Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Onnellista alkanutta vuotta kaikille vielä kerran ja viivästyneesti! Oma vointini on jo ihan kakskyt-kakskyt. Ehkä edessämme on paras vuosikymmen ikinä tai sitten kiinalainen korona pelaa meidät pandemiaan. Maailmanlopun kelloa on jälleen siirretty eteenpäin. Enää on vain 100 sekuntia keskiyöhön. Jatkan yksinäistä sokereiden vastaista ketoiluhömppää artikkelissa: Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Mutkaton 6:1-ketoiluni on tuottanut toivottuja tuloksia ja voin hieman paukutella henkseleitäni. Viiden viikon aikana painoni putosi tuskattomasti 5-6 kiloa. Seitsemännellä viikolla paino käväisi ujonoloisesti 85 kilossa, mutta otin sitten menetettyjä kiloja varovasti takaisin erilaisten tekosyiden varjolla. Se onnistui helposti hampurilaisilla ja oluella.

Vointini on pysynyt energisenä, eikä nälkä ole juuri vaivannut. Sehän se ongelma lienee; uskon nälän parantavaan voimaan. Syön ehkä vieläkin liikaa, vaikka luulen, että tehostuneen rasva-aineenvaihdunnan ohella myös päivittäinen kokonaisenergian saantini on ketoillen laskenut.

Oli painon putoamisen syy mikä tahansa, ketogeeninen ruokavalio toimii omalla kohdallani mainiosti. Jännää on, että en kaipaa perunoita, pastaa, leipää ja sokereita enää lainkaan. Ajatus esimerkiksi karkkien tai vaalean leivän syönnistä tuntuu melkeinpä vastenmieliseltä. Tai tuntui, kun kirjoitin nuo sanat. Tänään ahmin karkkia koko alkaneen vuoden edestä. Hyi minua!


Sokerina pohjalla:

Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Anahad O’Connor kirjoitti 12.9.2016 New York Times -lehdessä sokeriteollisuuden toteuttamasta suuresta vedätyksestä 1960-luvulla. En tiedä saiko tämä uutinen ansaitsemaansa näkyvyyttä suomalaisissa uutismedioissa, joten uutisoidaan tämä viiveellä Ruokasodassa.

Sokeriteollisuuden rahoittama härski pseudotutkimus on vaikuttanut ravintotieteisiin ja ravintosuosituksiin jo 50 vuotta ja vaikuttaa yhä. Se on vakava aihe, vaikkakaan ei yllättävä, eikä ehkä uutinenkaan.

Kaikkien aikojen huijaustilastoissa sokeriteollisuuden huijaus yltää neljännelle sijalle. Edelle menee kuuhuijaus, tai se kun amerikkalaiset päättivät lavastaa kuukäynnin, mutta se tuli niin kalliiksi, että he kuvasivat kuuhuijauksen kuussa ja huijasivat vain lavastuksen. Se oli yllättävän ovelaa.

Ei oikeasti! Se on hölmö juttu, mutta kuulostaa hauskalta. Sokeriteollisuuden vedätys jää vain hieman jälkeen öljyteollisuuden huijauksesta ja tupakkateollisuuden katalista toimista. Ne ovat vahvasti todennettuja faktuaalisia tapahtumasarjoja.

Tämän kupletin viheliäinen juoni on se, että sokeriteollisuus maksoi löytyneiden dokumenttien valossa kolmelle Harvardin tutkijalle tutkimuksesta, joissa valkopestiin sokerin ja sydäntautien välinen yhteys. Tämän ei pitäisi yllättää, sillä myös sokereiden ja syöpien yhteydestä haluttiin vaieta. Sen tarinan voit lukea tästä.

Samassa tutkimuksessa epäily sydän- ja verisuonitautien ravitsemuksellisesta syystä vieritettiin tyydyttyneille (koville) eläinrasvoille. Ensimmäiset amerikkalaiset ravitsemussuositukset laadittiin sokeriteollisuudessa kannuksensa ansainneen tohtori Hegstedin suosituksesta rasvavastaisiksi ja sokereita suosiviksi jo 1970-luvulla.

Nämä yhdysvaltalaiset ravitsemussuositukset levisivät ympäri maailman ja lopulta myös Suomeen. Mikä vaikutus huijauksella on ollut lihavuus- ja diabetesepidemioihin? Suoraa kausaalisuhdetta tuskin voidaan osoittaa, mutta korrelaatio on selvä: rasvan rajoittamisen ja sokereiden suosimisen seurauksena aikuistyypin diabetes ja lihavuus kääntyivät selvään kasvuun.

”Se, että sokerin terveyshaittoja vähäteltiin ja rasvojen haittoja liioiteltiin vuosikymmeniä, on suurella todennäköisyydellä vaikuttanut nykyisiin lihavuus- ja diabetesepidemioihin, kertoo Sanjay Basu Stanfordin yliopistosta. Lihavuus ja diabetes yleistyivät vähärasvaisten ja rasvattomien tuotteiden kulutuksen seurauksena.”


Tutkijat salapoliiseina

Tämä tieteellinen huijaus paljastui Kalifornian yliopiston tutkijan esiin kaivamista sokeriteollisuuden dokumenteista. Löydöstä on raportoinut mm. arvostettu lääketieteellinen julkaisu JAMA.

Keskustelu sokerin mahdollista terveyshaitoista vaiennettiin vuosikymmeniksi, kertoo eräs JAMAn julkaiseman raportin tekijöistä, professori Stanton Glantz (Kalifornian yliopisto).

Löydetyt dokumentit todistavat, että Sugar Research Foundation -niminen sokeriteollisuuden järjestö (nykyään Sugar Association), maksoi kolmelle Harvardin tutkijalle nykyrahassa 49 000 dollaria vastaavan summan sokeria, rasvoja ja sydäntauteja käsittelevän tutkimuksen julkaisemisesta 1967.

Sokeriteollisuuden rahoittama tutkimus ohjattiin sokereita suosivaksi

Sugar Research Foundation määritteli tutkijoille ennalta valitun sokerin terveysriskejä vähättelevän tutkimusmateriaalin. Sen lisäksi sokeriteollisuuden johtajat tarkistivat tutkimuksen ennen sen julkaisemista. Sokereiden terveysriskejä vähättelevä ja eläinrasvojen haittoja korostava artikkeli julkaistiin arvovaltaisessa lääketieteellisessä julkaisussa (New England Journal of Medicine).

Sokeriteollisuuden suuresta huijauksesta on vierähtänyt vuosikymmeniä, mutta sama meno jatkuu yhä. Ruokateollisuus rahoittaa ja ohjaa ravitsemusta käsitteleviä tutkimuksia.

2015 New York Times kertoi, että Coca-Cola Company on rahoittanut miljoonilla dollareilla tutkijoita ja tutkimuksia, joissa pyritään kumoamaan sokeria sisältävien juomien ja lihavuuden välinen yhteys. 2016 kesäkuussa AP (Associated Press) kertoi, että makeisvalmistajat rahoittavat tutkimuksia, joiden mukaan makeisia syövät lapset ovat terveempiä ja laihempia kuin lapset, jotka eivät syö makeisia. Tällaisen ei pitäisi hämmästyttää enää tässä totuudenjälkeisessä maailmassa, mutta on se aika härskiä ja järkyttävää toimintaa. Teollisuuden ahneus on ainoa asia, johon enää voi uskoa.

Huijaukseen osallistuneet Harvardin tutkijat ja sokeriteollisuuden johtajat ovat jo kuolleet. Eräs sokeriteollisuudelta rahaa saanut tutkija oli tohtori Mark Hegsted, joka myöhemmin nousi Yhdysvaltojen maatalousministeriön ravitsemusasioiden johtajaksi ja oli laatimassa ensimmäisiä ravitsemussuosituksia 1977. Toinen sokeriteollisuudelta rahaa saanut tutkija oli tohtori Fredrick J. Stare, Harvardin yliopiston ravitsemustieteellisen tiedekunnan johtaja.

Mitäpä sokeri vastasi?

Sugar Association vastasi JAMA:n julkaisemaan raporttiin toteamalla, että vuoden 1967 raportti julkaistiin aikana, jolloin lääketieteellisissä lehdissä ei edellytetty tutkimusten rahoittajien paljastamista. New England Journal of Medicine aloitti tieteellisten raporttien rahoittajien ilmoittamisen vasta vuonna 1984.

Sugar Association myönsi, että avoimuus ja läpinäkyvyys tutkimustoiminnan rahoittajien osalta olisi ollut aiheellista, mutta puolusti julkaistun tutkimuksen tärkeää ja informatiivista roolia tieteellisessä keskustelussa. Sokeriteollisuus painotti vastauksessaan, että vuosikymmenten tutkimukset eivät ole osoittaneet merkittävää korrelaatiota sokerin ja sydäntautien väliltä, toisin kuin American Heart Association ja World Health Organization uskovat.

Tausta

Sota tyydyttyneiden rasvojen ja sokerin terveyshaitoista on jatkunut vuosikymmeniä. Rasvasodan käynnisti Ancel Keysin myöhemmin kyseenalaistetut tutkimukset kovien rasvojen yhteydestä valtimonkovettumatautiin eli ateroskleroosiin. John Yudkin varoitteli sokereiden terveyshaitoista jo 1970-luvulla, mutta hänet leimattiin naurettavaksi pelleksi.

Keskustelu sokereiden ja tyydyttyneiden rasvojen haitoista jatkuu edelleen yhtä aiheellisena kuin 1970-luvulla. Vuosikymmenien ajan ravitsemussuosituksissa on kehotettu välttämään rasvaa ja erityisesti kovia rasvoja. 1970-luvulla alkanut vähärasvaisuutta suosiva buumi johti siihen, että rasvoja korvattiin elintarvikkeissa lisätyillä sokereilla. Monien tutkijoiden ja maallikoiden, kuten allekirjoittaneen, mielestä tämä on tärkein syy aikuistyypin diabeteksen ja ylipainon räjähdysmäiseen kasvuun.

Huijaus toimi – yllättääkö se?

Sokeriteollisuuden kannalta suunnitelma toimi erinomaisesti: huomio sokereiden mahdollisista terveyshaitoista unohdettiin käytännössä kokonaan. Arvostetussa julkaisussa raportoitu tutkimusraportti sai merkittävän näkyvyyden tieteellisessä yhteisössä.

Tohtori Hegsted käytti tutkimusraporttia vakuuttaakseen terveysviranomaiset tyydyttyneiden rasvojen haitoista sydän- ja verisuoniterveydelle. Sokereiden haitoista ei juuri puhuttu muuten kuin tyhjinä kaloreina, jotka saattavat pahimmillaan vahingoittaa hampaita.

Hegstedin raportti toimii yhä yleisimpien ravitsemussuositusten perustana, vaikka Amerikan sydänliitto (AHA) ja Maailman terveysjärjestö (WHO) ovat osoittaneet myös lisätyn sokerin kasvattavan sydän- ja verisuonitautien riskiä. Hölmöksi leimattu Yudkin oli siis oikeassa jo 1970-luvulla.

