajoitetaan 20-50 grammaan vuorokaudessa. Kehon varastoimien rasvojen tehokas käyttö energianlähteenä alkaa noin kolmessa viikossa edellyttäen, että hiilihydraattien saanti pysyy hyvin matalana. Ketoosissa:

  • paino laskee ja elimistö käyttää tehokkaasti varastorasvoja energianlähteenä
  • muuttunut aineenvaihdunta suojaa soluja
  • inflammaatio ja hapetus-pelkistysreaktion epätasapainon seurauksena syntyneet happiradikaalit vähenevät ja antioksidatiiviset prosessit tehostuvat
  • stressihormonien määrä elimistössä ja stressitasot laskevat


Ketogeeninen ruokavalio ja MS

Eräs ketogeeniseen ruokavalioon liitetty vaikutus on se, että se suojelee elimistöä solutasolla vaikuttamalla hapetusstressiin (oksidatiivinen stressi). Verensokerin nousu assosioituu oksidatiiviseen stressiin ja se ylläpitää inflammaatiota.  

Lihavilla myös ylimääräinen rasvakudos ylläpitää elimistön tulehdustilaa, koska rasvakudos erittää erilaisia tulehdussytokiineja eli tulehdusta välittäviä aineita. Laihduttaminen vähentää tällaista inflammaatiota ja tehokas laihtuminen voi laskea tulehdusarvoja (CRP) merkittävästi ja siten parantaa yleistä terveyttä.  

Mitä tutkimukset sanovat?

Saksalaisen 2015 toteutetun seurantatutkimuksen perusteella ketogeeninen ruokavalio parantaa multippeliskleroosia sairastavien elämänlaatua. Tutkimuksen miinuksena on, että se oli hyvin pienimuotoinen (60 osallistujaa) ja kesti vain puoli vuotta.

Saman vuoden aikana ilmestynyt tutkimusraportti löysi viitteitä siitä, että ketogeeninen ruokavalio suojaa etenevää multippeliskleroosia sairastavien keskushermostoa etenevään multippeliskleroosiin assosioituvilta neurodegeneratiivisilta tuhoilta.

”Until recently, multiple sclerosis has been viewed as an entirely inflammatory disease without acknowledgment of the significant neurodegenerative component responsible for disease progression and disability. This perspective is being challenged by observations of a dissociation between inflammation and neurodegeneration where the neurodegenerative component may play a more significant role in disease progression. In this review, we explore the relationship between mitochondrial dysfunction and neurodegeneration in multiple sclerosis. We review evidence that the ketogenic diet can improve mitochondrial function and discuss the potential of the ketogenic diet in treating progressive multiple sclerosis for which no treatment currently exists.” Lue tutkimus
tästä.

Ketogeeninen ruokavalio näyttää hyödyttävän multippeliskleroosia sairastavia solutasolla. Se vähentää oksidatiivista stressiä ja lisää veren antioksidanttitasoja. Tämä suojaa hermo- ja aivosoluja neurodegeneraatiolta. Vastaavia havaintoja on tehty dementian ja Alzheimerin taudin kohdalla; ketogeeninen ruokavalio on tutkimuksissa liitetty pienempään muistisairauksien riskiin.

Oksidatiivinen stressi ja antioksidantit

Oksidatiivinen stressi tarkoittaa solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Käytännössä hapettavien tekijöiden liiallinen määrä ja antioksidatiivisten järjestelmien vajavainen toiminta välittyy reaktiivisten happi- ja typpiradikaalien kautta, mikä ylläpitää elimistön inflammaatiota.

Verensokeri vaikuttaa oksidatiiviseen stressiin ja inflammaatioon sitä enemmän, mitä korkeammalle verensokeri nousee ja mitä suuremmasta syödystä hiilihydraattimäärästä on kyse. Suuren glykeemisen kuorman sisältävät ruoka-annokset nostavat verensokeria rajusti. Oksidatiivisen stressin aiheuttamia tulehdusta lisääviä vaikutuksia voi vähentää tulehdusta jarruttavilla tekijöillä: polyfenoleilla, C-vitamiinilla, kanelilla ja etikalla, kuiduilla ja rasvalla.

Miten se toimii?

Reaktiivinen happiradikaali sisältää parittoman elektronin ja on siksi hyvin reaktiivinen. Energiataloudellisesti parittomat elektronit ovat epäedullisia ja siksi yhdiste pyrkii parilliseen elektronimäärään reagoimalla läheisyydessä olevien muiden yhdisteiden kanssa. Happiradikaali vaurioittaa kohtaamiaan molekyylejä. Tämä voi ilmetä eri tavoin:

Lipidiperoksidaatiossa rasvat härskiintyvät. Oksidatiivisessa stressissä rasvat hapettuvat happiradikaalien liiallisen määrän vuoksi ja seurauksena voi olla esimerkiksi rasvakalvojen virheellinen toiminta, joka vaikuttaa hormonien ja muiden viestiaineiden aikaansaamien signaalien välittymisessä solukalvon kautta soluun.
– Proteiinien vauriot. Proteiinit toimivat entsyymikatalyytteina, jotka mahdollistavat elintoiminnoille välttämättömät kemialliset reaktiot. Jotkin proteiinit toimivat reseptoreina, jotka vastaanottavat soluun tulevia kemiallisia viestejä. Happiradikaalien vaikutukset proteiineihin voivat aiheuttaa monenlaisia elintoimintojen häiriöitä.
– Myös DNA voi vaurioitua hapettumisen seurauksena. Tämä aiheuttaa geneettisiä vaurioita eli mutaatioita DNA:n emäsjärjestyksissä. Tällaiset muutokset voivat muuttaa ko. aluetta koodinaan käyttävän proteiinin rakennetta ja edelleen pysyvästi solun toimintaa, minkä seurauksena solut saattavat muuttua pahanlaatuisiksi. Se altistaa syövän kehittymiselle.  

Happiradikaaleja syntyy elimistön normaalin toiminnan seurauksena esimerkiksi ruokailun jälkeen ja soluhengityksessä, kun mitokondrioiden elektroninsiirtoketju käyttää happea energiantuotannossa. Happiradikaalien muodostuminen on osa perusaineenvaihduntaa, mutta niiden määrää rajoittaa elimistön omat antioksidatiiviset järjestelmät. Hapetus-pelkistystiloissa tapahtuvat muutokset ovat osa solujen välistä viestintämekanismia (redox signaling). Keho voi hyödyntää happiradikaaleja myös immuunijärjestelmän osana. Luontainen immuniteetti ja siihen liittyvät fagosytoivat solut tuhoavat elimistölle vieraita mikrobeja tuottamalla happiradikaaleja.

Elimistöllä on omia mekanismeja reaktiivisten happiradikaalien määrän rajoittamiseen. Näistä tärkeimpiä ovat happiradikaaleja vaarattomiksi molekyyleiksi muuttavat entsyymit, kuten superoksididismutaasi, katalaasi ja glutationiperoksidaasi.  Ravinnosta saatavat pienimolekyyliset antioksidantit pystyvät myös inaktivoimaan happiradikaaleja. Antioksidantteihin kuuluu eräitä vitamiineja ja flavonoideja. Tutuimpia ovat C- ja E-vitamiinit.

Liiallinen oksidatiivinen stressi voi johtaa solukuolemaan ja kudostuhoon. Inflammaatio on kaikkien kroonisten sairauksien riskitekijä.

Tässä on syytä painottaa sitä, että kovin paljon tutkimustietoa ketogeenisen ruokavalion hyödyistä multippeliskleroosia sairastavien oireiden helpottajana ei ole. Havaitut hyödyt on todennettu lähinnä eläinkokeissa ja pitkäaikaisvaikutuksista ei ole tietoa. Toisaalta tutkimusten tulokset ovat hyvin rohkaisevia.

Huomioitavaa

Ketogeenisen ruokavalion noudattaminen voi aiheuttaa multippeliskleroosia sairastavilla väsymystä (fatiikkia). Omalla kohdallani en sellaista huomannut, mutta multippeliskleroosi vaikuttaa eri ihmisiin eri tavoin, joten varoituksen sana on paikallaan.

Usein vähän hiilihydraatteja sisältävää ruokavaliota noudattavia varoitetaan kuitujen ja välttämättömien ravintoaineiden mahdollisista puutoksista hiilihydraattirajoitteiden seurauksena. Se voi olla yksipuolisella ketogeenisella dieetillä ongelma, mutta myös vähän hiilihydraatteja sisältävällä ruokavaliolla saa kaikki välttämättömät ravintoaineet ja riittävästi kuituja, jos ruokavalio on riittävän monipuolinen.

Mitä pitäisi vältellä

Ketoosi edellyttää hiilihydraattien tuntuvaa rajoittamista päivittäisessä ruokavaliossa ja hiilihydraattien korvaamista rasvalla ja proteiineilla. Välteltäviä ravintoaineita ovat erityisesti sokerit ja tärkkelys, jauhot ja niistä valmistetut ruoat sekä riisi, peruna, maissi ja hedelmät.

Rasvat

Hyväksyttyihin ravintoaineisiin kuuluvat hyvät rasvat ja proteiinit sekä vähän hiilihydraatteja sisältävät kasvikset ja pähkinät. Voi kuuluu monissa virallisissa ravintosuosituksissa vältettäviin epäterveellisiin rasvoihin, mutta minä suhtaudun voihin äärimmäisen myönteisesti. Sen sijaan margariineja en mielelläni syö. Voin terveysvaikutuksista vallitsee kaksi koulukuntaa: klassinen rasvavastainen koulukunta ja uusimpiin tutkimuksiin perustuva modernimpi lähestymistapa. Jokainen tehköön valintansa itse. Yhtä totuutta voin terveysvaikutuksista ei ole olemassa.

  • oliiviöljy
  • voi (tai ei, jos syö mieluummin voimakkaasti raffinoituja margariineja)
  • avokadot
  • pähkinät, mantelit, pistaasit
  • rasvaiset kalat, kuten lohi, sardiinit ja makrilli

Proteiinit

Ketogeeniseen ruokavalioon voi sisältyä sekä eläin- että kasvisperäisiä proteiineja.

  • liha
  • meijerituotteet (juustot yms.)
  • munat
  • pähkinät, maapähkinät ja cashew-pähkinät

Hiilihydraatit

Ketogeenisella ruokavaliolla rajoitetaan erityisesti seuraavien hiilihydraattien saantia:

  • sokerit
  • hedelmämehut, virvoitusjuomat ja makeutetut teet
  • makeiset ja leivonnaiset
  • maitoa, sillä se sisältää maitosokeria eli laktoosia
  • pasta
  • leipä
  • pavut
  • hedelmät
  • murot, puurot yms.
  • tärkkelyspitoiset vihannekset, kuten perunat ja maissi

Esimerkki päivän ruoista ketogeenisella ruokavaliolla

Aamiainen

  • pari paistettua munaa
  • pekonia
  • kahvia

Välipala

  • puolikas avokado, kourallinen pähkinöitä

Lounas

  • viipaloitua kurpitsaa
  • lihapullia ja tomaattikastiketta

Välipala

  • manteleita

Päivällinen

  • paistettua lohta
  • kukkakaalia ja voita
  • pinaattia

Tuo on vain eräs esimerkki päivittäisen ruokavalion sisällöstä. Tulen lisäämään tänne ketonurkkaukseen erilaisia hyviksi koettuja reseptejä sekä muuta aihetta sivuavaa infoa.  