New Yorkin yliopiston ravitsemuksen, ruokatutkimuksen ja kansanterveyden professori Marion Nestle kirjoitti JAMA:n julkaiseman tutkimusraportin liitteessä, että löydetyt asiakirjat todistavat vakuuttavasti sokeriteollisuuden pyrkimyksestä valkopestä sokereiden rooli sydän- ja verisuonitautien riskitekijänä.

Tohtori Walter Willett, Harvardin TH Chanin kansanterveydenlaitoksen ravitsemusosaston puheenjohtaja, totesi, että akateemiset eturistiriitasäädökset ovat muuttuneet merkittävästi 1960-luvulta lähtien. Hänen mukaansa löydetyt dokumentit ovat tärkeä osoitus siitä, miksi tieteellistä tutkimusta tulisi tukea julkisella rahoituksella sen sijaan, että rahoitus on teollisuuden varassa.

Tohtori Willett lisäsi, että tutkijoilla oli vain rajoitetusti tietoa sokereiden ja rasvojen suhteellisten riskien arvioimiseksi. Tuoreet tutkimukset ovat osoittaneet, että puhdistetut hiilihydraatit ja erityisesti sokeroidut juomat ovat mm. sydän- ja verisuonitautien, lihavuuden ja aikuistyypin diabeteksen riskitekijöitä, mutta myös ravinnosta saatujen rasvojen laatu vaikuttaa sydän- ja verisuonitautien riskiin.

JAMA perusti artikkelinsa tuhansiin sivuihin kirjeenvaihtoa ja muita asiakirjoja, jotka tutkijatohtori Christin E. Kearns löysin Harvardin ja Illinoisin yliopistojen kirjastojen arkistoista. Löydettyjen asiakirjojen mukaan sokeriteollisuuden ylin johtaja John Hickson keskusteli vuonna 1964 muiden sokeriteollisuuden johtajien kanssa suunnitelmasta, jossa yleiseen mielipiteeseen vaikutettaisiin tutkimuksella, tiedotuksella ja lainsäädännöllisin keinoin. Samoja menetelmiä on onnistuneesti soveltanut tupakka- ja öljyteollisuus.

Imperiumin vastaisku

Tutkimukset olivat jo 60-luvulla havainneet merkittävän korrelaation runsaasti sokeria sisältävän ravinnon ja sydänsairauksien väliltä. Samaan aikaan muut tutkijat, kuten Ancel Keys, tutkivat oletusta, jonka mukaan sydänsairauksien riskiä kasvatti ensisijaisesti tyydyttyneet rasvat ja ravinnon sisältämä kolesteroli.

Hicksonin mukaan sokeriteollisuutta huolestuttaviin tutkimuksiin oli vastattava sokeriteollisuuden omalla tutkimuksella, joka kumoaa sokeriin liitetyt negatiiviset terveysväittämät.  Vuonna 1965 Hickson pyysi Harvardin tutkijoita kirjoittamaan raportin, joka kumoaa sokerin terveyshaittoja käsittelevät tutkimukset. Tutkijoille maksettiin 6500 dollaria, joka nykyrahassa vastaa 49 000 dollaria. Hickson valitsi tutkijoille lähdeaineiston ja teki selväksi, että tutkimuksen tulosten pitää suosia sokeria.

Kirjeenvaihdon perusteella Harvardissa työskennellyt tohtori Hegsted vastasi sokeriteollisuuden johtajille: ”Ymmärrämme ongelman ja teemme parhaamme sen korjaamiseksi”. Tutkijat esittelivät tutkimusluonnoksen Hicksonille, joka kertoi olevansa siihen erittäin tyytyväinen. Harvardin tutkijat sivuuttivat tutkimuksessa sokerin terveyshaittoihin viittaavat tiedot ja painottivat tyydyttyneiden rasvojen ja valtimonkovettumataudin välistä yhteyttä.

Tutkimuksen julkaisemisen jälkeen keskustelu sokerin ja sydäntautien välillä vaiettiin kuoliaaksi. Samalla monet terveysviranomaiset hyväksyivät ”terveelliset” vähärasvaisuutta korostavat ruokavaliot.

Nonni. Tämä nyt on tätä. Jos se ei ole totta, niin ainakin se on hyvä tarina!

https://www.nytimes.com/2016/09/13/well/eat/how-the-sugar-industry-shifted-blame-to-fat.html

https://academic.oup.com/ajcn/advance-article/doi/10.1093/ajcn/nqz276/5680464?guestAccessKey=e676e010-0638-423b-a731-6c760b460bd4

https://www.stmichaelshospital.com/media/detail.php?source=hospital_news/2019/1230

https://jamanetwork.com/journals/jamainternalmedicine/article-abstract/2548255




Ketoherkut: Kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatti

Juu. Tiedetään. Ketoilu on hidas itsemurha. Ketoilijan päivän salaattina esittelen ihanan ja täydellisen kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatin. Bon Appetit!

Raaka-aineet:

Kylmäsavugraavilohi (n. 100 g jäi joulusta)
Tonnikala öljyssä (purkki)
Aurinkokuivatut tomaatit (kourallinen siivutettuina)
Marinoituja latva-artisokkia (kourallinen siivutettuina)
Kalamata-oliiveja (kourallinen puolikkaina)
Fetaa (n. 100 g kuutioituna)
Cosmopolitan-salaattia (aika paljon ja maun mukaan)
Eri värisiä kirsikkatomaatteja (n. 200 g puolikkaina)
Paprikaa (ohuina suikaleina yksi riittänee)
Kesäkurpitsaa (noin 15 cm pätkä)
Sipuli (pieneksi hienonnettuna)
Puolikkaan sitruunan mehu
Kreikkalainen jogurtti (pari runsasta ruokalusikallista)

Oma currymajoneesi

1 muna
2,5 dl öljyä
1 tl suolaa, mustapippuria ja valkosipulijauhetta
2-4 tl curryjauhetta
Korkillinen roseviinietikkaa tai etikkaa
1-2 rkl kreikkalaista jogurttia

Leikkasin raaka-aineet sopivan kokoisiksi siivuiksi isoon kulhoon. Puristin päälle puolikkaan sitruunan mehun ja lisäsin pari reilua ruokalusikallista kreikkalaista jogurttia. Majoneesin olin tehnyt aiemmin.

Helpoin tapa tehdä mahtavaa majoneesia on lisätä 2,5 dl rypsiöljyä ja 1 muna korkeaan ja kapeaan astiaan. Päälle lisätään korkillinen roseviinietikkaa tai etikkaa sekä muut mausteet. Annetaan seisoa lämpimässä 10-20 minuuttia. Asetetaan sauvasekoitin kapean astian pohjaan, käynnistetään ja nostetaan sauvasekoitinta hitaasti noin 10 sekunnin aikana ylöspäin. Jos käy niin ikävästi, että majoneesi juoksettuu, sen voi korjata lisäämällä yhden munan öljyyn ja sauvasekoittamalla uudestaan. Kun majoneesi valmistuu, siihen voi lisätä 1-2 rkl kreikkalaista jogurttia, joka tekee siitä hieman pehmeämmän.

Kruunasin salaatin currymajoneesilla ja sekoitin. Annoin salaatin makuuntua jääkaapissa tunnin verran. Tämä oli paras salaatti ikinä. Onnellista alkavaa vuotta kaikille!




Salaperäiset sirtuiinit

Salaperäiset sirtuiinit tehostavat solujen aineenvaihduntaa, hidastavat ikääntymistä, säätelevät geenien aktiivisuutta ja suojaavat aivoja. Mutta mitä sirtuiinit ovat ja miten ne vaikuttavat aineenvaihduntaan?

”Jo 1930-luvulta asti on tiedetty, että energiarajoitus pidentää jyrsijöiden elinikää. Nimenomaan energiamäärä (noin 60-70 % normaalista) eikä energian lähde näyttää tässä suhteessa olevan ratkaiseva tekijä. Energiamäärän vähentäminen saa aikaan kehon lämpötilan laskun sekä glukoosi- ja insuliinipitoisuuden, painon ja rasvamäärän vähenemisen (Guarente ja Picard 2005). Vähäinen energiansaanti tekee eläimet resistentiksi ulkoisille stressitekijöille, kuten oksidatiiviselle stressille. Tämä on tärkeä sopeutumismekanismi, sillä ikääntymisen uskotaan liittyvän ROS:n (reactive oxygen species) muodostukseen.”- Professori Markku Laakso / Duodecim


Johdanto

Nyt syntyviä sukupolvia odottavat ilmastonmuutoksen, hallitsemattoman väestönkasvun ja taloudellisesti yhä selvemmin jakaantuneen maailman asettamat haasteet.

Toisaalta lääketieteellinen kehitys ja ymmärrys geenien toiminnasta lupaa tuleville sukupolville pitkää ja tervettä elämää. Eräs mullistavimmista lääketieteellisistä keksinnöistä viime vuosina on ollut CRISPR-Cas-9 geenisakset, joilla DNA:sta voidaan leikata viallisia jaksoja ja korvata ne terveillä jaksoilla. Samaan aikaan ymmärrys ikääntymisestä ja siihen vaikuttavista aineenvaihduntamekanismeista on täsmentynyt.

Salaperäiset sirtuiinit ohjaavat ja tehostavat solujen rasva-aineenvaihduntaa silloin kun glukoosin saanti on vähäistä. Niukka energiansaanti käynnistää aineenvaihdunnan luonnollisen sopeutumismekanismin, johon osallistuu SIRT1-geeni. Sirtuiinit ovat NAD+ -riippuvaisia solujen apoptoosia, tulehdusvastetta, solujen elämänkaarta, geenitranskriptiota ja aineenvaihduntaa sääteleviä proteiiniasetylaaseja.



NAD+ eli nikotiiniamidiadeniinidinukleotidi ja proteiiniasetylaasit

Molekyylibiologiaan harjaannuttamattoman silmissä nämä sanat ovat silkkaa hepreaa. Mitä ne tarkoittavat ja mitä helvettiä ne meille tekevät? Vaikeilla sanoilla on miltei maagisia tarkoituksia. Mitä koentsyymit, kofaktorit ja entsyymit ovat?

NAD+ on kaikissa elävissä soluissa esiintyvä koentsyymi. Koentsyymit (tai kofaktorit) ovat orgaanisia molekyylejä tai epäorgaanisia metalli-ioneja, joka entsyymin on sidottava itseensä toimiakseen kemiallisia reaktioita katalysoivana entsyyminä.

Monet koentsyymeistä ovat vitamiineja, osa metalleja, kuten kofaktori-ionit Mn2+, Mg2+ ja Zn2+. Entsyymi, johon ei ole sitoutunut sen luontaista kofaktoria tai kofaktoreita on toimimaton apoentsyymi. Koentsyymi muodostaa entsyymin proteiiniosan eli apoentsyymin kanssa toimivan entsyymin.

Epäorgaanisia kofaktoreita ovat mm. ravinnosta saatavat metalli-ionit Cu2+, Fe2+ tai Fe3+, K+, Mg2+. Arvaatte varmaan, että näitä on paljon enemmän, mutta eiköhän pointti selvinnyt.