Lopuksi

En voi sietää sanaa ”karppaaminen”. Siinä on jotenkin negatiivinen sointi. Lisäksi se kuulostaa pikemminkin hiilihydraattien syömiseltä kuin niiden rajoittamiselta. Käytän itse ketoilu-sanaa vähän hiilihydraatteja ja runsaasti rasvaa sisältävästä ruokavaliosta.

 Aloitin ketoilun eilen 2.12.2019. Söin päivän aikana kaksi ateriaa. Brunssi-lounaalla naudan jauhelihapihvin, runsaasti paistettua valkosipulilla ja chilillä maustettua kaali-paprika-sekoitusta ja juustoraastetta. Päivällisellä 3 paistettua munaa, kaali-paprikasekoituksen jämät ja paistetun naudan jauhelihapihvin. Pysyin kylläisenä, enkä kaivannut välipaloja tai iltapalaa.

Aloitan tulevien viikkojen aikana kokoamaan Ruokasotaan erityistä Ketonurkkausta, jossa kerron ketoiluun liittyvistä tutkimuksista, omista havainnoistani ja hyvistä resepteistä.

 




Runsas gluteenin saanti varhaislapsuudessa voi selittää keliakiaan sairastumista

CNN raportoi 14.8.2019 päivätyssä uutisessa tutkimuksesta, jonka mukaan varhaislapsuuden runsaasti gluteenia sisältävä ravinto voi selittää gluteeniyliherkkyyteen ja keliakiaan sairastumista.

Mitä gluteeni on

Gluteeni on viljojen sisältämien gliadiini- ja gluteliini-ryhmän varastoproteiineista muodostuva aine, joka antaa viljoille leivonnassa hyödyllisen sitkon. Taikinassa gliadiini ja gluteniini järjestyvät gluteeniksi, eli tiiviiksi, venyväksi ja joustavaksi verkostoksi.

Vehnän sisältämä gluteeni sisältää glysiinejä, seriinejä ja treoniineja. Rukiissa on sekaliineja, ohrassa hordeiineja ja kaurassa aveniineja. Gluteenia on kaikissa yleisimmissä viljatuotteissa, mutta monet keliakiaa sairastavat sietävät kauran aveniinista muodostuvaa gluteenia.

Suomessa noin 6 prosenttia väestöstä sairastuu gluteeniyliherkkyyteen ja 2 prosenttia keliakiaan. Keliakiassa gluteenin prolamiiniosa gliadiini aiheuttaa ohutsuolessa tulehduksen. Tutkimusten mukaan gliadiini kasvattaa suolen läpäisevyyttä  ja soluliitosten väljentymistä suoliston seinämissä.

JAMA:n julkaiseman tutkimuksen mukaan runsaasti gluteenia sisältävä ravinto lapsen ensimmäisten viiden elinvuoden aikana assosioituu kasvaneeseen keliakian, suolistotulehdusten ja ohutsuolen vaurioiden riskiin.

Normaalia suurempi gluteenin saanti kasvatti lapsen riskiä sairastua keliakiaan 6,1 %. Gramman lisäys päivittäiseen gluteenin saantiin kasvatti sairastumisen riskiä edelleen 7,2 %.

Tutkimuksessa arvioitiin yli 6600 vuosien 2004 ja 2010 välillä syntyneen lapsen ravintotottumuksia Yhdysvalloissa, Suomessa, Saksassa ja Ruotsissa. Kaikilla tutkimuksessa mukana olleilla lapsilla oli lapsuustyypin diabetekselle ja keliakialle altistava genotyyppi.

Lasten gluteenin saanti tarkistettiin muutaman kuukauden välein aina viidenteen ikävuoteen asti. Saantia verrattiin saman ikäisten terveiden verrokkilapsien gluteenin saantiin.

Tutkimuksen aikana 1216 lapsella (lähes 20 %) havaittiin gluteenin liittyvä autoimmuniteettireaktio, joka on elimistön ensimmäinen merkki huonosta gluteenin siedosta, kertoi tutkimusta johtanut Carin Andrén Aronsson Lundin yliopistosta. Lisäksi lapsista 450 (n. 7 %) sairastui keliakiaan. Keliakiaan sairastuminen diagnosoitiin useimmiten 2 ja 3 ikävuoden välillä.


Keliakia vaikuttaa miljoonien elämään


Keliakiaa sairastavilla gluteeni vahingoittaa ohutsuolen limakalvon nukkaa. Keliakia edellyttää perinnöllisen alttiuden sairastua, sekä jonkin taudin laukaisevan ympäristötekijän. Tämän tutkimuksen perusteella runsas gluteenin saanti varhaislapsuudessa voi laukaista taudin sellaisilla lapsilla, joilla on perinnöllinen alttius sairastua.

Pienelle osalle keliakiaa sairastavista kehittyy iho-oireita (dermatitis herpetiformis). Suolen keliakiaa sairastavista kaksi kolmasosaa on naisia. Ihokeliakiaa esiintyy yhtäläisesti miehillä ja naisilla.

Keliakia on autoimmuunitauti, jossa elimistön immuunijärjestelmä tuottaa vasta-aineita omia kudoksia vastaan. Keliakiaa sairastavilla on muuta väestöä useammin myös jokin muu autoimmuunitauti. Taudin laukaisee vehnässä, rukiissa ja ohrassa esiintyvä gluteeni, joka perinnöllisesti alttiilla henkilöillä vahingoittaa immunologisen reaktion seurauksena ohutsuolen sisäpintaa verhoavan limakalvon soluja.


Keliakian oireet


Suolistonukan vaurioituminen vaikuttaa ravintoaineiden imeytymiseen. Tämä voi johtaa joidenkin ravintoaineiden puutosoireisiin. Yleisimmät puutosoireet liittyvät raudan ja foolihapon imeytymishäiriöön, mikä voi aiheuttaa anemiaa. Myös ravinnosta saatavan D-vitamiinin imeytyminen voi heikentyä, mikä aiheuttaa kalsiumin imeytymishäiriöitä.

Keliakian tavallisimmat oireet ovat ripuli, löysät ulosteet, ylävatsan turvotus, ilmavaivat, painon lasku ja lapsilla kasvun hidastuminen.

Nykyisin tiedetään, että keliakiaan kuuluu myös oireita, jotka eivät suoraan liity suolistoon. Melkein puolella keliakiaa sairastavista maksaentsyymit ovat koholla. Vakavat maksavauriot ovat kuitenkin harvinaisia. Keliakia aiheuttaa myös hermostoon liittyviä oireita, muistihäiriöitä ja lapsettomuutta.

Ihokeliakiassa esiintyy kutisevia rakkuloita etenkin kyynärpäissä, polvissa ja pakaroissa. Lähes kaikilla ihokeliakiaa sairastavilla on myös suoliston keliakia, mutta usein se on lieväoireinen tai oireeton.

Maailmanlaajuisesti keliakiaa sairastaa arviolta yksi ihminen sadasta. On mahdollista, että jopa kaksi miljoonaa ihmistä sairastaa keliakiaa tietämättään. Celiac Disease Foundation.

Gluteenin osuus keliakiaan tunnetaan, mutta JAMA:n julkaiseman tutkimuksen perusteella myös gluteenin määrällä on sairastumisen kannalta merkitystä.


Gluteeniton ruokavalio kasvattaa suosiotaan


Gluteenittomuus on yhä suositumpaa myös terveiden parissa. Monet välttelevät gluteenia viljojen aiheuttaman turvotuksen tunteen vuoksi.

Gluteenin rajoittaminen voi kuitenkin aiheuttaa vajausta erityisesti täysjyväviljojen sisältämien tärkeiden ravintoaineiden saannissa. Viljojen korvaaminen maissi- tai riisijauhoilla ei ole erityisen terveellistä. Gluteenia sisältävät viljatuotteet sisältävät yleensä runsaasti terveellistä suoliston hyvää mikrobikantaa ravitsevaa sulamatonta kuitua.

Asiantuntijoiden mukaan gluteenista luopuminen ei ole erityisen järkevää, jos ei sairasta gluteeniyliherkkyyttä tai keliakiaa. Aronssonin mukaan geneettisessä riskiryhmässä olevien lasten vanhempien tulisi rajoittaa lastensa gluteenin saantia pienentääkseen sairastumisen riskiä. Mitään tarkkaa ja turvallista saantisuositusta geneettisen sairastumisalttiuden omaaville ei toisaalta ole olemassa.

Tohtori Alessio Fasano (Center for Celiac Research and Treatment, Massachusetts General Hospital) on yksi gluteenin kärjekkäimmistä vastustajista. Hänen hypoteesinsa vuotavan suolen oireyhteydestä kaikkien autoimmuunitautien perimmäisenä syynä on herättänyt paljon polemiikkia, mutta mitään lääketieteellistä konsensusta hypoteesista ei vallitse.

Fasanon mukaan gluteenittomuus on tällä hetkellä Hollywoodin suosituin ruokatrendi, mutta hänkään ei näe järkevänä vältellä gluteenia vain sen vuoksi, että se sattuu olemaan muodikasta. Fasano korostaa, että keliaakikoille gluteenittomuus on rinnastettavissa insuliinin diabeetikoilla; se on ainoa lääketietellinen keino hillitä tautia.

Gluteenittomuuden hyödyistä ei ole tutkittua tietoa muiden kuin keliakiaa tai gluteeniyliherkkyyttä sairastavien kohdalla.


Gluteenittomuuden lyhyt historia

Toisen maailmasodan jälkeen Eurooppa oli raunioina ja lapset kärsivät aliravitsemuksesta. Viljasta, hedelmistä ja vihanneksista oli suuri puute. Aliravitsemuus johti kuitenkin yllättävään havaintoon: terveet lapset heikkenivät, mutta keliakiaa sairastavat vahvistuivat.

Keliakia oli tunnettu jo pitkään ja sitä pidettiin erityisesti lastentautina. Hollantilainen lastenlääkäri Dr. Willem-Karel Dicke havaitsi, että sota-aikana keliakiaa sairastavien lasten oireet helpottivat. Ennen sotaa lasten kuolleisuus keliakiaan oli 30 prosentin luokkaa. Vuonna 1941 Dicke julkaisi tutkimuspaperin vehnättömään ruokavalioon liittyvistä havainnoistaan (PDF).

”There’s nothing specifically bad about gluten or specifically good about a gluten-free diet, outside of for these specific — not uncommon but relatively small — populations of people with celiac disease, which is about 1% of people in the general population,” –  Dr. Daniel Leffler (Celiac Center at Beth Israel Deaconess Medical Center, Boston).

Miksi gluteeni aiheuttaa oireita keliakiaa sairastaville? Aluksi ajateltiin, että kyse on ruoka-allergiasta.

1970-luvulla geenit paljastuvat

Lefflerin mukaan tutkijat oivalsivat 1970-luvulla, että keliakia ei ole allergia, vaan autoimmuunitauti. Taudin patogeneesi paljastui vähitellen 1970-luvun puoliväliin mennessä.

Tutkimukset johtivat havaintoon, että keliakia assosioituu immuunivasteeseen osallistuvaan geeniin HLA-DQ2. Myös HLA-DQ8-geeni vaikuttaa keliakiassa.

”This was sort of a surprise, because HLA-DQ2 was already known to be linked to type 1 diabetes, which is another classic autoimmune disease, but not to any of the allergic diseases. So the genetics that people with celiac disease have is much more similar to autoimmune diseases.” – Leffler

1980-luku: Keliakiasta riippumaton gluteeniyliherkkyys

Keliakiasta riippumaton gluteeniyliherkkyys nousi framille 1980, kun Gastroenterology julkaisi tutkimuspaperin kahdeksan naisen keliakiaa muistuttavista oireista (vatsakipu, krooninen ripuli), jotka katosivat gluteenittomalla ruokavaliolla. Tutkimuspaperin kuvaamien naisten ohutsuolinäytteet eivät osoittaneet merkkejä keliakiasta. Nykyisin keliakia voidaan diagnosoida perhehistorian, verikokeiden, iho- ja geeninäytteiden ja ohutsuolinäytteen avulla.

Gluteeniyliherkkyys tunnetaan yhä huonosti. Nykyisin ajatellaan, että keliakiasta riippumaton gluteeniyliherkkyys aiheuttaa keliakiaan viittaavia suolisto-oireita ilman, että immuunijärjestelmä vahingoittaa suolistonukkaa.

Oireet ovat todellisia ja potilaiden olo helpottaa gluteenittomalla ruokavaliolla, mutta syytä ei vielä ymmärretä. Onkin hyvin mahdollista, että gluteeni ei aiheuta gluteeniyliherkkyyden oireita, vaan jotkin muut viljojen sisältämät proteiinit, kuten vehnän ATI-proteiinit.




Ruokavaliot: MIND

Tieto erilaisten ravintoaineiden vaikutuksista terveyteen vahvistuu jatkuvasti. Tämä synnyttää monenlaisia ravitsemuksellisia oppisuuntia. Tavoite on kaikissa ruokavalioissa sinänsä sama: hyvä terveys. Kognitiivista terveyttä edistävä MIND on eräs tuoreimmista ruokavaliotrendeistä.

Useimmat ruokavaliot sisältävät hyviä ja ravitsemuksellisesti arvokkaita osia. Joidenkin ruokavalioiden selkein päämäärä on laihtuminen ja painonhallinnan ylläpitäminen. Ruokavaliot, kuten ketogeeninen dieetti tai Atkinsin dieetti nojaavat aineenvaihdunnan mekanismeihin, jotka pakottavat aineenvaihdunnan turvautumaan kehon varastorasvoihin energianlähteinä. DASH painottaa sydän- ja verisuoniterveyttä. Vegaaninen ruokavalio voi olla eettinen tai terveydellinen valinta. MIND perustuu kognitiivista terveyttä ylläpitävien ravintoaineiden syömiseen.

Se, mitä suuhunsa laittaa, ei koskaan ole täysin samantekevää. Kaikilla ravintoaineilla on useita tehtäviä elimistössä, mutta minkään yksittäisen ruoka-aineen korostaminen ei liene pitkällä tähtäimellä erityisen terveellistä. Olennaisinta tervellisessä ja tasapainoisessa ruokavaliossa on välttämättömien ravintoaineiden saanti.

MIND (Mediterranean-DASH Intervention for Neurodegenerative Delay)

MIND-ruokavalio on Välimeren ruokavalion ja DASH-ruokavalion sekoitus. Ruokavalio perustuu havaintoihin, että tietyt ravintoaineet parantavat aivojen hyvinvointia ja pienentävät ikääntymiseen liittyvien muistisairauksien, kuten Alzheimerin taudin riskiä.

MIND-ruokavalion mukainen ruoka kootaan ensisijaisesti täysjyväviljoista, marjoista, vihreistä lehtivihanneksista, vihanneksista, oliiviöljystä, kalasta ja siipikarjan lihasta.

Tutkimusnäyttö MIND-ruokavalion terveyshyödyistä on varsin niukkaa, mutta eräiden epidemiologisten tutkimusten mukaan ruokavalio laskee Alzheimerin taudin riskiä.

Huomionarvoista on, että MIND-ruokavalion hyödyt tutkimuksissa vertautuvat erityisesti perinteiseen amerikkalaiseen arkiruokaan, joka ei välttämättä sisällä juurikaan hyviä rasvoja, kasviksia, marjoja, hedelmiä ja kokojyväviljoja.

MIND-ruokavalion kehittäminen alkoi 2015, kun tutkijat selvittivät ravinnon ja aivojen terveyden välistä yhteyttä. Tavoitteena oli kehittää ruokavalio, joka suojaa ikääntymisen aiheuttamilta muistisairauksilta.

Sydän- ja verisuoniterveyttä edistävä DASH (Dietary Approaches to Stop Hypertension) on monissa ruokavalioita vertailevissa tutkimuksissa arvioitu terveellisimmäksi ruokavalioksi. Myös Välimeren ruokavalio ylläpitää terveyttä. MIND yhdistää hyviksi todettuja malleja DASH- ja Välimeren ruokavalioista.

DASH kehitettiin NHLBI:n (National Heart, Lung and Blood Institute) rahoittamien kliinisten tutkimusten rohkaisemana. MIND eroaa Välimeren ruokavaliosta ja DASH-ruokavaliosta:

  • marjojen merkitystä korostetaan hedelmiin nähden marjojen antioksidanttipitoisuuden vuoksi
  • kalaa suositellaan vähintään kerran viikossa
  • MIND korostaa vihreiden lehtivihannesten ja vihannesten tärkeyttä terveydelle

MIND-ruokavalion fokus on kymmenessä suositeltavassa ravintoaineessa ja viidessä ravintoaineessa, joita tulisi välttää.

Suositeltavia ovat:

  • Vihreät lehtivihannekset
  • Kaikki vihannekset
  • Marjat
  • Pähkinät
  • Oliiviöljy
  • Täysjyväviljat
  • Kala
  • Pavut ja palkokasvit
  • Siipikarjan liha
  • Viini (mutta vain lasillinen päivässä)

Vältettäviä ravintoaineita ovat:

  • Voi ja margariini
  • Juusto
  • Punainen liha
  • Paistettu ja uppopaistettu ruoka
  • Makeiset

MIND ja terveys

Välimeren ruokavaliota ja DASH-ruokavaliota on tutkittu paljon. Tutkimusaineiston tulokset ovat varsin koherentteja ja vahvoja. Kumpikin ruokavalio assosioituu tutkimuksissa matalampaan verenpaineeseen, pienempään sydän- ja verisuonitautien riskiin ja pienempään tyypin 2 diabeteksen riskiin.

Toistaiseksi MIND-ruokavaliosta ei ole laajoja epidemiologisia tutkimuksia, mutta kourallinen tehtyjä tutkimuksia viittaisi MIND-ruokavalion hidastavan kognitiivisten sairauksien kehittymistä ja etenemistä sekä pienentävän Alzheimerin taudin riskiä.

Tärkeä huomio MIND-ruokavaliossa on se, että se sisältää paljon antioksidantteja, jotka vähentävät oksidatiivista stressiä. Oksidatiivinen stressi tarkoittaa soluja vaurioittavien vapaiden happiradikaalien ja niitä torjuvien antioksidanttien epätasapainoa elimistössä. Ruokavalion myös uskotaan ylläpitävän sydän- ja verisuoniterveyttä ja vähentävän aikuistyypin diabeteksen riskiä.

MIND laskee Alzheimerin taudin riskiä

Alzheimer’s & Dementia: The Journal of the Alzheimer’s Association-lehdessä julkaistun tutkimuksen mukaan MIND-ruokavalio laskee Alzheimerin taudin riskiä jopa 35 %. Ruokavalion on kehittänyt Rush yliopistossa työskentelevä ravitsemustiteeseen erikoistunut epidmologi Martha Clare Morris kollegoineen.

MIND-ruokavalion vaikutuksia tarkastelevassa tutkimuksessa seurattiin 923 Chicagossa asuvan 58-98-vuotiaan ravitsemustottumuksia osana laajempaa seurantaa (Rush Memory and Aging Project), jonka tavoitteena on tunnistaa muistisairauksiin vaikuttavia tekijöitä. Informaatiota kerättiin osallistujilta kyselytutkimuksina vuosien 2004 ja 2013 välisenä aikana. Ruokatottumukset pisteytettiin sen mukaan, kuinka läheisesti ne muistuttivat MIND-, DASH- tai Välimeren ruokavaliota. Tutkimuksessa seurattiin,  miten erilaisia ruokavalioita noudattavien henkilöiden ravintotottumukset korreloivat Alzheimerin taudin kanssa.

Tutkijat havaitsivat, että ruokatottumukset, jotka olivat lähimpänä MIND-, DASH- ja Välimeren ruokavaliota korreloivat pienimpään Azlheimerin taudin sairastumisriskiin. Välimeren ruokavaliota lähimmin muistuttavat ravintottottumukset laskivat Alzheimerin taudin riskiä 54 %, lähimmin MIND-ruokavaliota muistuttavat ravintotottumukset laskivat Alzheimerin taudin riskiä 53 % ja lähimmin DASH-ruokavaliota noudattavien tottumukset laskivat Alzheimerin taudin riskiä 39 % suhteessa niihin seurannassa oleviin henkilöihin, joiden ravitsemustottumukset erosivat eniten näistä.

Kognitiivista terveyttä edistävät tekijät lienevät MIND-ruokavalion sisältämissä ravintoaineissa, vitamiineissa, mineraaleissa, hyvissä rasvoissa ja fytokemikaaleissa sekä erityisesti folaateissa ja antioksidanteissa.

Ratkaisevaa oli havainto, jonka mukaan toisinaan DASH- tai Välimeren ruokavaliota noudattavien Alzheimerin taudin riski ei laskenut muihin nähden, mutta MIND-ruokavaliota muistuttavaa ruokavaliota satunnaisestikin noudattavien Alzheimerin taudin riski laski 35 %.




Muistio: Gameettien tanssista solubiologian alkeisiin ja aineenvaihdunnan ihmeisiin

Elämä on jatkuvaa muutosta sukupolvien ja lajien evoluutiosta yksilön monimutkaiseen aineenvaihduntaan. Joka päivä osa soluistamme uusiutuu ja osa soluistamme kuolee. Telomeerit lyhenevät solujen uusiutuessa ja leikkaavat solujen biologista aikaa.

Aineenvaihdunta ylläpitää elämää ja muutosta muuttamalla syömämme ravinnon elimistön rakennusaineiksi ja solujen energiaksi tai varastoimalla ravinteita myöhempää käyttöä varten.