Nämä epäorgaaniset kofaktorit muodostavat apoentsyymien kanssa entsyymejä, kuten: sytokromi-c-oksidaasin, katalaasin, peroksidaasin, pyryvaattikinaasin, heksokinaasin ja glukoosi-6-fosfataasin.

Monet orgaanisista koentsyymeistä ovat vitamiineja tai niiden johdannaisia, kuten biosytiini, koentsyymi A, 5’-deoksiadenosyylikobolamiini, flaviiniadeniinidinukleotidi, lipoaatti, NADH/NAD+, pyriokdaalifosfaatti jne. Näiden koentsyymien esiasteet ovat vitamiineja, kuten biotiini (B7), pantoteenihappo(B5), B12, riboflaviini (B2), niasiini (B3), B6, folaatti (B9) ja tiamiini (B1).

Entsyymit ovat kemiallisia aineenvaihduntareaktioita nopeuttavia biologisia katalyytteja. Ne ovat yleensä proteiineja, mutta myös RNA-molekyylit eli ribotsyymit voivat olla entsyymejä. Entsyymien vaikutus perustuu niiden kykyyn alentaa substraattiin kohdistuvan reaktion aktivaatioenergiaa. Ilman entsyymejä kemialliset reaktiot tapahtuisivat soluissa liian hitaasti, eikä elämä olisi mahdollista. Nopeimmat entsyymit muuttavat jopa 40 miljoonaa molekyyliä reaktiotuotteiksi sekunnissa.


NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa biologisissa hapetus-pelkistysreaktioissa.

Nikotiiniamidiadeniinidinukeotidi muistuttaa kemialliselta rakenteeltaan toista tärkeää koentsyymiä, nikotiiniamidiadeniinidinukleodifosfaattia (NADP+). NAD+ osallistuu katabolisiin aineenvaihduntareaktioihin ja NADP+ on tärkeä koentsyymi anabolisissa reaktioissa.

Kataboliset aineenvaihduntareaktiot pilkkovat monimutkaisia molekyylejä yksinkertaisemmiksi ja anaboliset aineenvaihduntareaktiot rakentavat yksinkertaisemmista molekyyleistä suurempia ja monimutkaisempia molekyylirakenteita.

Eliöt tuottavat NAD+:a kahdella tavalla:

1. Geenien säätelemässä de novo-synteesissä tryptofaanista (aminohappo) syntetisoidaan ensin kinoliinihappoa, joka muutetaan nikotiinihappomononukleotidiksi ja edelleen nikotinaattinukleotidiadenyylitransferaasientsyymin avulla desamino- NAD+:ksi.
NAD+ syntaasientsyymi muuttaa desamino- NAD+:n nikotiiniamidiadeniinidinukleotidiksi.

2. NAD+-biosynteesiä tapahtuu myös nikotiiniamidista, joka prosessoidaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

Proteiiniasetylaasit ovat asetyyliryhmään kiinnittyviä proteiineja. Deasetylaasit poistavat osia asetyyliryhmästä. Nisäkkäillä tunnetaan seitsemän erilaista ja erilaisiin reaktioihin osallistuvaa sirtuiinia. Esimerkiksi SIRT1-3 ja SIRT5 ovat deasetylaaseja. Solun tumassa on SIRT1:tä, SIRT6:ta ja SIRT7:ää. Mitokondrioissa on puolestaan SIRT3-5:tä ja solulimassa SIRT2:ta.

Mitä ne sirtuiinit siellä soluissa tekevät?

SIRT1 säätelee aineenvaihduntaa ja solujen elinkaarta
SIRT2 ja SIRT6 saattavat vaikuttaa kasvaimien kehittymiseen ja syöpään
SIRT3 ja SIRT4 osallistuvan aineenvaihdunnan säätelyyn
SIRT4 liittyy aminohappovälitteiseen insuliinin eritykseen

SIRT1 vaikuttaa erityisesti energia-aineenvaihdunnan kannalta keskeisissä kudoksissa, kuten haimassa, maksassa ja rasvakudoksessa. SIRT1:n aktivoituminen lisää insuliiniherkkyyttä ja laskee glukoosi- ja insuliinipitoisuuksia.

Koska SIRT1 on PPAR*-estäjä (*peroxisome proliferator-activated receptor), se kiihdyttää rasvakudoksen lipolyysiä vapauttamalla rasvakudoksiin varastoituja rasvahappoja verenkiertoon.


Lipolyysi vs. lipogeneesi

Lipolyysi pilkkoo rasvasoluihin varastoituja triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu verenkierron mukana maksaan, ja rasvahapot energialähteiksi luurankolihaksille, maksalle ja sydämelle.

Lipolyysi aktivoituu paaston ja vähän hiilihydraatteja sisältävän ruokavalion yhteydessä hormonaalisesti lipolyyttisten hormonien: glukagonin, kortikotropiinin, adrenaliinin ja noradrenaliinin vaikutuksesta.

Lipolyysin tarkoitus on säästää glukoosia punasoluille ja hermosoluille, jotka eivät pysty käyttämään rasvahappoja energiantuotannossa. Lipolyysille vastakkainen aineenvaihduntareaktio on lipogeneesi, joka prosessoi ja varastoi ylimääräisiä sokereita rasvahapoiksi.

Insuliini osallistuu ravinnon soluun pääsyyn sekä ravinteiden varastoimiseen lihas-, maksa- ja rasvasoluihin. Glukagoni ja muut lipolyyttiset hormonit purkavat solujen sokeri- ja rasvavarastoja verenkiertoon, jolloin niitä voidaan käyttää solujen energiantuotannossa.

Lipolyysiä ohjaa lipaasi. Kun haima erittää vereen insuliinia, lipolyysi estyy. Rasvakudos on herkkä insuliinin säätelylle. Kun veren insuliinipitoisuus laskee, lipolyyttiset hormonit ohjaavat lipaasin toimintaa. Tämä käynnistää lipolyysin ja rasvahappoja vapautuu rasvasoluista vereen.

Veren mukana soluihin kulkeutuneista rasvahapoista tuotetaan beetaoksidaatiossa asetyylikoentsyymi-A:ta, joka on kaikille energiaravinteille yhteinen väliaine sitruunahappokierrossa. Asetyylikoentsyymi-A voi jatkaa solujen energiantuotantoa mitokondrioissa tapahtuvassa sitruunahappokierrossa, jos glukoneogeneesi ei ole käynnissä.

Kun SIRT1 aktivoituu, insuliinin eritys haimasta lisääntyy. SIRT1myös suojaa haiman beetasoluja oksidatiiviselta stressiltä.

PCG-1:n*-aktivoituminen (*peroxisome proliferator-activated receptor gamma coactivator-1) lisää glukoosin syntetisoimista maksassa osana SIRT1-aktivaatiota. PCG-1 kasvattaa mitokondrioiden määrää ja kokoa sekä kiihdyttää rasvahappojen hapettumista beetaoksidaatiossa. Nämä tekijät yhdessä vaikuttavat suotuisasti glukoosin aineenvaihduntaan.

SIRT1 suojaa keskushermoston soluja neurodegeneratiivisilta prosesseilta. Punaviinin, mustikoiden, viinimarjojen ja karpaloiden sisältämä fenoliyhdiste resveratroli on SIRT1-aktivaattori, joka lisää PCG-1-aktivaatiota. Tämä on tutkimuksissa tehostanut mitokondrioiden toimintaa, energiankulutusta ja hapenottokykyä. Se voi lisätä myös solujen insuliiniherkkyyttä ja laskea rasvamaksaan sairastumisen riskiä.

Resveratroli on eläinkokeissa suojannut runsaasti energiaa ravinnosta saavia hiiriä lihomiselta estämällä PPAR:n* (*peroxisome proliferator-activated receptor) aktivaation. SIRT1 voi vaikuttaa suotuisasti aikuistyypin diabetekseen, sillä se lisää solujen insuliiniherkkyyttä ja haiman insuliinin eritystä, sekä laskee painoa ja kehoon varastoituneen rasvan määrää.

Yhteenveto

SIRT1 (Silent Information Regulator 1) osallistuu useisiin aineenvaihduntaprosesseihin ja energia-aineenvaihdunnan säätelyyn. SIRT1 vaikuttaa lihavuuteen ja aikuistyypin diabetekseen säätelemällä rasvojen aineenvaihduntaa ja mitokondrioiden biogeneesiä.

Sirtuiinien hermoja ja aivosoluja suojaava vaikutus perustuu toisaalta SIRT1:n oksidatiivista stressiä vähentävään vaikutukseen ja toisaalta SIRT1:n kykyyn vähentää tulehdusvastetta sitoutumalla NF-kB*:en (Nuclear Factor-kappaB) ja siten ehkäistä hermosoluissa tapahtuvaa neurodegeneraatiota ja atrofiaa.


NF-kB


Hiirikokeissa sekä akuutit, että pitemmän ajan kuluessa syntyvät hermosoluvauriot johtavat lähes aina aivojen mikrogliasolujen aktivaatioon. M1-tyypin mikrogliat erittävät tulehdusta edistäviä sytokiineja, jotka lisäävät osaltaan hermosolujen atrofiaa, kun taas M2-tyypin solut poistavat kuolleita soluja ja erittävät vaurioituneisiin hermoston osiin erilaisia kasvutekijöitä.

Keskeisenä tulehdusreaktioiden välittäjänä toimii transkriptiotekijä, tumatekijä kappaB (NF-kB) ja erityisesti sen p50/105-alayksikkö. Hiirikokeissa havaittiin, että NF-kB p50/105-alayksiköllä on merkittävä rooli aivojen tulehdusreaktioiden välittäjänä ja sitä kautta aivojen uusien hermosolujen muodostumisessa. NF-kB p50/105-alayksikön puuttumisen vaikutus vaihtelee eri tautimalleissa ja eri ikäisillä hiirillä.  (Taisia Rõlova)

”Tulehdus on immuunijärjestelmän aikaansaama reaktio, jonka avulla elimistö pyrkii vastaamaan infektioon tai kudosvaurioon ja korjaamaan sen. Matala-asteinen krooninen tulehdus on häiriötila, joka voi ylläpitää tulehdusvasteita kudoksissa aineenvaihdunnan muutosten kautta ja johtaa edelleen kudosvaurioihin sekä altistaa monille sairauksille, kuten astmalle, Alzheimerin taudille, sydän- ja verisuonitaudeille ja erilaisille syöville.”- Anu Wiklund

VIDEO


OSA 1: Energia-aineenvaihdunnan perusteet


Evoluution seurauksena ihmiselle on kehittynyt tehokkaita selviytymismekanismeja toisaalta adaptiivisen immuunijärjestelmän kautta erilaisia taudinaiheuttajia vastaan, ja toisaalta turvaamaan välttämättömät elintoiminnot silloinkin, kun ravintoa ei ole riittävästi saatavilla.

Terve nuori aikuinen selviää pelkällä vedellä kolmisenkymmentä vuorokautta. Aineenvaihdunta käyttää energianlähteenä ensimmäiseksi elimistön sokeri- ja rasvavarastot, mutta ravinnonpuutteen jatkuessa myös lihasten proteiineja käytetään energian lähteenä välttämättömien elintoimintojen turvaamiseksi.

Nykyinen yltäkylläisyys ja ravinnon helppo saatavuus on uusi ilmiö. Meille ruoka ja sen vaivaton saatavuus on itsestäänselvyys, mutta kaukaiset esivanhempamme joutuivat elämään pitkiäkin aikoja hyvin niukalla ravinnolla tai kokonaan ilman ruokaa.

Varhaiset ihmiset söivät silloin, kun ravintoa oli tarjolla ja paastosivat, kun ruokaa ei ollut. Ravinnosta saatu ylimääräinen energia varastoitiin rasva- ja lihassoluihin. Lihominen auttoi ihmisiä selviämään niukoista ajoista.

Toisaalta ravinnon saatavuuden epävarmuus on ilmeisesti vaikuttanut erilaisten biologisten selviytymismekanismien kehittymisen lisäksi eräänlaisen psykologisen selviytymismoodin syntymiseen. Nälkäinen ihminen valpastuu, aistit tarkentuvat, keskittymiskyky paranee, ympäristön hahmottaminen tehostuu, päätöksenteko nopeutuu jne. Tälle on biokemialliset ja hormonaaliset syyt. Väitän, että hieman nälkäinen ihminen on älyllisesti ja fyysisesti parhaimmillaan. Se on asia, josta toki voi kiistellä.

Sokeria vai rasvaa? Kuinka solut saavat energiaa?

Kaikki solut voivat käyttää glukoosia energianlähteenä. Solujen sytoplasmassa tapahtuva glykolyysi pilkkoo glukoosimolekyylin kahdeksi pyruvaatiksi, mikä tuottaa kaksi runsasenergistä ATP-molekyyliä. Kummastakin pyruvaatista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Aminohapot, hiilihydraatit ja rasvahapot on muutettava asetyyliryhmiksi ja liitettävä koentsyymi-A:han, jotta ne pääsevät mitokondriossa tapahtuvaan sitruunahappokiertoon. Sitruunahappokierrossa pyruvaateista saadaan vielä kolmisenkymmentä ATP-molekyyliä. Tämän soluhengityksen lopputuotteena on vettä ja hiilidioksidia.

Myös rasvaa (ja proteiineja) voidaan käyttää energian tuottamiseen. Aineenvaihdunta osaa käyttää esimerkiksi eräitä proteiineista saatavia ja vapaita aminohappoja glukoosia tuottavassa glukoneogeneesissä.

Rasvojen energia-aineenvaihdunnan perusta on beetaoksidaatio, ketoosi ja ketogeneesi. Solujen kannalta hiilihydraateista saatava glukoosi on kaikkein helpoin ja nopein energianlähde. Siihen aineenvaihduntamme on totutettu lapsesta alkaen. Rasvan ja proteiinien muuttaminen energiaksi kelpaavaan muotoon edellyttää useita aineenvaihduntareaktioita.

Lähtökohtaisesti keho suosii siis hiilihydraatteja energianlähteenä. Hiilihydraatit pilkotaan sokereiksi, jotka imeytyvät ohutsuolen epiteelin läpi verenkiertoon. Glukoosi kohottaa verensokeria ja haima reagoi glukoosipitoisuuden kasvuun erittämällä vereen insuliinia. Insuliinimolekyyli kiinnittyy solun pinnassa olevaan insuliinireseptoriin ja toimii kuin avain, joka avaa solun glukoosimolekyyleille.

Fruktoosi prosessoidaan maksassa ensisijaisesti glykogeeneiksi eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi. Nämä ovat nopeita varastosokereita. Osa fruktoosista muutetaan glukoosiksi, joka vapautuu verenkiertoon ja 1-2 % fruktoosista muutetaan triglyserideiksi.

Myös veressä oleva ylimääräinen glukoosi muutetaan mahdollisuuksien mukaan lihasten glykogeeneiksi. Glykogeenivarastojen rajallisen koon vuoksi osa glukoosista varastoidaan rasvasoluihin ja muutetaan rasvasolussa tapahtuvassa lipogeneesissä triglyserideiksi.

Veren glukoosipitoisuuden laskiessa haiman alfasolut erittävät vereen glukagonia, joka vapauttaa maksan glykogeenivarastoista glukoosia vereen ja lihasten glykogeeneistä glukoosia lihasten käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.



Entä sitten kun sokerivarastot loppuvat?


Maksan ja lihasten sokerivarastot voivat loppua paastotessa, hyvin niukkaenergisellä ruokavaliolla tai hiilihydraattien saantia rajoitettaessa. Tällöin elimistön on turvauduttava varastoimaansa energiaan eli läskiin.

Veren glukoosipitoisuuden laskun seurauksena vereen erittyy lipolyyttisiä hormoneja: glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia. Näiden vaikutuksesta elimistön rasva-aineenvaihdunta tehostuu.

Ketoaineiden tuotanto

Lipolyysi purkaa rasvasolujen triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu maksaan, jossa sitä voidaan hyödyntää mm. glukoosia syntetisoivassa glukoneogeneesissä.

Soluihin kulkeutuvat vapaat rasvahapot pilkotaan beetaoksidaatiossa asetyylikoentsyymi-A:ksi. Glukoneogeneesin yhteydessä asetyylikoentsyymi-A:ta ei voida hapettaa normaalisti mitokondrioissa, vaan ylimääräisestä asetyylikoentsyymi-A:sta muodostetaan 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-syntaasin katalysoimana 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A:ta (HMG-KoA) ja edelleen mitokondrioissa 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-lyaasin (HMG-KoA-lyaasi) katalysoimassa reaktiossa ketoaineita: asetoasetaattia ja siitä edelleen betahydroksibutyraattia ja asetonia.

Asetyylikoentsyymi-A on kaikille ravintoaineille yhteinen väliaine solun valmistaessa energiaa. Sen asetyyliryhmän hiilet hapettuvat hiilidioksidiksi sitruunahappokierrossa (Krebsin sykli) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio

Oksidatiivinen fosforylaatio on elektroninsiirtoketjusta ja ATP-syntaasista koostuva aineenvaihduntareitti. Happea käyttävien solujen ATP-energiasta noin 90 % syntyy oksidatiivisessa fosforylaatiossa eli kun ravintoaineet hapettuvat ja energia sitoutuu suurienergisiin fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio, glykolyysi ja sitruunahappokierto päättävät solun katabolisen energiantuotannon. Glykolyysissä, rasvahappojen oksidaatiossa ja trikarboksyylihappokierrossa muodostuneiden pelkistyneiden koentsyymien (NADH ja FADH2) elektronit siirtyvät oksidatiivisen fosforylaation elektroninsiirtoketjuun. Nämä elektronit pelkistävät happimolekyylit vedeksi, jolloin vapautuva energia sitoutuu ATP:nä.

Yhdestä glukoosimolekyylistä saadaan noin 30 suurienergistä ATP-molekyyliä.

Katabolisessa aineenvaihdunnassa pienimolekyyliset yhdisteet (aminohapot, monosakkaridit, rasvahapot) pilkotaan ja ”poltetaan” solujen energiaksi. Kaikkien energiaravinteiden yhteinen väliaine on asetyylikoentsyymi-A.

Asetyylikoentsyymi-A voidaan pilkkoa sitruunahappokierrossa, jossa sen hiiliatomit hapettuvat hiilidioksidiksi ja vetyatomit siirtyvät hapetus-pelkistysreaktioissa keoentsyymeille (NADH ja FADH2) Nämä siirtävät vetyä sitruunahappokierron ja elektroninsiirtoketjun välillä. Koentsyymit menettävät elektronit ja hapettuvat NAD+:ksi ja FAD:ksi, jotka jatkavat kiertoa.

Osa 2: Ketoosi ja sirtuiinit

Ketoosi kiihdyttää sirtuiinien aktivaatiota soluissa. Sirtuiinit kuuluvat histonideasetylaaseihin (HDAC). Ne ovat proteiineja, jotka poistavat asetyyliryhmän geenin histonista ja näin ”sammuttavat” geenin ilmentymisen eli ekspression.

Jokainen solu sisältää yksilön jokaisen geenin, mutta geeni ilmentyy vain tietyissä soluissa, ja joskus vain tiettyyn aikaan. Sammutettua geeniä ei lueta proteiinin valmistuksessa.

Ketoosi lisää sirtuiini1:en (SIRT1) määrää hippokampuksen eli aivoturson alueella ohimolohkojen sisäosissa korvien lähellä. Kummankin ohimolohkon hippokampus on yhteydessä toiseen ja hypotalamukseen aivokaaren välityksellä.

Nyt liikutaan kiistanalaisilla vesillä. Vuosittain arviolta 2,8 miljoonaa ihmistä kuolee lihavuuden aiheuttamiin komplikaatioihin. Tutkimuksissa on havaittu, että väestöjen keskimääräinen älykkyys laskee. Voisiko olla niin, että runsasenerginen ravinto ei tuhoa vain terveyttämme, vaan myös kognitiiviset kykymme? Voisimmeko elää nälässä terveempinä ja älykkäämpinä. Siinä on provokatiivinen keskustelunaihe kahvipöytään.


Hippokampus ja deklaratiivinen muisti



Hippokampus osallistuu muistitoimintoihin. Erityisen tärkeä hippokampus on deklaratiivisen muistin eli säilömuistin toiminnassa. Deklaratiivinen muisti jakautuu semanttiseen ja episodiseen muistiin. Semanttiseen muistiin tallentuvat asiat, joiden merkitys ymmärretään. Episodimuistiin tallentuu välähdyksenomaisia muistoja tapahtumista. SIRT1-puutos aiheuttaa kognition, muistin ja suunnitelmallisuuden häiriötilan.

”Li-Huei Tsai’s group found that Sirt1 regulates memory by forming a complex that downregulates microRNA miR-134.  This microRNA targets mRNA transcripts for the key learning and memory genes CREB and BDNF, so by keeping miR-134 low, Sirt1 promotes memory formation by keeping CREB and BDNF levels high.”

2016 tehdyssä tutkimuksessa (Heyward et al.) havaittiin, että jatkuvasti liikaravittujen hiirien muistitoiminnot heikkenivät ja hippokampuksen sirt1-pitoisuudet laskivat. Muistia ja oppimista säätelevien geenien ekspression heikkeneminen assosioitui DNA:n lisääntyneeseen metylaatioon.

Tutkijat raportoivat myös SIRT1-geeniin liittyvän DNA:n hydroksimetylaation vähenemisestä. Runsaasti energiaa sisältävän ravinnon aiheuttama DNA:n metylaatio hiirillä alleviivaa ympäristövälitteisten epigeneettisten muutosten vaikutuksia geenin ilmentymiseen.

Hydroksimetylaation merkitys aivojen toiminnalle on yhä arvailujen varassa, mutta tutkijat uskovat, että hydroksimetyloitunut DNA estää eräiden repressiivisten kompleksien sitoutumisen DNA:han.