Solu on kaikkien elävien organismien sähköisesti varautunut perusyksikkö. Ihmisillä ja muilla suvullisesti lisääntyvillä otuksilla solut voidaan jakaa somaattisiin soluihin ja ituradan sukusoluihin eli gameetteihin. Yleensä solut ovat mikroskooppisen pieniä (0,01-0,1 mm), mutta eräät hermosolut voivat olla yli metrin mittaisia. Suurimpia soluja ovat munasolut, hermosolut ja lihassolut. Pienimpiä soluja ovat siittiösolut ja veren punasolut. Ihosolun koko on vain 11-12 µm.

Useimmat solut elävät kuukausia tai vuosia, mutta suolen sisäpinnan solut ja eräät valkosolut kuolevat jo muutamassa päivässä. Hermo- ja lihassolut ovat yleensä pitkäikäisiä. Aivosolut saattavat elää yli sata vuotiaiksi tai kuolla perjantain ja sunnuntain välillä riippuen nautitun tuliliemen määrästä ja laadusta.

Ihmisen kudoksesta yli 96 % muodostuu neljästä alkuaineesta. Vedyn, hiilen, typen ja hapen lisäksi kudoksissa on pieniä pitoisuuksia natriumia, magnesiumia, fosforia, rikkiä, klooria, kaliumia ja kalsiumia. Solut ovat 60–90 prosenttisesti vettä. Solujen tärkeimpiä orgaanisia yhdisteitä ovat hiilihydraatit, lipidit, proteiinit sekä nukleiinihapot (DNA ja RNA).


Elämän alku X+Y


Elämä alkaa seksuaalisen valinnan seurauksena naistentansseissa, työpaikan taukotilassa tai jossakin kiireellisesti valitussa epämukavassa paikassa intohimoisen, mutta surkuhupaisan gameettien tanssin seurauksena. Sattumalla on julma huumorintaju. Haikara vie nyytin usein aivan väärään osoitteeseen ja nyyttiä odottavat jäävät liian usein ilman.

Gameettien tanssi

Gameetit eli sukusolut ovat suvullisesti lisääntyvien eliöiden suvunjatkamiseen erikoistuneita soluja, jotka kehittyvät sukurauhasissa ituradan soluista meioottisen solunjakautumisen seurauksena.

Iturata on lisääntymissoluja (munasoluja tai siittiöitä) tuottava solulinja. Gameettien tanssissa siittiöt uivat kilpaa emättimessä ja voittaja voi soidinmenojen jälkeen päästä kurkistamaan munasoluun. Yleensä tämä johtaa munasolun hedelmöittymiseen.

Kauniimman sukupuolen ituradan solut kehittyvät oogeneesin ja meioosin kautta haploidin kromosomin sisältäviksi munasoluiksi. Oogeneesissä munasoluun varastoituu kaikenlaista vararavintoa ja muuta sälää alkion kehityksen turvaamiseksi. Neljästä oogeneesin tuottamasta haploidista tumasta vain yksi kehittyy munasolun tumaksi ja kolme tumaa surkastuu. Miehillä ituradan solut kehittyvät meioosin ja spermatogeneesin kautta haploidin kromosomin sisältäviksi siittiöiksi.

n + n => 2n

Miehen ja naisen välisen seksuaalisen kanssakäymisen seurauksena, olettaen, että ehkäisyä ei ole käytetty ja seksissä on noudatettu perinteisesti hyväksi koettuja tapoja, miehen siittiö etenee emättimessä ja sen haploidi tuma hedelmöittää haploidin munasolun. Näin syntyy diploidi tsygootti, josta uusi yksilö alkaa kehittyä.

Hedelmöittyminen tapahtuu munanjohtimen yläpäässä sijaitsevassa ampullassa. Siemensyöksyssä emättimeen vapautuu jopa satoja miljoonia siittiöitä, mutta niistä vain muutama uiskentelee aina ampullaan asti. Ampullassa ne voivat säilyä hedelmöittämiskykyisinä yhdestä kolmeen päivään. Vilkkaiden siimahäntäisten seikkailu jatkuu emättimestä kohtuun ja sieltä munanjohtimiin. Hedelmöitys on mahdollinen, jos siittiöt löytävät munasarjasta irronneen munasolun.


Zona pellucida

Gameettien tanssiin kuuluu, että siittiö ei hedelmöitä munasolua heti, vaan sen täytyy ensin läpikäydä kapasitaatio, jossa siittiön solukalvosta poistuu glykoproteiinivaippa ja sytoplasman proteiineja. Kun siittiö on näin vähentänyt ylimääräisiä vaatteitaan, se voi edetä korona radiatan läpi ja kiinnittyä zona pellucidaan.

Zona pellucidaan kiinnittynyt siittiö voi käynnistää akrosomireaktion, jossa siittiön akrosomista vapautuu zona pellucidan läpäisemisen edellyttämiä entsyymejä, kuten akrosiiniä ja trypsiinin kaltaisia aineita.

Munasolun hedelmöittymiselle tärkeä zona pellucida on munasolun solukalvoa ympäröivä glykoproteiinikerros. Se näyttää erottavan munasolun ja ja zona pellucidan ulkopuoliset follikulaarisolut toisistaan, mutta nämä ovat itse asiassa kiinnittyneet munasoluun zona pellucidan läpi kulkevilla ulokkeilla. Munasolun hedelmöittyessä siittiöt kiinnittyvät ensin zona pellucidan ulkopinnan glykoproteiiniin (ZP3), mikä johtaa siittiössä tapahtuvaan akrosomireaktioon ja auttaa siittiön zona pellucidan läpi.


Munasolu, jota ympäröi zona pellucida (valkoinen rengas), ja sen ulkopuolella follikulaarisoluista muodostuva korona radiata Kuvan lähde: Wikipedia

Siittiö kurkistaa zona pellucidan läpi, jolloin sen solukalvo pääsee vihdoin kosketuksiin munasolun solukalvon kanssa. Solukalvojen yhdistyminen alkaa munasolun tuottamien integriinien ja niiden ligandien, siittiön tuottamien disintegriinien vaikutuksesta.
Totta munasolussa

Kun siittiö on vihdoin uinut munasolun sisälle, tapahtuu munasolun toiminnassa kolme muutosta:

– Munasolun solukalvo muuttuu niin, että se ei enää sido siittiöitä, eikä päästä siittiöitä lävitseen. Tämä ehkäisee polyspermiaa, eli usean siittiön pääsyä munasoluun.
– Munasolu aloittaa meioottisen jakautumisen välittömästi siittiön päästyä munasolun sisään.
– Munasolun aineevaihdunta kiihtyy siittiön tuoman aktivaattorin käynnistämänä.

Munasolussa hämmentynyt siittiö räpiköi kohti munasolun pronukleusta. Siittiön pronukleus kasvaa ja sen häntä irtoaa. Siittiön ja munasolun pronukleuksien kasvaminen aiheuttaa molemmissa DNA:n replikaation. Tämän jälkeen ne sulautuvat yhteen ja muodostavat hedelmöityneen munasolun, eli tsygootin. Kahdesta 23 kromosomia sisältävästä haploidista kromosomista syntyy 23 kromosomiparin diploidi kromosomisto (n + n => 2n). We have a winner!

 


Solut ja mikrobit tarvitsevat ravintoa


Ihminen tarvitsee ravintoa ruokkiakseen elimistön noin 37 biljoonan solun tarpeita. Ihmisen aineenvaihduntaan osallistuvat myös suolistossa elävät  arviolta100 biljoonaa mikrobia, jotka vaikuttavat ihmisen fysiologiaan, immuunipuolustuksen kehittymiseen, kolonisaatioresistenssiin ja ravitsemukseen tuottamalla sulamattomien kuitujen, resistentin tärkkelyksen ja proteiinijäänteiden aineenvaihduntatuotteina muiden muassa foolihappoa, biotiinia, K-vitamiinia sekä eräitä suolen kehittymiseen, elimistön energiatasapainoon ja homeostaasin ylläpitoon vaikuttavia bioaktiivisia yhdisteitä.

Mikrobit tuottavat hajoamattomasta ruokajätteestä mm. vetyä, metaania ja epiteelisolujen ensisijaisia energialähteitä – lyhytketjuisia rasvahappoja. Näistä esimerkiksi voihappo saattaa pienetää kasvainten muodostumisen riskiä.

Limakalvon homeostaasi edellyttää suolistomikrobien ja elimistön jatkuvaa kommunikaatiota immuunipuolustuksen ja epiteelisolujen Tollin kaltaisten reseptoreiden (TLR) välityksellä. Normaalin mikrobiomin solurakenteet ja mikrobien erittämät aineenvaihduntatuotteet vaikuttavat limakalvon immuunipuolustuksen solujen kypsymiseen ja pienentävät suolistotulehdusten riskiä. 

Solut saavat energiaa ja rakennusaineita ravinnosta. Mikrobiomi saa ravintoa sulamattomista kuiduista, resistentistä tärkkelyksestä ja imeytymättä jääneistä proteiineista. Nykytiedon valossa vaikuttaa siltä, että paksusuoleen päätyvät proteiinit ravitsevat suoliston huonoja mikorbeja ja kasvattavat suolistotulehdusten ja kasvainten riskiä.

Ravinnosta elimistö saa mineraaleja ja vitamiineja (suojaravinteita), hiilihydraatteja (sokereita), proteiineja (aminohappoja) ja rasvoja (rasvahappoja). Näiden lisäksi hyvinvoiva elimistö kiittää antioksidanteista, sulamattomasta kuidusta, resistentistä tärkkelyksestä sekä pro- ja prebiooteista. Anabolinen ja katabolinen aineenvaihdunta muokkaavat ravintoaineista erilaisia molekyylejä elimistön erilaisiin tarpeisiin. 


Solun rakenne

Solukalvo erottaa solun ympäristöstä. Sytoplasma eli solulima sijaitsee solukalvon sisällä. Solun aineevaihdunnasta huomattava osa tapahtuu solulimassa, jossa on useita soluelimiä eli organellejä ja tuma. Solun perintötekijät ovat tumassa, joka on eristetty solulimasta tumakalvolla.

Soluelinten kalvot kasvattavat solun kalvopinta-alaa ja rajaavat solun eräänlaisiin osastoihin, joissa tapahtuvat kemialliset reaktiot pysyvät erillään toisistaan. Monet solun reaktioketjut tarvitsevat solun eri osastojen välisen kalvopinnan toteutuakseen.

Solua rajaava solukalvo on lipidikaksoiskalvo. Se muodostuu fosfolipideistä, joissa glyseroliin on liittynyt kaksi rasvahappoa sekä hydrofiilinen (vesihakuinen) fosfaattiryhmä. Rasvahappojen hydrofobiset (vesipakoiset) osat ovat suuntautuneet kalvon keskelle. Rasvahapoilla on pallomainen hydrofiilinen pää ja kaksi raajaa, jotka ovat vesipakoisia eli hydrofobisia.