Kolmas ruokavalioon liittyvä havaittu epigeneettinen mekanismi on, että yksi kolmesta ketoainetyypistä, betahydroksibutyraatti on itsessään endogeeninen HDAC-estäjä. Vaikka sirtuiinit estävät muistin repressoreita (torjujat?), toiset HDAC-luokan histonideasetylaasit voivat estää muistia parantavien geenien toimintaa. Tällaisten histonideasetylaasien estäjät parantavat muistin toimintaa ja niillä on suuri terapeuttinen potentiaali.

Moses Chaon tutkijaryhmä havaitsi, että betahydroksibutyraatti lisää hippokampuksen BDNF-expressiota estämällä HDAC2:ta ja HDAC3-5:tä. Käänsin edellisen kappaleen niin sekavasti, että täsmennetään: betahydroksibutyraatti parantaa muistiin vaikuttavien geenien ilmentymistä estämällä eräitä histonideasetylaaseja.

Eläinkokeiden perusteella ravinnosta saadun energian rajoittaminen ja ketogeeninen ruokavalio suojaavat aivojen soluja, tehostavat muistia ja parantavat kognitiivisia toimintoja. Vastaavasti runsasenerginen ja hiilihydraattipainotteinen ravinto ylläpitää oksidatiivista stressiä ja kasvattaa neurodegeneratiivisten muutosten riskiä.  Eräässä lievistä muistivaikeuksista kärsivillä vanhuksilla toteutetussa tutkimuksessa kuuden viikon vähähiilihydraattinen ruokavalio paransi koehenkilöiden verbaalista muistia. Toisessa kokeessa terveille nuorille aikuisille annettiin annos glukoosia. Kognitiivisia kykyjä mitattiin ennen glukoosia ja sen jälkeen. Tässä tutkimuksessa nuorten kognitiiviset kyvyt heikkenivät 20 minuuttia glukoosiannoksen jälkeen.

Ketogeeninen ruokavalio säätelee NAD+-riippuvaisia entsyymejä ja vähentää DNA:n vaurioita hippokampuksen alueella

Ketogeenisen ruokavalion (KD) epileptisia kohtauksia vähentävät vaikutukset on hyvin dokumentoitu. Ketogeeninen ruokavalio on joillain lapsilla ainoa tehokas keino vähentää epilepsiaan liittyviä kohtauksia.

Hiljattain on havaittu ketogeenisen ruokavalion terapeuttinen potentiaali useiden neurodegeneratiivisten sairauksien hoidossa. Kokeellinen todistusaineisto ketoruokavalion hyödyistä on kuitenkin edelleen puutteellista.

Rotilla tehdyssä tutkimuksessa on osoitettu, että ketogeenistä ravintoa saavien rottien hippokampuksen alueen solujen nikotiiniamidiadeniinidinukleotidi+ (NAD+) -tasot kasvavat.

NAD+ on soluaineenvaihdunnan toiminnalle välttämätön koentsyymi, signalointimolekyyli, soluterveyden markkeri sekä pitkäikäisyyteen ja DNA:n vaurioiden korjaamiseen osallistuvien entsyymien, kuten sirtuiinien ja poly-ADP riboosi polymeraasi-1:n (PARP-1) substraatti.

NAD+-riippuvaisten entsyymien aktivaatio voi selittää laajemminkin ketogeenisen ruokavalion hyödyllisiä vaikutuksia. En mene tarkemmin tuon rottakokeen arviointiin, mutta sen tulokset olivat hyvin rohkaisevia aivojen terveyden osalta.

Miten ketogeeninen ruokavalio suojaisi aivoja?

Ketogeeninen (KD) eli LCHF-ruokavalio sisältää hyvin niukasti hiilihydraatteja, runsaasti rasvoja ja kohtuullisesti proteiineja. Hiilihydraattien määrä rajoitetaan noin 10 prosenttiin päivittäisestä energiansaannista. Suurin osa päivittäisestä energiasta saadaan rasvasta, jonka määrä voi olla 60-70 % päivittäisestä energiansaannista. Proteiinien saanti pidetään 20-30 prosentin tasolla päivittäisestä energiansaannista.

KD ohjaa energia-aineenvaihdunnan helpoista ja nopeista hiilihydraateista (glukoosista) enemmän energiaa kuluttavaan rasva-aineenvaihduntaan, jossa vapaista rasvahapoista valmistettuja ketoaineita käytetään solujen ATP:n lähteenä.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio on ainoa tehokas hoitomuoto lasten lääkeresistentin epilepsian epileptisten kohtausten hillitsemiseen. (Neal et al., 2009; Sharma et al., 2013; Cervenka et al., 2017)

Jatkuvasti kasvava tutkimusnäyttö osoittaa, että ketogeenisella ruokavaliolla on suotuisia vaikutuksia terveyteen (Yang and Cheng, 2010; Winter et al., 2017; Augustin et al., 2018) sekä pitkäikäisyyteen (Newman et al., 2017; Roberts et al., 2017).

Tuoreissa tutkimuspapereissa ketogeenisen ruokavalion terveysvaikutukset assosioituvat vahvasti NAD -koentsyymiin (Elamin et al., 2017), joka on välttämätön ATP:n prosessoinnille ja hapetus-pelkistys-reaktiolle. Ketoaine-perusteisessa aivosolujen energia-aineenvaihdunnassa pelkistyy vähemmän NAD-molekyylejä, kuin glukoosiin perustuvassa energia-aineenvaihdunnassa. Tämän seurauksena aivosoluihin jää korkeampia pitoisuuksia hapettuneita NAD+ -molekyylejä.

Ketogeeninen ruokavalio voi havaintojen perusteella indusoida nopeita ja pysyviä muutoksia NAD+ / NADH -suhteissa aivojen runsaasti energiaa kuluttavalla hippokampuksen alueella. Tämä aivojen osa tunnetaan leikkimielisellä nimellä – kohtausportti (seizure gate). Vastaavia havaintoja on tehty ikääntyneillä hiirillä. Sen sijaan ketoaineisiin nojaavan energia-aineenvaihdunnan ei havaittu vaikuttavan aivokuoren alueella.

Korkeammat NAD+ -tasot rajoittavat epileptisia kohtauksia ja kasvattavat koe-eläinten elinajan odotetta (Lin and Guarente, 2003; Mills et al., 2016; Liu et al., 2017). Kokeellisesti kohotetut NAD+ -arvot tehostavat mitokondrioiden toimintaa, suojaavat oksidatiivisen stressin aiheuttamilta vaurioilta ja vähentävät solujen kuolemaa (Kussmaul and Hirst, 2006). Nämä vaikutukset palautuvat alemman tason aineenvaihduntareitteihin.

NAD+ on kahden entsyymiryhmän, sirtuiinien ja poly-(ADP-riboosi) polymeraasien eli PARP:ien substraatti. Nämä entsyymiryhmät vaikuttavat solujen toimintaan geenien ilmentymisestä DNA:n vaurioiden korjaamiseen (Belenky et al., 2007).

NAD+-riippuvaiset sirtuiini-entsyymit ovat tärkeitä aineenvaihdunnan, tulehdusvasteiden ja DNA:n vaurioiden korjaamisen säätelijöinä. Sirt1 osallistuu transkriptiotekijöiden, kasvutekijöiden, anti-apoptisten (ohjattua solukuolemaa estävien) ja anti-inflammatoristen proteiinien deasetylaatioon, eli asetyyliryhmien purkuun.

Sirt1 on välttämätön kognitiivisten toimintojen, muistin ja neuroplastisuuden normaalille toiminnalle (Michan et al., 2010) ja sillä on havaittu epileptisia kohtauksia ehkäiseviä vaikutuksia. Ravinnosta saatavan energian (kaloreiden) rajoittaminen ja ketogeeninen ruokavalio assosioituvat solujen parempaan terveyteen ja ainakin eläinkokeissa odotettavissa olevan elinajan pidentymiseen. Sirt6 ja Sirt7 osallistuvat suoraan DNA:n emäsjaksojen korjaamiseen, mikä vähentää ikääntymisen aiheuttamia DNA-vaurioita.

Lopuksi

On kiinnostavaa seurata sirtuiinien ja ketogeenisen ruokavalion tutkimuksia. Väitteet karppauksen, rasvojen ja ketogeenisen ruokavalion haitallisuudesta ovat vähintäänkin liioiteltuja ja todennäköisesti jopa haitallisia. Tutkimusaineisto sirtuiinien molekyylibiologisesta roolista ja ketogeenisen ruokavalion terveysvaikutuksista karttuu vauhdilla. Minä palaan tähän aiheeseen Ruokasodassa varmasti vieläkin täsmällisempien tutkimusten kautta. Omalla kohdallani olen havainnut, että vähäisempi ravinnonsaanti kasvattaa motivaatiota, muistia ja aktiivisuutta. Nämä tutkimukset näyttävät vahvistavan omia huomioitani.

PS. Iloista ja rauhallista joulua!

Lähteinä olen käyttänyt erikseen ilmoitettujen lähteiden lisäksi mm. Duodecimia ja Wikipdiaa yleisimpien aineenvaihduntareaktioiden osalta. Kuvien lähde: Pixabay

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2928875/

https://www.jneurosci.org/content/36/4/1324.long

https://elifesciences.org/articles/15092

https://www.frontiersin.org/articles/10.3389/fncel.2018.00263/full

https://www.duodecimlehti.fi/lehti/2007/19/duo96781




Esidiabetes, diabetes ja ketoilu

Esidiabeteksessa verensokeri on selvästi koholla, mutta ei vielä niin korkea kuin diabetekseen sairastuneilla. Esidiabeteksen toteamisen jälkeen on tärkeää kiinnittää ravintoon ja elintapoihin enemmän huomiota. Todetuista esidiabetes-tapauksista jopa seitsemän kymmenestä johtaa aikuistyypin diabetekseen. Lue tästä.

Ruokavalio- ja elämäntapamuutokset pienentävät esidiabetes-diagnoosin saaneiden riskiä sairastua aikuistyypin diabetekseen jopa 40-75%.

Elämäntapamuutoksiin kuuluvat säännöllinen liikunta ja terveellinen ruokavalio. Terveellisestä ruokavaliosta on useita keskenään ristiriitaisia näkemyksiä. Eräiden tutkimusten mukaan ketogeeninen ruokavalio voi pienentää diabetekseen sairastumisen riskiä. Onko näin?


Uhkakuvia ja pelkokertoimia


Olen ketoillut alun kolmatta viikkoa. Sitä voi verrata laskuvarjohyppyyn ilman laskuvarjoa. Ketoilu tappaa yhtä varmasti kuin ydinsota ja marraskuun märkä pimeys Helsingissä. En laske leikkiä. Kaikki vähähiilihydraattista ruokavaliota noudattavat kuolevat sataprosenttisen varmasti.

Tämä on pelottavaa, sillä edes täyskäännös ruisleipään, vähärasvaisiin ruokiin, pehmeisiin rasvoihin ja kasviksiin ei pelasta kerran ketoillutta harhaoppista mitenkään. Vain Jumbo voi pelastaa.

Maailman yli 400 miljoonasta diabeetikosta ja 2,8 miljoonaa lihavuuteen vuosittain kuolevasta vain kourallinen sairastui tai kuoli vähähiilihydraattisen ruokavalion vuoksi. He sairastuivat ja kuolivat, koska se on Jumbon tahto. Tai ehkäpä ei.

LCHF-ruokavaliot eivät uhkaa kansallista tai edes monikansallista turvallisuutta. Joidenkin pohdintojen mukaan ketogeeninen ruokavalio voi tosin olla uhka sokeri-, lääke- ja elintarviketeollisuudelle. Se on kaiketi lööperiä.

Vähähiilihydraattista ruokavaliota demonisoidaan osin aiheettomasti. The Lancet julkaisi hiljattain tutkimuskatsauksen, jonka mukaan vähiten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi kohtuullisesti hiilihydraatteja syöviä verrokkeja enemmän. Clickbait-uutisen lopuksi mainittiin lyhyesti, että tosiasiassa U-käyrän toisella puolella myös eniten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi.

Miksi näin on? Mitä uutisella haluttiin kertoa?

Enkä sillä haluttiin kertoa, että ketoilu on helvetin vaarallista, moraalitonta ja halveksittavaa ja sitä vastaan on taisteltava kaikin kuviteltavissa olevin keinoin.

Kaikista uusitupalaisimpien näkemysten mukaan karppaus aiheuttaa, jos ei maailmanloppua, niin ainakin 10-15 miljoonaa uutta sydäntautitapausta pelkästään Suomessa. Näistä arviolta 83 % kuolee seuraavien 3-5 kuukauden sisällä. Jotkut onnettomuuksiin, toiset itsemurhiin ja useimmat hiilihydraattien välttämisen aiheuttamiin komplikaatioihin ja yleisvitutukseen. No niin. Siinäpä tuo saatanan sarkasmi taas tuli. Anteeksi.

Ehkäpä tärkeää ei ole niinkään makroravinteiden osuudet, vaan tasapuolinen ruokavalio ja mikroravinteiden  riittävä saanti. Sitä sietää harkita. Laihtumisen kannalta tällaiseen viittaa Stanfordissa tehty tutkimus, jossa verrattiin LCHF-ruokavaliota vähän kaloreita sisältävään ruokavalioon. Osallistujat laihtuivat molemmilla dieeteillä, mutta seuratuissa ryhmissä oli laihtumisen suhteen suuria sisäisiä eroja.


Ei ole vain yhtä tapaa syödä oikein tai väärin


Ihmiset syövät väärin ja sairastuvat. Se ei ole varsinaisesti kenenkään syy. Se on ennemminkin seuraus siitä, että ruokateollisuus tarjoaa yhä enemmän korkean glykeemisen kuorman ruokia, jotka sisältävät hyvin vähän elimistön tarvitsemia mikroravinteita.

Markkinointi ohjaa kuluttajat syömään halvemmalla, nopeammin, mutta laadullisesti heikompitasoista ruokaa. Sellainen maistuu lisättyjen sokereiden, transrasvojen ja viljojen ansiosta helvetin paljon paremmalta kuin parsa tai porkkana. Tämä johtaa lihomiseen ja kasvattaa sairastumisen riskiä.

Runsaasti energiaa sisältävä ruoka on helppoa, halpaa ja nopea valmistaa. Välttämättömiä ravinteita sisältävä ruoka vaatii enemmän työtä ja suunnittelua.  Kaikilla ei yksinkertaisesti ole aikaa ja energiaa valmistaa ruokaa itse, jolloin on houkuttelevaa turvautua nopeisiin ja halpoihin vaihtoehtoihin.

Ketogeeninen LCHF-ruokavalio ei ole täydellinen tai ainoa terveyttä ja painonhallintaa ylläpitävä ruokavalio, mutta jos sen toteuttaa monipuolisesti, se on ihan pätevä ja harkitsemisen arvoinen vaihtoehto.

Hiilihydraatit eivät pidä kylläisenä yhtä hyvin kuin rasvat. Hiilihydraatteja ja runsaasti huonoja rasvoja sisältävät herkut hampurilaisista donitseihin ja makeisista virvoitusjuomiin vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin päihteet.

On esitetty, että käytännöllisesti katsoen kaikkien riippuvuutta aiheuttavien aineiden addiktoiva vaikutus selittyy viime kädessä niiden kyvyllä vapauttaa dopamiinia aivojen nk. mielihyväkeskuksessa nucleus accumbensissa. (Duodecim)” Sokeri ja erityisesti fruktoosi vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin kokaiini tai alkoholi. Sokeririippuvuus on kokonaan toinen juttu.

Lihominen on vain yksi oire aineenvaihdunnan särkymisestä. Muita oireita ovat metabolinen oireyhtymä, aikuistyypin diabetes, tulehdukselliset suolistosairaudet ja alkoholista riippumaton rasvamaksa. Kaikki ovat lisääntyneet räjähdysmäisesti 1970-luvun jälkeen.

Melkein kaikki lihavat sairastuvat metaboliseen oireyhtymään, joka johtaa yleensä aikuistyypin diabetekseen. Useimmille diabetesta sairastaville kehittyy rasvamaksa. Huonot ravitsemustottumukset edesauttavat yleensä jonkin tulehduksellisen suolistosairauden kehittymistä. Näitä voi käsitellä yksittäisinä ilmiöinä, mutta mielestäni ne ovat osa laajempaa ravitsemukseen liittyvää ongelmaa. Kardiometabolisten sairauksien epidemia uhkaa jo terveydenhoidon kantokykyä ja kansantaloutta.


Oikotietä terveyteen ei ole, mutta jotain on syötävä


En laske hiilihydraatteja. Tiedän, että niiden määrä jää kohdallani 20-50 grammaan päivässä. Rasvaa voisin syödä ehkä hieman enemmän, mutta proteiinien saanti saattaa kohdallani olla hieman tarvetta runsaampaa. Haluan välttää lihomisen ja erityisesti vyötärölihavuuden aiheuttamat sairaudet. Yritän siis laihtua paetakseni aikuistyypin diabetesta. Multippeliskleroottisena en haluaisi uusia taakkoja kannettavakseni.

Näin ketoilun kolmannella viikolla huomaan noudattavani jonkinlaista 6:1-variaatiota. Syön siis kuutena päivänä vähähiilihydraattisesti ja yhtenä päivänä melkein mitä vain kohtuuden ja järjen sallimissa puitteissa. Tämä ei mene kirjan mukaan, mutta katsellaan mihin tämä johtaa.

Ketopäivinä syön kahdesti päivässä ja oloni on koko ajan kylläinen ja energinen. En kaipaa aamu- ja iltapalaa, välipaloja tai herkkuja. Juon vettä, kahvia ja teetä (tarvittaessa punaviiniä tai sokeritonta lonkeroa). Aiemmin napostelin pitkin päivää jotakin ja energiatasot olivat koko ajan aivan nollassa.

Ketogeenisen ruokavalion suuri hyöty laihtumisen kannalta onkin juuri siinä, että rasva pitää kylläisenä pidempään ja naposteluhalu vastaavasti vähenee. Näin päivittäinen energiansaanti laskee ilman näläntunnetta ja suuria uhrauksia.

Varoitus: Ketogeeninen LCHF-ruokavalio ei välttämättä sovi kaikille. Pitkäaikaistutkimuksia LCHF-ruokavalion vaikutuksista terveydelle ei ole. En halua hehkuttaa ketogeenistä ruokavaliota minään muuna kuin mitä se on.

Parantaako ketogeeninen ruokavalio kaikki vaivat? Ei helvetissä paranna. Sellaista väittävät puhuvat paskaa ja myyvät jotain. Aineenvaihdunnan tasolla ketogeenisen ruokavalion toiminta tunnetaan ja se on hyvin tehokas laihdutusruokavalio kahdesta syystä:

1) rasva pitää kylläisenä, jolloin kokonaisenergiansaanti laskee, ja
2) ketogeeninen ruokavalio pakottaa elimistön turvautumaan läskivarastoihin energian saamiseksi, jolloin rasvan ”poltto” tehostuu.

Viralliset mallit, kuten ruokapyramidit eivät ole aivan huonoja, mutta niissä hiilihydraattien eli sokereiden määrä pidetään tarpeettoman korkeana ja rasvojen saantia kehotetaan välttämään tai suosimaan rasvattomia tai vähärasvaisia elintarvikkeita, vaikka rasvat ovat solujen uusiutumiselle sekä aivojen ja hermoston toiminnalle välttämättömiä ravintoaineita. Aivojen kuivapainosta 60 prosenttia on rasvaa. Kolesterolista – jota elimistö tuottaa itse kolesterolisynteesissä, 25 prosenttia on aivoissa. Rasva ja kolesteroli ovat mm. hermoratoja suojaavien myeliinieristeiden rakennusaineita.

Vähän hiilihydraatteja sisältävään ravintoon liittyy monenlaisia ennakkoluuloja, joiden mukaan LCHF-ruokavaliolla syödään vain proteiinia ja rasvaa. Se ei ole aivan totta. Ketogeenisellä ruokavaliolla on mahdollista syödä terveellisesti ja monipuolisesti, jos vain jaksaa nähdä vaivaa ja valmistaa terveellistä ja monipuolista ruokaa.

Usein ketoilija korvaa paljon tärkkelystä sisältävät korkean glykeemisen kuorman hiilihydraatit, kuten perunat ruokavalion sallimilla vihanneksilla. Terveellisten vihannesten ja kasvisten päivittäinen saanti todennäköisesti kasvaa LCHF-ruokavaliolla aiempaan verrattuna.


Diabetes: 1 & 2


Hölöttäminen sikseen. Aiheena on diabetes ja erityisesti ketogeenisen ruokavalion vaikutus diabetesta ehkäisevänä ruokavaliona. Tyypin 1 ja typin 2 diabetes ovat hyvin erilaisia sairauksia.

Tyypin 1 diabeetikon kohdalla hiilihydraattien välttämisen tuottama ketoosi voi johtaa hengenvaaralliseen ketoasidoosiin. Ketogeeninen ruokavalio ei siis sovi tyypin 1 diabetesta sairastavalle, mutta voi vähentää lääkityksen tarvetta tyypin 2 diabetesta sairastavilla.

Diabetekseen sairastuvan sokeriaineenvaihdunta on häiriintynyt. Insuliinintuotanto on loppunut tai solujen insuliinisensitiivisyys on heikentynyt. Haiman Langerhansin saarekkeiden beetasolujen tuottama elintärkeä insuliini on eräänlainen avain, jonka glukoosi tarvitsee päästäkseen solun sisälle.