Solukalvo ympäröi solulimaa ja säätelee aineiden kulkua soluun ja sieltä pois. Rasvaliukoiset aineet voivat diffundoitua eli tihkua solukalvon läpi, mutta hydrofiiliset aineet tarvitsevat soluun päästäkseen solukalvon läpäisevän kuljetusproteiinin, kanavaproteiinin, kantajaproteiinin tai pumppuproteiinin. Solukalvossa on useita kalvoproteiineja, kuten reseptoreja ja rakennusproteiineja. Kalvoproteiineihin on kiinnittynyt myös hiilihydraattiosia.

Sytoplasma käsittää solukalvon ja tuman väliin jäävän perusaineen sekä soluelimet (organellit). Solulimassa on myös runsaasti proteiineja ja RNA:ta. Proteiinisynteesi tapahtuu soluliman ribosomeissa.

 Solun natriumkaliumpumput kuljettavat jatkuvasti natriumia solusta ja kaliumia soluun. Tämä edellyttää ATP:n energiaa. Ionipitoisuuserojen seurauksena solulima on negatiivisesti varautunut solunulkopuoliseen matriksiin (extracellular matrix) verrattuna. Sähköinen varaus on edellytys mm. hermosolujen toiminnalle. Varauksen häviäminen johtaa solun kuolemaan.

Tuma

Tuma sijaitsee solulimassa ja sitä ympäröi tumakalvo, joka solukalvon tapaan on rasvahappokaksoiskalvo. Tumakalvo ei ole tiivis, vaan siinä on paljon tumahuokosia, joiden läpi lähetti-RNA (mRNA) ja muut molekyylit pääsevät solulimaan. Geenit sijaitsevat DNA:ssa tuman kromosomeissa.

Mikrotubulukset, mikrofilamentit ja välikokoiset säikeet muodostavat solun tukirangan solulimassa. Mikrotubuluksilla on tärkeä tehtävä solun sisäisessä liikenteessä tuman ja solun reunaosien välillä. Moottoriproteiinit dyneiini ja kinesiini liikkuvat mikrotubuluksia pitkin kuljettaen proteiineja ja muuta solun toiminnan kannalta kiinnostavaa sälää solun muihin osiin.

Mikrofilamentteihin kuuluu esimerkiksi lihassolujen aktiini. Lihassolu supistuu, kun limittäin järjestäytyneet myosiinimolekyylit tarttuvat aktiinimolekyyliin ja vetävät aktiineja lähemmäksi. Vastaavaa aktiinin ja myosiinin vuorovaikutusta tapahtuu jossain määrin muissakin soluissa. Välikokoiset säikeet vaihtelevat solutyypin mukaan. Solun tukirangan osat toimivat solujen välisten liitosten rakenteina.


Mitokondriot


Mitokondrio vastaa soluhengityksestä eli solun energia-aineenvaihdunnasta. Mitokondrioiden määrään soluissa vaikuttaa solun energian tarve. Esimerkiksi lihassoluissa voi olla runsaasti täallaisia ravinnosta energiaa polttavia voimaloita. Punasoluilta mitokondriot puuttuvat kokonaan, joten niiden energiantuotanto tapahtuu glykolyysissä.

Aerobisessa soluhengityksessä mitokondriot polttavat ravintoaineita, glykolyysin glukoosista tuottamia pyruvaatteja hapen avulla sitruunahappokierrossa vedeksi ja hiilidioksidiksi. Reaktioketju tuottaa parikymmentä adenosiinitrifosfaattimolekyyliä. Näin ravintoaineisiin sidottu kemiallinen energia muutetaan ATP:ksi (adenosiinitrifosfaatti), joka on solun tärkein energialähde.

Anaerobinen aineenvaihdunta tuottaa energiaa soluille, joissa ei ole mitokondrioita tai happea. Esimerkiksi veren punasoluilta puuttuu mitokondriot. Anaerobinen aineenvaihdunta tapahtuu glykolyysissä, joka pilkkoo glukoosin kahdeksi ATP:ksi ja kahdeksi pyruvaatiksi. Anaerobisen energiantuotannon lopputuotteena on laktaattia eli maitohappoa.

Mitokondrioissa on omaa DNA:ta ja ne periytyvät lähes aina äidiltä. Aiemmin uskottiin, että mitokondriot periytyvät aina äidiltä, mutta sitten löydettiin poikkeustapauksia, joissa mitokondrioiden sisältämä DNA oli periytynyt isältä. Nykyisin on arvioitu, että jopa joka viidennessätuhannessa tapauksessa mitokondriot ja niiden sisältämä DNA saattavat periytyä isältä jälkeläiselle. Tästä esiintyy erilaisia havaintoja ja tulkintoja.  

Mitokondrion rakenne

Rakenteellisesti mitokondriot muodostuvat sileästä ulkokalvosta ja poimuttuneesta sisäkalvosta. Niissä on viisi toiminnoiltaan ja kemiallisilta ominaisuuksiltaan erilaista osastoa: ulkokalvo, sisäkalvo, ulko- ja sisäkalvon välinen tila, sisäkalvon poimut eli kristat ja sisäkalvon sisäpuoli eli matriksi.

Mitokondrion ulkokalvoa peittää vastaava amfipaattisten molekyylien muodostama kalvo kuin solua. Se koostuu lähinnä vastakkain asettuneista fosfolipideistä, joissa glyserolimolekyylin jokaiseen hydroksyyliryhmään on esterisidoksella kiinnittynyt happo. Kalvoon myös kiinnittynyt poriineiksi kutsuttuja proteiineja, jotka päästävät vain tietyn kokoisia molekyylejä lävitseen.

Sisäkalvoproteiinit ovat:
– Soluhengityksen hapetusreaktioihin liittyvät proteiinit
– ATP-syntaasi, joka tekee ATP:ta matriksissa
– Kuljetusproteiineja, jotka säätelevät metaboliittien siirtoa matriksin sisä- ja ulkopuolelle.
– Proteiininkuljetuskoneisto

Kristat eli sisäkalvon poimut laajentavat kalvon kokonaispinta-alaa, jolloin ATP-molekyylien tuotanto tehostuu.

Matriksi sijaitsee sisäkalvon sisäpuolella. Matriksin sisällä on mm. sitruunahappokierron entsyymejä, mitokondrion oma genomi ja sen säätelyyn ja kopioitumiseen vaadittavia proteiineja. Mitokondrion mtDNA on noin 16 600 emäksen mittainen rengasmainen DNA-molekyyli. Koska mitokondrioilla on oma DNA-sekvenssi ja työkalut proteiinisynteesiin, uskotaan, että mitokondriot ovat alun perin olleet itsenäisiä soluja.

Mitokondrio-Eeva

Mitokondrio-Eeva eli Afrikassa noin 200 000 vuotta sitten. Tämä on voitu laskea, koska uniparentaalisessa periytymisessä jälkeläinen saa mtDNA:n äidiltään. Siinä tapahtuu paljon mutaatioita, jotka eivät korjaannu, vaan säilyvät mtDNA:ssa sukupolvelta seuraavalle jne. Mutaatioiden avulla voidaan tutkia äitilinjoja pitkälle menneisyyteen. Yhden emäksen muutos (single nucleotide polymorphism) eli SNP on mutaation merkkitekijä.

Mitokondriot osallistuvat solun jakautumiseen, apoptoosiin (ohjelmoituun solukuolemaan) ja solun sisäiseen signalointiin esimerkiksi varastoimalla positiivisesti varautuneita kalsium-ioneja. Kalsiumin vapauttaminen solulimaan vaikuttaa hermosolujen välittäjäaineiden vapautumiseen.


Energiantuotanto – Soluhengitys


Soluissa energiaa tuotetaan kemiallisesti ja tuotettu energia varastoidaan korkeaenergisiin fosfaatteihin, yleensä ATP:hen. Mitokondriot ovat solujen voimaloita.

Soluhengitys tuottaa sähkövirtaa, jota tarvitaan erityisesti solukalvojen sähkövarausten ylläpitoon. Solun sisäpuoli on negatiivisesti ja ulkopuoli positiivisesti varautunut.

Kemialliset reaktiot voivat kuluttaa tai tuottaa energiaa riippuen reagoivista aineista. Kun ATP:stä irtoaa fosfaattiryhmä, se luovuttaa runsaasti energiaa, jota solu hyödyntää erilaisiin toimintoihin. Energiaa tuottavat ravintoaineet (glukoosi, rasvat ja proteiinit) muokataan kaikille energiaravinteille yhteiseksi välimuodoksi (asetyylikoentsyymi-A, asetyyli-CoA eli aktiivinen etikkahappo), josta mitokondrioiden reaktiosarja tuottaa ATP-molekyylejä.

Asetyylikoentsyymi-A:n hiilien pelkistymistä hiilidioksidiksi ja vetyjen hapettumista vedeksi sitruunahappokierrossa ja oksidatiivista fosforylaatiota kutsutaan yhteisnimellä soluhengitys.

Hiilihydraateista eli sokereista saatava glukoosi on kehon kaikkien solujen tärkein ravintoaine. Hiilihydraatit, kuten tärkkelys, pilkotaan ruoansulatuskanavassa imetyviksi molekyyleiksi, jotka kulkevat erilaisten glut-kuljetusproteiinien kuljettamina ohutsuolen endoteelin läpi verenkiertoon tai maksaan. Veren kohonnut glukoosipitoisuus aktivoi haiman erittämään vereen insuliinia. Insuliini kiinnittyy solujen insuliinireseptoreihin. S aiheuttaa monenlaista säpinää solussa, mutta tärkeintä on, että insuliini houkuttelee solukalvolle solukalvon läpäisvän proteiinikanavan, jota pitkin glukoosimolekyyli pääsee solun sisälle. Fruktoosin aineenvaihdunta tapahtuu käytännössä vain maksassa. Lue tästä.

Glukoosi

Glukoosimolekyyli hajoaa solulimassa tapahtuvassa glykolyysissä kahdeksi pyruvaatti-molekyyliksi. Anaerobisessa glykolyysissa pyruvaatti pelkistyy maitohapoksi. Pyruvaatin pelkistyessä NADH luovuttaa saamansa vedyn pyruvaatille.

Glykolyysissä muodostuu yhtä glukoosimolekyyliä kohden 2 ATP-molekyyliä ja kumpaakin pyruvaattia kohden 6 vety-ionia (protonia). Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit. Syntyneet NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen.

Pyruvaatit hapettuvat asetyylikoentsyymi-A:ksi, joka on kaikille energiaravinteille yhteinen välituote.

Rasvahapot

Rasvahappojen aineenvaihdunnassa tärkeää on beetaoksidaatio, jossa rasvahapot pilkkoutuvat kristojen välisessä tilassa entsyymien vaikutuksesta. Kun veren glukoosipitoisuus laskee, haiman erittämä glukagoni aktivoi rasvahappojen vapauttamisen rasvasoluista verenkiertoon sekä ketogeneesin, glukoneogeneesin ja beetaoksidaation käynnistymisen.

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Ssen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Sitruunahappokierto

Sitruunahappokierto tapahtuu mitokondrion kristojen välisessä tilassa. Reaktisarjassa oksaloasetaatti reagoi asetyylikoentsyymi-A:n kanssa muodostaen sitraattia. Entsyymien avulla molekyyli, jossa nyt on kuusi hiiltä, kiertää syklin, jossa se luovuttaa yhteensä 12 protonia flavoproteiinien (NAD+/NADP+) siirtäminä elektronisiirtoketjuun ja kaksi hiiltä hiilidioksidin muodostamiseen. Lopulta jäljelle jää oksaloasetaatti, joka on jälleen valmis aloittamaan uuden kierroksen uuden asetyyli-CoA molekyylin kanssa.

Oksidatiivinen fosforylaatio

Flavoproteiinien siirtämät vedyt siirtyvät oksidatiivisessa fosforylaatiossa sytokromiketjuun kristojen kalvoille. Sytokromit siirtävät vetyä eteenpäin, hpettuen ja pelkistyen jälleen takaisin, ja muodostaen kristojen ulko- ja sisäkalvon välille protonigradientin. Tämä kuljettaa protoneja matriksiin, jonka ansiosta ATP-syntetaasi entsyymi syntetisoi ATP:tä ADP:stä, ja fosfaatin jämistä.   

Viimeinen sytokromi eli sytokromi c oksidaasi siirtää vedyt molekulaariselle hapelle muodostaen vettä.


Solusykli


Solusykli on kasvuvaiheesta eli interfaasista ja suvuttomasta tuman jakautumisesta eli mitoosista koostuva vaihe, jossa solu jakautuu kahdeksi uudeksi soluksi. Solukiertoa säätelevät sykliinit ja sykliineistä riippuvaiset kinaasit.

Kasvuvaiheen G1-vaihe alkaa jakautumisvaiheen jälkeen. Se on solusyklin pitkäkestoisin vaihe. Siinä solun tilavuus ja sen sisältämien valkuaisaineiden ja RNA:n määrä lisääntyy. G1-vaiheen aikana solun kromosomisto on kaksinkertainen.

Solun on kasvatettava tilavuutta ja sen DNA:n tulee olla ehjää ennen siirtymistä S-vaiheeseen. DNA:n tarkastamisesta ja eheydestä vastaa p53-proteiini. S-vaihe (S=Synthesis) alkaa DNA:n kahdentumisen alusta ja kestää kunnes koko DNA on kahdentunut.

G2-vaihe kestää S-vaiheen lopusta mitoosin alkuun. Sen aikana solu tarkistaa DNA:n eheyden ATM-proteiinin avulla.

Jakautumis- eli M-vaiheena tunnetun mitoosin käynnistää M-vaihetta edistävä ntekijän (MPF, M-phase promoting factor) aktivoituminen. MPF on kaksiosainen molekyyli, joka koostuu Cdc2- ja sykliinivalkuaisaineesta, ja sen aktivoituminen perustuu Cdc2-valkuaisaineen fosforyloinnin säätelyyn. Mitoosi- eli jakautumisvaihe päättyy, kun proteiinin hajotuslaitteet hajottavat sykliinit.

G0-vaiheessa olevat solut ovat irtautuneet solukierrosta.                  

Somaattiset solut

Somaattiset solut ovat soluja, jotka eivät ole ituradan solulinjassa, eli eivät ole sukusoluja tai sukusolun kantasoluja. Somaattiset solut ovat diploidisia, eli niissä on kaksi homologista kopiota kustakin vastinkromosomista.

Somaattiset solut sisältävät yksilön ainutkertaisen perimän 23 kromosomiparin diploidina kromosomistona. Yksilön sukupuolen perusteella diploidi kromosomisto on muotoa XX (nainen) tai XY (mies). Siittiön sisältämä haploidi kromosmi määrää jälkeläisen sukupuolen.

Myös XXY- ja XYY-muotoisia kromosomipoikkeamia esiintyy. Sellaisia syntyy harvakseltaan, mutta ne eivät viittaa supernaiseen tai supermieheen. Kromosomipoikkeamista tutuin on Downin syndrooma, jossa kromosomia 21 on poikkeuksellisesti kolme kappaletta (21-trisomia).

Gameetit

Meioosissa kehittyvät gameetit, eli sukusolut sisältävät rekombinaatiossa satunnaisesti valikoituneen haploidin kromosomin, eli 23 kromosomia.

Tuman- ja solunjakautuminen

Somaattiset solut uusiutuvat mitoosissa, jossa tuma ja sen sisältämä perimä jakautuvat kahdeksi identtiseksi kopioksi. Solunjakautuminen tapahtuu pian tumanjakautumisen eli mitoosin jälkeen. Solunjakautumisessa yhdestä emosolusta syntyy kaksi identtistä tytärsolua.

Jokainen solunjakautuminen tuottaa virheitä DNA-ketjuun ja lyhentää kromosomien päässä sijaitsevia DNA-jaksoja, eli telomeerejä. Telomeerit muodostuvat toistuvista DNA-sekvensseistä. Nisäkkäillä sekvenssi on muotoa TTAGGG, joka on 3000-20 000 emäsparin mittainen.


Mitoosi

Somaattiset solut jakautuvat mitoosissa, jossa solun tuma ja sen sisältämä perimä jakautuvat kahdeksi identtiseksi kopioksi. Mitoosilla voidaan tarkoittaa joko perimän jakautumista tai koko solusyklin M-vaihetta.

Tuma jakautuu ennen kuin solu voi jakautua kahdeksi tytärsoluksi. Jakautuminen kestää yleensä noin tunnin. Mitoosissa solun alkuperäinen kromosomimäärä pysyy samana. Mitoosin vaiheet:

  • Profaasi (esivaihe), jossa kromosomit kondensoituvat näkyviin
  • Prometafaasi, jossa tumakotelo hajoaa ja tumajyvänen katoaa näkyvistä
  • Metafaasi (keskivaihe), jossa kahdentuneet kromosomit asettuvat jakotasoon. Sisarkromatidit (kromosomin puolikkaat) asettuvat usein metafaasikromosomeille tyypilliseen X-kirjaimen muotoon, jossa solmukohtana on sentromeeri. Solulimassa tuman lähettyvillä on kaksi sentriolia (keskusjyvästä), jotka profaasin aikana siirtyvät tuman vastakkaisille navoille. Seuraavaksi mikrotubuluksista muodostuu tumasukkula, jonka sukkularihmoja kiinnitty kunkin kromosomin sentromeeriin.
  • Anafaasi (jälkivaihe), jossa tumasukkulan säikeet lyhenevät ja vetävät kromatidit toisistaan irti sekä ohjaavat syntyneet tytärkromosomit solun vastakkaisille puolille. Näin solunjakautumisen S-vaiheen aikana kahdentuneista kromatideista tulee taas yksinkertaisia.
  • Telofaasi (loppuvaihe), jossa kummankin tytärkromosomiryhmän ympärille rakentuu tumakotelo. Tumasukkula häviää vähitellen ja kromosomit purkautuvat kierteisyydestään löyhäksi vyyhdeksi. Molempiin tumiin ilmaantuu tumajyvänen.

Mitoosia seuraa sytokineesi, eli sytoplasman jakautuminen kahdeksi erilliseksi soluksi. Replikaatiosta vastuussa oleva DNA-polymeraasi sisältää itsetarkastusmekanismin, joka havaitessaan virheen pysäyttää entsyymin etenemisen, kunnes virhe on korjattu. Anafaasi ei käynnisty, jos DNA havaitaan liian vialliseksi. Keskeinen proteiini DNA:n vaurioihin liittyvissä tarkastusketjuissa on proteiini p53, jonka läsnäolo estää mitoosin etenemisen.

Mikrotubulukset liittyvät kromosomeissa sentromeerin päälle rakentuneeseen monimutkaiseen kompleksiin, jota kutsutaan kinetokoriksi. Mikrotubulusten liittyminen kinetokoreihin tarvitsee korjausmekanismeja, jotta tytärsolut saavat oikean määrän kromosomeja. Slu tarkastaa, että kromosomien kinetokorit ovat liittyneet mikrotubuluksiin, ja että niissä on mekaanista jännitettä.

Solu huolehtii myös, että kaikki kromosomit ovat oikein suhteessa tuman ekvaattoriin (jakotasoon). Jos ehdot täyttyvät, mitoosi etenee inhiboivien proteiinien hajottamisella. Esimerkiksi kinetokoreihin liittyvät proteiinit MAD ja BUB hajoavat, kun mikrotubulus liittyy siihen. Jos näitä proteiineja havaitaan, mitoosi ei etene anafaasiin.

Kun MAD:t vapautuvat kinetokoreista, APC-proteiini (anaphase promoting complex) aktivoituu ja merkitsee ubikitiini-yksiköillä tuhottavat sisarkromatideja yhteen liimaavat proteiinit.

Sytokineesi alkaa, kun tumasukkulan mikrotubulukset koskettavat solukalvoa. Tällöin tumasukkula järjestäytyy uudelleen ja mikrofilamenteista koostuva rengas jakaa sytoplasman kahtia.


Meioosi


Sukusolujen tumanjakautumisessa eli meioosissa syntyy neljä haploidia sukusolua toisin kuin mitoosissa, jossa syntyy kaksi diploidia solua. Meioosissa on kaksi perättäistä tumanjakautumista, mutta DNA kahdentuu vain kerran. Meioosin biologinen tarkoitus on ylläpitää

Meioosi sekoittaa geenejä. Geenit voivat uudelleenjärjestyä meioosin aikana monella tavalla, jolloin syntyy monenlaisia sukusoluja. Tämä mahdollistaa sen, että hedelmöityksessä syntyy ainutlaatuisia yksilöitä. Meioosissa haploidi kromosomi voi järjestyä 2^23 (8 388 608) tavalla. Kahden haploidin kromosomin yhdistyessä diploidiksi kromosomistoksi, erilaisia variaatioita on 2^46 (70 368 744 177 664). Näin kahden identtisen yksilön syntyminen käytännössä mahdotonta, paitsi samamunaisissa kaksosissa tai kolmosissa, jossa jokainen jälkeläinen perii saman genomin.

Geneettinen variaatio on tärkeää evoluution ja luonnonvalinnan kannalta. Meioosin tuottamat haploidit sukusolut synnyttävät diploidin perimän siittiön hedelmöittäessä munasolun.

Ensimmäinen jakautuminen tunnetaan nimellä vähennysjakautuminen (M1) ja toista kutsutaan puoliintumisjakautumiseksi (M2). 

Ennen meioosia solu monistaa tuman sisältämän DNA:n, luo lisää soluelimiä ja kasvaa. Meioosin ensimmäisen jaon profaasissa kahdentuneet vastinkromosomit pariutuvat, minkä jälkeen ne eroavat toisistaan sellaisinaan ja siirtyvät tuman navoille ja sitä kautta uusiin soluihin. Toisessa jaossa kromosomit jakautuvat. Seurauksena sntyy neljä solua, joissa jokaisessa on yksi tytärkromosomi.