Insuliinin ja glukagonin vaikutus


Ruokailun jälkeen veren sokeripitoisuus kasvaa. Haima reagoi tähän erittämällä vereen insuliinia. Solujen pinnalla on insuliinireseptoreita, joihin kiinnittyvä insuliinimolekyyli tuo solun läpäisevän kanavamolekyylin solukalvolle. Näin glukoosimolekyyli pääsee soluun, jossa se muutetaan solun tarvitsemaksi energiaksi solulimassa tapahtuvassa glykolyysissä ja mitokondrioissa tapahtuvassa sitruunahappokierrossa. Aerobisessa energiantuotannossa eli soluhengityksessä sokerit (ja rasvat) poltetaan vedeksi ja hiilidioksidiksi.

Kun veren glukoosipitoisuus laskee, haiman alfasolut erittävät vereen glukagonia. Se on insuliinin vastavaikuttajana energia-aineenvaihdunnan kannalta elintärkeä hormoni. Glukagoni aktivoi maksan ja lihasten sokerivarastojen eli glykogeenien purkamisen. Näin veren sokeripitoisuus pysyy tasaisena myös aterioiden välillä.

Mitä tapahtuu, jos ja kun elimistön sokerivarastot loppuvat? Kuoleeko ihminen? Ei. Glukagoni purkaa rasvasoluista rasvahappoja vereen. Se käynnistää maksan ja munuaisten soluissa ketogeneesin ja glukoneogeneesin.

Ketogeneesi ja glukoneogeneesi

Ketogeneesi tuottaa vereen vapautuneista rasvahapoista ketoaineita, joita solut voivat käyttää energianlähteenä. Tähän täysin arkiseen aineenvaihduntaprosessiin ei liity mitään mystiikkaa. Se on elimistön eräs luonnollinen selviytymismekanismi.

Glukoneogeneesi tuottaa mm. sitruunahappokierron väliaineista ja eräistä vapaista aminohapoista glukoosia.

Glukagoni käynnistää beetaoksidaation, glukoneogeneesin ja ketogeneesin. Insuliini keskeyttää nämä aineenvaihduntaprosessit.

Glukagonin vaikutuksesta soluissa käynnistyvässä beetaoksidaatiossa rasvahapot pilkotaan asetyylikoentsyymi-A:ksi eli aktiiviseksi etikkahapoksi. Se on kaikkien energiaravinteiden yhteinen väliaine sitruunahappokierrossa.

Näin rasvasolujen sisältämä rasva muutetaan solujen energiaksi kelpaavaan muotoon ja rasvaa aletaan polttaa solujen energiaksi. Atkinsin hypoteesin mukaan jatkuvasti korkeat insuliinitasot estävät elimistön rasvavarastojen tehokkaan käyttämisen, koska beetaoksidaatio, ketogeneesi ja glukoneogeneesi eivät ehdi kuluttamaan rasvoja, kun tarjolla on jatkuvasti helppoja ja nopeita hiilihydraatteja.

Tyypin 1 diabetes on autoimmuunitauti, jossa kehon oma immuunijärjestelmä tuhoaa insuliinia valmistavat Langerhansin saarekkeiden beetasolut. Tämän seurauksena haima ei pysty tuottamaan riittävästi elintärkeää insuliinia.

Ennen insuliinilääkityksen keksimistä tyypin 1 diabetes oli käytännössä kuolemantuomio. Insuliinilääkityksen ansiosta diabeetikot saavat elää melko normaalisti, mutta se edellyttää jatkuvaa tasapainoilua veren glukoosipitoisuuden tasaisena pitämiseksi. Liian korkea ja liian matala veren glukoosipitoisuus aiheuttavat diabeetikoille jopa hengenvaarallisia komplikaatioita. Diabetesta kutsuttiin aiemmin sokeritaudiksi, koska se vaikuttaa sokerin aineenvaihduntaan.

Tyypin 2 diabeteksessa solujen insuliinireseptorien ”lukkomekanismi” rikkoutuu niin, että vaikka insuliinimolekyylit koettavat kiinnittyä insuliinireseptoreihin, ne eivät kiinnity siihen toivotulla tavalla. Haima voi tuottaa yhä insuliinia, mutta solut eivät reagoi insuliiniin niin kuin niiden pitäisi reagoida. Tätä kutsutaan insuliiniresistenssiksi.

Tyypin 1 diabetes on erityisesti lasten ja nuorten sairaus, vaikka siihen voi sairastua vanhempanakin. Se edellyttää perinnöllisen alttiuden sekä yhden tai useamman sairastumisen laukaisevan tekijän. Tyypin 1 diabetes on hoidettavissa insuliinilääkityksellä, mutta ei parannettavissa. Se on elinikäinen sairaus. Diabetesta sairastavista noin 5 % sairastaa tyypin 1 diabetesta.

Tyypin 2 diabetes on elämäntapoihin liittyvä sairaus, johon sairastutaan yleensä aikuisena. Tosin se yleistyy pelottavan nopeasti myös ylipainoisten lasten parissa. Myös tyypin 2 diabetekseen liittyy perinnöllinen alttius, mutta siihen sairastumista voidaan ehkäistä ja oireita helpottaa elämäntapamuutoksilla.

Molemmissa tapauksissa diabetes voi johtaa erilaisiin komplikaatioihin, kuten sydän- ja verisuonitauteihin, munuaisten sairauksiin, sokeuteen, erilaisiin neurologisiin häiriöihin sekä verisuoni- ja elinvaurioihin.

Yhdysvalloissa jo lähes joka kymmenes ihminen (noin 30 miljoonaa) sairastaa diabetesta, mutta sairastuneista 25 % ei tiedä sairastavansa.

Paistettua chilillä maustettua kanaa ja kasviksia, porkkanaraaste ja jogurttikastike

Raskausaikainen diabetes paranee usein synnytyksen jälkeen, mutta joissain tapauksissa se voi johtaa aikuistyypin diabetekseen myöhemmin elämässä.


Diabeteksen syyt


Tyypin 1 ja tyypin 2 diabetes johtuvat eri syistä, mutta molempiin liittyy insuliini. Insuliini on haiman tuottama sokeriaineenvaihdunnalle elintärkeä hormoni.

Tyypin 1 diabetes

Autoimmuunitautien tarkkaa syntytapaa ei tunneta. Niissä immuunijärjestelmän virheellinen toiminta kohdistaa aktivaation kehon omia kudoksia vastaan. Diabeteksessa immuunijärjestelmä tuhoaa haiman Langerhansin saarekkeiden insuliinia tuottavia beetasoluja. Autoimmuunitaudit edellyttävät perinnöllisen sairastumisalttiuden sekä yhden tai useamman sairastumisen laukaisevan ympäristötekijän. Tyypin 1 diabeteksen saattaa laukaista jokin lapsuudessa sairastettu infektio. Tutkimus.

Sairastumisen riskiin vaikuttavat mahdollisesti:

  • perinnölliset tekijät; suvussa esiintyy diabetesta
  • eräät geenimuutokset
  • muut sairaudet, kuten kystinen fibroosi ja perinnöllinen hemokromatoosi
  • altistuminen infektioille, kuten sikotaudille, vihurirokolle ja tavalliselle herpesvirukselle (cytomegalovirus)
  • matalat sikiöaikaiset D-vitamiinitasot

Tyypin 2 diabetes

Aikuistyypin diabeteksessa solut alkavat vieroksua insuliinia. Hiljalleen tauti etenee pisteeseen, jossa insuliinin tuotanto vähenee ja solut eivät pysty käyttämään glukoosia tehokkaasti. Glukoosi ei pääse soluihin ja sitä alkaa kerääntyä verenkiertoon. Insuliiniresistanssi ilmenee mittauksissa selvästi kohonneena verensokerina.

Insuliiniresistenssi voi syntyä, jos veren glukoosipitoisuus on jatkuvasti korkea ja veressä on runsaasti insuliinia. Solut ylikuormittuvat ja ”kyllästyvät” insuliiniin, jolloin ne reagoivat insuliinin vaikutuksiin huonommin.

Tyypin 2 diabeteksen selkeiden oireiden ilmenemiseen voi mennä vuosia. Taudin varhaisvaiheessa sairauden etenemistä voi vielä hidastaa ja oireita hillitä lääkkeiden, ruokavalion ja liikunnan avulla. Insuliinia ei sairauden alkuvaiheessa tarvita, mutta taudin edetessä insuliinin tarve kasvaa veren glukoosipitoisuuden tasaisena pitämiseksi.

Tyypin 2 diabeteksen riskitekijöihin kuuluvat:

  • perinnöllinen alttius; suvussa esiintyy aikuistyypin diabetesta
  • ylipaino ja lihavuus
  • tupakointi
  • huonot ruokatottumukset
  • liikunnan puute
  • eräät lääkkeet

Riskitekijät

Geneettiset tekijät sekä eräät ympäristömuuttujat voivat laukaista tyypin 1 ja tyypin 2 diabeteksen, mutta aikuistyypin diabeteksen voi välttää laihduttamalla, syömällä terveellisesti ja liikkumalla riittävästi. JAMA Oncology -julkaisu kertoo, että kuitujen ja maustamattoman jogurtin saanti laskee keuhkosyövän riskiä merkittävästi. Aiemmissa tutkimuksissa on havaittu jogurtin ja kuitujen vähentävän aikuistyypin diabeteksen riskiä.

D-vitamiini

On jonkin verran tutkimusnäyttöä siitä, että riittävä D-vitamiinin saanti laskee diabetekseen sairastumisen riskiä. Erityisesti odottavan äidin ja sikiön matalat D-vitamiinitasot voivat altistaa sairastumiselle myöhemmin elämässä. 2017 julkaistun tutkielman mukaan D-vitamiinin vajaus heikentää mm. immuunijärjestelmän säätelyä ja solujen insuliiniherkkyyttä; tämä puolestaan lisää diabetekseen sairastumisen riskiä.

Rintaruokinta

Rintaruokinta voi laskea lapsen riskiä sairastua tyypin 1 diabetekseen. 2012 julkaistu tutkimus tulkitsi rintaruokinnan suojaavan lasta tyypin 1 diabetekseen sairastumiselta, mutta tieteellinen näyttö rintaruokinnan suojaavasta vaikutuksesta jäi melko ohueksi.

Oireet

Diabeetikko voi kärsiä monenlaisista alhaisen verensokerin aiheuttamia oireita ja komplikaatioita.

Aikuistyypin diabetekseen liittyy metaboliseen oireyhtymään viittaavia piirteitä, kuten lihavuutta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja. Inflammaatio vaikuttaa metaboliseen oireyhtymään ja aikuistyypin diabetekseen.

Ketoilijan jauhelihasalaattia

Tyypin 1 diabetes Tyypin 2 diabetes
Ennen tautia Painoindeksi on tasolla (19–24.9) Painoindeksi (25 tai suurempi)
Taudin aikana Useita viikkoja jatkuva nälän- ja janontunne sekä lisääntynyt virtsaamisen tarve, näön hämärtyminen.

Näön hämärtyminen, väsymys, käsien ja jalkojen puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon äkillinen putoaminen.

Lisääntynyt janon- ja nälän tunne, lisääntynyt virtsaamisen tarve, näön hämärtyminen

Väsymys, jalkojen ja käsien puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon selittämätön lasku.