Meioosin vaiheet

Ensimmäisen jaon vaiheet ovat:

– Profaasi I
– Metafaasi I
– Anafaasi I
– Telofaasi I

Profaasi I jakaantuu viiteen osaan:

leptoteeni – kromosomit tiivistyvät
tsygoteeni – kromosomit alkavat pariutua
pakyteeni – pariutuminen on valmis
diploteeni – homologiset sisarkromosomit vaihtavat geneettistä materiaalia
diakineesi – sentromeerit muodostuvat

Kiasma-rakenteiden välityksellä tapahtuva DNA-materiaalin vaihto diploteenin aikana on toinen kahdesta tekijästä, jotka aikaansaavat geenivaihtelua meioosissa.

Metafaasi I on tuottaa geenivaihtelua. Yksi kromosomipari voi päätyä kahdella eri tavalla tuman ekvaattorin suhteen. 23 kromosomiparia johtaa 2^23 eri tapaan järjestää kromosomit. Kromosomit erottava mikrotubuluksista muodostuva tumasukkula muodostuu.

Anafaasi I:ssä kromosomit työnnetään erilleen toisistaan, jos saadut kemialliset signaalit sallivat tämän. Anafaasiin ei edetä, jos kaikki kromosomiparit eivät ole orientoituneet oikealla tavalla.

Telofaasi I:ssä solut erotetaan aktiinista koostuvan renkaan supistuessa ja siten erotetaan solulimat toisistaan.

Toinen jako:

Toinen jako on verrattavissa ilman DNA:n kahdentumista tapahtuvaan mitoosiin.

Meioosin epäonnistuminen tuottaa useimmiten poikkeuksellisen määrän kromosomeja. Tunnetuin esimerkki on Downin syndrooma, jossa ihmisellä on 47 kromosomia, joista kromosomia 21 on kolme kappaletta.


DNA



Deoksiribonukleiinihappo eli DNA on noin 3 miljardin emäsparin mittainen kaksoiskierre. Se sisältää ihmisen geneettisen aineksen noin 25 000 geenissä (arvio vaihtelee eri lähteiden mukaan 23 000 ja 30 000 geenin välillä).
Yhdessä solussa on noin kaksi metriä DNA:ta. Kaikkien solujen DNA:sta sidottu nauha yltäisi maasta kuuhun ja takaisin. DNA sijaitsee kromosomeissa solun tumassa. Mitokondriot sisältävät oman rengasmaisen DNA-ketjun, joka periytyy lähes aina äidiltä (mtDNA).

DNA-kierre muodostuu kahdesta josteesta, jotka ovat sitoutuneet toisiinsa typpiemäsosien välisin vetysidoksin. Nämä koostuvat kolmenlaisista yksiköistä:

Pentoosisokeri
   – deoksiriboosi
– Typpiemäkset
   – adeniini (A)
   – guaniini (G)
   – sytosiini (C)
   – tymiini (T)
– Fosforihappo

Nukleotidi syntyy sokerin esteröityessä fosforihappoon. Nukleotidit polymeroituvat esterireaktiolla, jolloin syntyy nukleiinihappoketju. Fosforihappo ja deoksiriboosi vuorottelevat DNA-ketjussa. Jokaiseen deoksiriboosiyksikköön on kytkeytynyt jokin typpiemäksistä.

Typpiemäsparit ovat:
adeniini – tymiini
sytosiini – guaniini

Eli jos toisessa kierteessä on adeniini, on toisessa aina vastaavalla kohdalla tymiini tai päinvastoin. Vastaavasti, jos toisessa kierteessä on sytosiini, on toisessa aina guaniini tai päinvastoin. Tämä emästen järjestys on ratkaisevaa sille, millä tavoin DNA:sta muodostunut geeni vaikuttaa.

”Sekundaarirakenteena on kaksoiskierre, α-helix, jossa emäsparit liittyvät oikeakätisesti yhteen siten että muodostuu A-T ja C-G pareja. Kun toisessa kierteessä on adeniini, on toisessa aina vastaavalla kohdalla tymiini ja päin­vastoin, ja vastaavasti kun toisessa kierteessä on sytosiini, on toisessa aina guaniini ja päin­vastoin. Yhdessä helixin kierteessä on kymmenen emäsparia. Tertiäärirakenne, nk. 30 nm kierre, perustuu DNA:n kietoutumiseen histoniproteiinien ympärille, jolloin DNA on tarpeeksi pienessä tilassa mahtuakseen tumakoteloon. Histonien sijoittelun muuttaminen 30 nm kierteessä mahdollistaa myös transkription säätelyn, koska siten transkription aloituskohdat voidaan tarvittaessa joko paljastaa tai piilottaa. Tertiäärirakenne ehkäisee myös osaltaan DNA:n katkeilua.”– Wikipedia

DNA:n kopioituminen

Solun jakautuessa DNA:n kaksoiskierre avautuu ja DNA:n molemmat säikeet täydennetään täydelliseksi kopioksi. DNA:n kopioituminen on semikonservatiivista, sillä syntyneiden uusien DNA-molekyylien toinen juoste on aina peräisin alkuperäisestä DNA-molekyylistä.  Näin se myös perii puolet vanhaan DNA-rihmaan assosioituneista proteiineista (esimerkiksi histoneista).

DNA on epäsymmetrinen ja entsyymit voivat lukea sitä vain yhteen suuntaan. Tätä nimitetään 5’-3’-suunnaksi. DNA-polymeraasi-δ täydentää toista säiettä 5′-3′ -suuntaan ja DNA-polymeraasi-ε toista säiettä. Polymeraasi-ε kopioi DNA-säiettä 100-200 emäsparin osissa, joita kutsutaan Okazaki-fragmenteiksi. DNA-ligaasi yhdistää Okazaki-fragmentit yhtenäiseksi ketjuksi. Virheenkorjausmekanismien ansiosta vain keskimäärin 2,5 emäsparia sadasta miljoonasta emäsparista kopioituu väärin.

Transkriptio

Geenien nukleotidisarjat sisältävät ohjeen proteiinien valmistukseen. Proteiinisynteesi alkaa tumassa, jossa DNA:n transkriptio tapahtuu.

Transkriptiossa kaksoiskierre avautuu helikaasi-entsyymin avulla ja DNA:sta kopioituu lähetti-RNA (mRNA), joka on geenin peilikuva. Geenien kopiointia mRNA:ksi ohjaavat useat transkriptiofaktorit,

Lähetti-RNA pääse tumakalvon tumahuokosten läpi solulimaan. Ennen proteiinisynteesiä mRNA silmukoidaan. Se tarkoittaa geenin koodaamattomien osien eli intronien poistamista geenin koodaavien osien eli eksonien välistä

Translaatio

Silmukointia seuraa mRNA:n translaatio, jossa mRNA:n nukleotidijärjestys muutetaan proteiinin aminohappojärjestykseksi. Kolme mRNA:n peräkkäistä emäsjaksoa muodostaa kodonin, joka määrää proteiinisynteesissä käytettävät aminohapot. Neljästä emäksestä saadaan 64 erilaista kolmen emäksen yhdistelmää. Aminohappoja on 20, joten jokaista aminohappoa vastaa geneettisessä koodissa useampi kodoni.

Yksi kodoneista on aloituskodoni ja sen lisäksi on kolme erilaista lopetuskodonia. Ne määräävät translaation alku- ja lopetuskohdan. Translaatio tapahtuu joko soluliman vapaissa ribosomeissa, jolloin proteiini jää solulimaan tai kulkeutuu tumaan, tai endoplasmakalvostoon kiinnittyneissä ribosomeissa, jolloin syntyy proteiineja eksosytoitaviksi tai kalvoproteiineiksi.

Translaatiossa ribosomi kiinnittyy mRNA-ketjuun. tRNA (siirtäjä-RNA) sovittaa antikodoniaan (kodonin peilikuva) mRNA:n kodoniin. Jos ne täsmäävät, tRNA jää paikalle ja ribosomi siirtyy seuraavan kodonin kohdalle pidentäen aminohappoketjua, kunnes saavutetaan lopetuskodoni. Proteiinin pitää laskostua ja siihen liitetään endoplasmakalvostossa ja Golgin laitteessa hiilihydraattiosia.

Geeni

Perintötekijät eli geenit ovat biologisen informaation yksiköitä, jotka on tallennettu DNA:n tai RNA:n nukleiinihappoketjuun. Informaatio on tallennettu DNA:n emästen järjestykseen. Pienin informaatioyksikkö on kolmesta peräkkäisestä emäksestä puodostuva kodoni (kolmikko), joka proteiinisynteesissä tulkitaan tietyksi aminohapoksi.

Geenit ovat DNA:ssa sijaitsevia DNA-sekvenssejä. Geenien ja niiden säätelyalueiden lisäksi DNA:ssa on alueita, jotka eivät sisällä informaatiota. Tätä pidettiin aiemmin ”roska-DNA:na”, mutta nykyisin uskotaan, että ns. tyhjät alueet osallistuvat geenien säätelyyn. Geenin toimintaan vaikuttaa koodaavan osan ympärillä olevat DNA:n alueet, joita kutsutaan geenin säätelyalueeksi ja ne sisältävät erilaisia tunnistus- ja kiinnittymiskohtia geenin toimintaa ohjaaville, aktivoiville ja inhiboiville proteiineille. Säätelyalueilla on esimerkiksi vahvistajia ja promoottoreita.

Rekombinaatio

Rekombinaatio on uusien ominaisuusyhdistelmien syntymistä suvullisessa lisääntymisessä vanhemmilta periytyvien ominaisuuksien uudelleen järjestyessä. Rekombinaatiota aiheuttaa meioosin vähennysjakautumisessa tapahtuva vastinkromosomien satunnainen konjugoituminen ja sukusolujen sattumanvarainen yhdistyminen hedelmöityksessä.

Kromosomien välinen rekombinaatio mahdollistaa suuren määrän uusia ominaisuusyhdistelmiä. Perimän uudelleenjärjestäytymistä meioosissa tapahtuu myös kromosomien eri osien välillä tekijäinvaihdunnan eli crossing-overin seurauksena, mikä moninkertaistaa rekombinaation määrän.

Evoluutiossa rekombinaatiolla on keskeinen rooli, sillä se lisää eliöiden sopeutumista erilaisiin ympäristöihin.

Kromosomit

Kromosomi on DNA-rihma, joka on kiertynyt kromatiiniksi histoniproteiinien ympärille. Mitoosin ja meioosin aikana kahdentunut kromosomi kiertyy tiiviisti yleensä X:n muotoiseksi rakenteeksi.

Kromosomit 1-22 ovat autosomeja, jotka eivät vaikuta sukupuoleen. Sukupuolen määräävät X- ja Y-sukupuolikromosomit. Y-kromosomin SRY-geeni saa sikiön kehittymään miespuoliseksi. Suurin osa geneettisestä materiaalista sijaitsee X-kromosomissa. Y-kromosomi sisältää arviolta 59 miljoonaa emäsparia ja 50-60 geeniä. Yhdessä kromosomissa on keskimäärin 150 miljoonaa emäsparia.

Telomeerit

Telomeerit suojaavat kromosomien päitä. DNA:ta replikoiva entsyymi DNA-polymeraasi ei pysty monistamaan kromosomin 5’-päätä, johon jää solunjakautumisen yhteydessä RNA-alukkeen pituinen emäsvajaus.

Ilman telomeereja solujen uusiutuminen johtaisi nopeasti geneettisen tiedon katoamiseen. Telomeerien lyhentyessä ne eivät enää muodosta silmukoita, jolloi kromosomit saattavat yhtyä. Normaalit solut eivät pysty korjaamaan virhetä, mikä voi johtaa ohjattuun solukuolemaan (apoptoosi). Telomeerien lyhenemisen uskotaan vaikuttavan vanhenemiseen ja syöpien kehittymiseen.



Kolme tehokasta niksiä ultratehokkaaseen aineenvaihduntaan

Kuinka saat pyöreän pyllyn ja kiinteämmät rinnat ensi perjantaihin mennessä? Miten poistat vyötäröltä 25 senttiä tekemättä mitään? Aivan oikein. En tiedä.

Jos jaksoit lukea tänne asti, ymmärrät, että lupaukset satumaisen tehokkaista, yllättävän nopeista ja hillittömästi aineenvaihduntaa tehostavista elämäntavan muutoksista ei ollut tämän muistion idea. Halusin vain selvittää kuinka aineenvaihdunta tapahtuu solutasolla ja kuinka elimistö toimii.  

Katabolinen ja anabolinen aineenvaihdunta

Aineenvaihdunta on kaksisuuntainen biologinen prosessi, jossa ravinto pilkotaan ensin ruoansulatuskanavassa imeytyvään muotoon eli ravinnon perusmolekyyleiksi (aminohapot, rasvahapot ja sokerit ja suojaravinteet) erilaisten entsyymien avulla. Solut käyttävät ravinnosta pilkottuja molekyylejä energiantuotantoon tai rakennusaineina.

Näistä ravinnon perusmolekyyleistä glukoosi on elimistön tärkein ja helpoin energianlähde. Helppo se on siksi, että käytännössä kaikki solut osaavat hyödyntää glukoosia energiantuotannossa. Solut osaavat tuottaa energiaa myös rasvasta ja proteiineista, mutta se edellyttää pidempiä aineenvaihduntaketjuja.

Periaatteessa glukoosipitoisuuden kasvu aktivoi haiman erittämään insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin ja näin kutsuvat solunläpäisevät proteiinikanavat solukalvolle. jolloin glukoosimolekyylit pääsevät soluun.

Soluliman glykolyysissa glukoosi pilkotaan pyruvaateiksi, jolloin syntyy runsasenergisia ATP-molekyylejä. Jos solulla on käytettävissään mitokondrioita ja happea, energiantuotanto jatkuu aerobisena soluhengityksenä sitruunahappokierrossa. Soluissa, joissa ei ole happea tai mitokondrioita, pyruvaatit pelkistyvät maitohapoksi. 

Jos veressä on hyvin paljon glukoosia, aineenvaihdunta varastoi osan siitä maksan ja lihasten nopeiksi sokerivarastoiksi – glykogeeneiksi. Glukoosi, joka ei mahdu glykogeenivarastoihin, varastoidaan rasvasoluihin, jossa se muutetaan lipogeneesissä triglyserideiksi. Mitä enemmän ihmisellä on lihaksia, sitä suuremmat glykogeenivarastot ja vastaavasti pidempi rasituskestävyys.

Veren sokeripitoisuuden laskiessa haima erittää vereen glukagonia. Se purkaa maksan ja lihasten nopeita sokerivarastoja solujen energianlähteeksi. Glukagoni aktivoi useita aineenvaihduntareaktioita. Glukagonin vaikutuksesta rasvasoluista vapautuu verenkiertoon rasvahappoja, jotka voidaan muuttaa ketogeneesissä solujen energianlähteiksi kelpaaviksi ketoaineiksi. Samalla käynnistyy glukoneogeneesi, joka tuottaa muista ravinteista glukoosia. Beetaoksidaatiossa rasvahapot pilkotaan kaikkien energiaravinteiden yhteiseksi välituotteeksi: asetyylikoentsyymi-A:ksi.  

Proteiineista, rasvoista ja suojaravinteista elimistö valmistaa suurempia rakenteita, kuten proteiineja, lihassoluja, hormoneja jne. Ravinnosta saatavia aineita muokataan elimistössä siis katabolisesti (pilkkoen pienemmiksi) ja anabolisesti (rakentaen suuremmiksi) molekyyleiksi.   

Elimistön normaali aineenvaihdunta edellyttää, että välttämättömiä ravintoaineita on saatavilla. Näihin sisältyvät proteiineista saatavat 20 aminohappoa, rasvoista saatavat kaksi rasvahappoa (omega-3 ja omega-6), vitamiinit ja mineraalit (sekä ehdollisesti hiilihydraatit eli sokerit).

Sokerit eivät periaatteessa kuulu välttämättömiin ravintoaineisiin, vaikka energiaa tuottava soluhengitys rakastaa glukoosia. Myös solujen uusiutuminen ja DNA:n kopioiminen edellyttää jonkin verran sokereita. Välttämättömistä ravintoaineista elimistö osaa syntetisoida kaikki tarvitsemansa rakenteet – myös solujen tarvitseman glukoosin.

Glukoneogeneesi

Glukoneogeneesi on eräs kehon kehittyneistä aineenvaihdunta- ja selviytymismekanismeista. Se muuttaa mm. maitohappoa, glyserolia, propionaattia, oksaloetikkahappoa sekä muita sitruunahappokierron väliaineita, ketoneita, aminohappoja sekä rasvahappoja glukoosiksi.

Glukoneogeneesi käynnistyy haiman erittämän insuliinin vastahormoni glukagonin aktivoivana ja päättyy insuliinin vaikutuksesta.

Keskimäärin aikuinen tarvitsee ravinnosta 2000-2500 kcal vuorokaudessa.  Kaikki ravinnosta saatava ylimääräinen energia ei varastoidu rasvakudokseen, mutta osa varastoituu. Eri ravintoaineet toimivat hieman eri tavoin aineenvaihdunnassa ja yksilöllisiä eroja aineenvaihdunnan toiminnassa on paljon. Eroihin vaikuttavat mm. yksilön hormonitoiminta.  

Liikunta lisää energiantarvetta ja tehostaa aineenvaihdunnan toimintaa. Kun ihminen syö yli kulutuksensa, osa energiasta varastoidaan rasvasoluihin. Ylimääräiset hiilihydraatit eli sokerit muuttuvat lipogeneesissä elimiin ja keskivartalolle varastoitaviksi triglyserideiksi. Tämä viskeraalinen rasva on terveyden kannalta kaikkein huonointa rasvaa.

Anabolinen aineenvaihdunta käynnistyy ruokailun jälkeen

Anabolinen ja katabolinen aineenvaihdunta vuorottelevat elimistössä päivittäisten rutiinien lisäksi myös iän ja elämäntilanteen mukaan. Fyysinen harjoittelu ja sairaudesta toipuminen kallistavat aineenvaihduntaa anaboliseksi, jolloin aineenvaihdeunta rakentaa lihaskudosta tai korjaa sairauden aiheuttamia vaurioita. Myös kasvavien lasten aineenvaihdunta on anabolinen, mutta vanhemmilla ihmisillä ja hyvin vähän liikkuvilla aineenvaihdunta on yleensä pitkäkestoisessa katabolisessa tilassa.  

Anabolinen aineenvaihdunta käynnistyy yleensä ruokailun jälkeen, kun kehossa on runsaasti ravintoaineita. Siinä ravinnosta saaduista perusmolekyyleistä muodostetaan elimistössä suurempia molekyylejä, kuten lihasten tarvitsemia proteiineja.

Sairastelun, lihomisen ja laihduttamisen yhteydessä aineenvaihdunta ylläpitää elimistön toimintaa. Aineenvaihdunta kasvattaa hedelmöittyneestä alkiosta sikiön ja sikiöstä lapsen, aikuisen ja vanhuksen.

Perusaineenvaihdunta

Perusaineenvaihdunnalla tarkoitetaan välttämättömien elintoimintojen aiheuttamaa energiankulutusta levossa mitattuna n. 10 tunnin paaston jälkeen. Unen aikana perusaineenvaihdunta laskee n. 10 %. Uuvuttavan pitkäkestoisen rasituksen jälkeen perusaineenvaihdunnan taso pysyy suurentuneena useita tunteja. Aikuisten perusaineenvaihdunta on suoraan verrannollinen rasvattomaan kehonpainoon.

Ruokahalun säätely

Ruokahalu on fysiologisten, psykologisten ja sosiaalisten tekijöiden summa. Keskushermosto on myös tärkeä tekijä ravinnon oton säätelyssä. Useat hormonit, välittäjäaineet, ruoat vaikuttavat ruokahaluumme. Rasvakudos tuottaa leptiiniä, joka säätelee kylläisyyttä. Insuliini ja leptiini hillitsevät keskushermostotasolla ruoan ottoa.

Suolistosta vapautuu hormoneja, jotka vaikuttavat keskushermostotasolla ravinnon oton säätelyyn (mm. greliini, kolekystokiini). Liikunta voi lisätä tai vähentää ruokahalua. Lisääntynyt betaendorfiini ja glykogeenivarastojen pieneneminen kiihdyttää ruokahalua.

Rasittavan liikunnan jälkeen suurentuneet adrenaliini- ja serotoniinipitoisuudet sekä kehon kohonnut lämpötila vähentävät ruokahalua. Yleensä energiatasapainon pitkäaikainen säätely ei toimi moitteettomasti, jos kululusta ei ole riittävästi.

Perusaineenvaihdunta ylläpitää elimistön tärkeimpiä elintoimintoja. Näihin kuuluvat keuhkojen ja sydämen, lihasten  sekä muiden elintärkeiden elinten ja aivojen toiminta ja aineenvaihdunta.

Vuorokauden energiankulutuksesta 65-75 prosenttia on perusaineenvaihduntaa. Aivot käyttävät keskimäärin 21 %, lihakset 22 %, maksa 18 %, sydän 12 %, munuaiset 6 % ja muut kudokset 21 % päivittäisestä energiankulutuksesta.  

Aineenvaihduntaa säätelevät monet aktivaattorit kuten kasvutekijät, hormonit, vitamiinit ja hivenaineet.

Tämä muistio on kirjoitettu useita lähteitä hyödyntäen. Osa on listattu alla. Kuvat ovat Pixabay:sta tai Wikipediasta lainassa, jollei lähteeksi mainita jotain muuta.

https://fi.wikipedia.org/wiki/Mitoosi
https://fi.wikipedia.org/wiki/Meioosi
https://fi.wikipedia.org/wiki/Rekombinaatio
https://www.duodecimlehti.fi/lehti/2009/6/duo97943
https://fi.wikipedia.org/wiki/Zona_pellucida
https://fi.wikipedia.org/wiki/DNA
https://fi.wikipedia.org/wiki/Replikaatio
https://fi.wikipedia.org/wiki/Solu
https://fi.wikipedia.org/wiki/Mitokondrio