 

Komplikaatiot

Riskinä sydän- ja verisuonitaudit, sydänkohtaus, halvaus, munuaistauti ja munuaisen vajaatoiminta.

Silmävauriot ja sokeus, hermovauriot, hitaasti paranevat haavat, ketoasidoosi

Riskinä sydän- ja verisuonitaudit, sydänkohtaus ja halvaus, munuaistauti ja munuaisten vajaatoiminta, näön heikkeneminen, hermovauriot.
Hitaasti paranevat haavat, kuoliot (amputaation riski), ketoasidoosi.

Hyperglykemia

Jos diabeetikon veren sokeripitoisuus kasvaa liian korkeaksi, seurauksena on hyperglykemia. Tämä voi johtaa pitkäkestoisiin komplikaatioihin, sokeutumiseen, sydän- ja verisuonitauteihin ja elinvaurioihin. Hyperglykemiaan liittyy usein lisääntynyt virtsaamisen tarve ja kova jano.

Hyperglykemia voi johtaa ketoasidoosiin, eli happomyrkytykseen, joka on diabeetikoilla hengenvaarallinen ja lääkärin hoitoa vaativa tila.

Ketoasidoosin yleiset oireet:

  • hengitysvaikeudet
  • makealta ja hedelmäiseltä haiseva hengitys
  • pahoinvointi ja oksentelu
  • kuiva suu
  • kooma

Hypoglykemia

Diabetesta sairastavien pitää seurata veren sokeritasoja säännöllisesti. Diabetesta sairastavan verensokerin lasku liian alhaiselle tasolle viittaa hypoglykemiaan. Hypoglykemian voi aiheuttaa liian suuri annostus insuliinia tai insuliinia tuottavaa lääkettä.

Hypoglykemian oireita ovat:

  • hikoilu, vilunväreet, kalpeus
  • heikotus, vapina, hermostuneisuus, ahdistus
  • kiihtynyt pulssi
  • huimaus
  • pahoinvointi
  • väsymys
  • päänsärky
  • kihelmöinti

Hypoglykemian hoitamiseksi diabetesta sairastavan on saatava jotakin nopeaa hiilihydraattia, sokerivettä, makeisia tai glukagonitabletti. Hypoglykemia on hengenvaarallinen tila, jossa potilas tarvitsee nopeasti lääkärin apua.

Ilman asianmukaista hoitoa hiilihydraateilla tai glukagonilla hypoglykemia voi aiheuttaa:

  • kohtauksia
  • tajunnan menetyksen
  • kooman

Diagnoosi

Tyypin 1 diabetes alkaa usein nopeasti ja varoittamatta. Kun oireita ilmenee, potilaan on syytä hakeutua lääkärin vastaanotolle, jotta diagnoosi varmistuu ja asianmukainen hoito voidaan aloittaa.

Esidiabetesta ja alkavaa tyypin 2 diabetesta sairastavalla ei välttämättä ole minkäänlaisia sairauteen viittaavia oireita. Aikuistyypin diabetes varmistuu verikokeilla mitattavalla glukoosilla.

Lihavien sekä muiden aikuistyypin diabeteksen riskiryhmään kuuluvien olisi hyvä tarkistuttaa veren glukoosipitoisuus säännöllisesti. Kohonneisiin glukoositasoihin on tärkeää reagoida nopeasti, koska näin taudin kehittymisen voi parhaimmillaan estää ja usein ainakin hidastaa. Testejä:

Verikokeiden tulosten perusteella tutkittavan verensokeritaso selvittää mahdollisen esidiabeteksen tai aikuistyypin diabeteksen.

Tyypin 1 diabeteksen hoitomahdollisuuksia immunosuppressiivisilla lääkkeillä tutkitaan, mutta vaikutukset ovat vielä epäselviä. Myöskään aikuistyypin diabetekseen ei tunneta parantavaa hoitoa, mutta elämäntapamuutokset ja suolen ohitusleikkaus voivat kääntää taudin suunnan ja johtaa remissioon.

Silputtu paprika, sipuli, valkosipuli ja chili


Kannattaisiko ketoilu?


1. Vähähiilihydraattinen ruokavalio auttaa painonpudotuksessa

Rasvan muuttaminen energiaksi edellyttää enemmän työtä kuin hiilihydraattien käyttäminen energiaksi. Kun elimistölle ei tarjota helppoa energiaa hiilihydraattien muodossa, elimistön on turvauduttava rasvavarastoihin. Tämä nopeuttaa laihtumista. Rasva myös pitää kylläisenä, mikä vähentää kokonaisenergian saantia. Brasilialaistutkimus osoitti, että vähän hiilihydraatteja sisältävä ruokavalio on kaloreita rajoittamista tehokkaampi laihduttamisessa:

”The role of very-low-carbohydrate ketogenic diets (VLCKD) in the long-term management of obesity is not well established. The present meta-analysis aimed to investigate whether individuals assigned to a VLCKD (i.e. a diet with no more than 50 g carbohydrates/d) achieve better long-term body weight and cardiovascular risk factor management when compared with individuals assigned to a conventional low-fat diet (LFD; i.e. a restricted-energy diet with less than 30% of energy from fat). Through August 2012, MEDLINE, CENTRAL, ScienceDirect,Scopus, LILACS, SciELO, ClinicalTrials.gov and grey literature databases were searched, using no date or language restrictions, for randomised controlled trials that assigned adults to a VLCKD or a LFD, with 12 months or more of follow-up. The primary outcome was bodyweight. The secondary outcomes were TAG, HDL-cholesterol (HDL-C), LDL-cholesterol (LDL-C), systolic and diastolic blood pressure,glucose, insulin, HbA1c and C-reactive protein levels. A total of thirteen studies met the inclusion/exclusion criteria. In the overall analysis,five outcomes revealed significant results. Individuals assigned to a VLCKD showed decreased body weight (weighted mean difference -0·91 (95% CI -1·65, -0·17) kg, 1415 patients), TAG (weighted mean difference -0·18 (95% CI -0·27, -0·08) mmol/l, 1258 patients) and diastolic blood pressure (weighted mean difference -1·43 (95% CI -2·49, -0·37) mmHg, 1298 patients) while increased HDL-C(weighted mean difference 0·09 (95% CI 0·06, 0·12) mmol/l, 1257 patients) and LDL-C (weighted mean difference 0·12 (95% CI 0·04,0·2) mmol/l, 1255 patients). Individuals assigned to a VLCKD achieve a greater weight loss than those assigned to a LFD in the longterm; hence, a VLCKD may be an alternative tool against obesity.”

2. LCHF voi suojata aivoja

Joidenkin tutkimusten mukaan ketoilu suojaa aivoja mm. ikääntymiseen liittyviltä muistisairauksilta kuten dementialta ja Alzheimerin taudilta sekä neurodegeneratiiviselta Parkinsonin taudilta. Kirjoitin aiemmin tutkimuksesta, jonka mukaan vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio voi vaikuttaa suotuisasti etenevään multippeliskleroosiin. Tutkimuksia tarvitaan enemmän. On kuitenkin viitteitä siitä, että ketogeenisellä ruokavaliolla on aivojen hyvinvointia suojaavia ominaisuuksia. Tutkimuksissa on havaittu, että ketogeeninen ruokavalio parantaa unen laatua ja lisää lasten tarkkaavaisuutta ja oppimiskykyä. Kyllä vain. En keksinyt omasta päästäni. Lue tästä.

Entä se diabetes ja ketoilu?

Ketogeeninen LCHF-ruokavalio auttaa aikuistyypin diabetesta sairastavaa ylläpitämään terveitä verensokeritasoja.

Hiilihydraatit kohottavat veren glukoosipitoisuutta enemmän kuin muut ruoat ja sen vuoksi haiman on eritettävä vereen enemmän insuliinia.

Hiilihydraattien vähentäminen auttaa tasapainottamaan veren glukoositasot ja estämään verensokerin suuria heilahduksia. LCHF ruokavalio laihduttaa ja vaikuttaa myös elimistön hiljaista tulehdusta (inflammaatio) hillitsevästi.

Tästä huolimatta LCHF ei ole yksinkertaisesti helvetin hyvä ruokavalio. Se voi helposti johtaa välttämättömien vitamiinien, mineraalien, kuitujen ja antioksidanttien liian vähäiseen saantiin, mikä voi aiheuttaa monia muita terveysongelmia. Tähän jokaisen ketoilijan on syytä suhtautua riittävällä hartaudella ja vakavuudella. Välttämättömät ravintoaineet ovat välttämättömiä, koska elimistö ei toimi oikein ilman niitä.

Yleisesti ottaen erittäin vähän hiilihydraatteja sisältävä ruokavalio sisältää vain 10-50 grammaa hiilihydraatteja vuorokaudessa, vähän hiilihydraatteja sisältävä ruokavalio on sellainen, jossa hiilihydraattien saanti rajoitetaan 50-100 grammaan päivässä ja kohtuullisesti hiilihydraatteja sisältävä ruokavalio sisältää 100-225 g hiilihydraatteja päivässä. Nämä ovat lukuja ja luvut ovat abstrakteja. Ihmisten tarpeet vaihtelevat ja omaa kehoa on syytä kuunnella tarkasti. Ilman varavarjoa ei pidä hypätä tuntemattomaan. On ihan järkevää ensin selvittää mistä on kyse ja millaisia mahdollisia riskejä radikaaliin ruokavaliomuutokseen voi liittyä.

Eräs varteenotettava vaihtoehto on laskea päivittäistä hiilihydraattien saantia tasaisesti ja seurata samalla millaisia vaikutuksia hiilihydraattien vähentämisellä on veren glukoositasoihin, verenpaineeseen, painoon, yleiseen jaksamiseen jne. Tällaiseen päästään pienillä muutoksilla. Lisätyistä sokereista, valkoisista jauhoista, makeisista, virvoitusjuomista, mehuista yms. on helppo luopua, eikä se edellytä radikaalia elämäntapamuutosta. Leivän voi korvata täysjyväleivällä, pastan ja riisin täysjyväversioilla ja runsaasti tärkkelystä sisältäviä perunoita voi vähentää.

Mitä sitten saa syödä ja mitä ei?

Tästä vallitsee lukemattomia koulukuntia ja jokainen on aivan ehdottomasti omasta mielestään täysin oikeassa. Viime aikoina LCHF-skeneen on liittynyt virallisia ravitsemussuosituksia painottavia virallis-vähähiilihydraattisia tendenssejä.  Eli hiilihydraattien rajoittamisen ohella kehotetaan myös välttämään rasvoja ja suosimaan rasvattomia lihoja. Ei kai siitä haittaa ole, mutta LCHF-ruokavalio lähtee ajatuksesta, että hiilihydraateista saatava energia korvataan rasvasta saatavalla energialla. Siihen ei vähärasvaiset tuotteet sovi.

  • sallittuja vihanneksia (kaalit, parsa, vihreät lehtivihannekset, kesäkurpitsa, tomaatit, paprika jne.)
  • esimerkiksi liha, kana, kala, pähkinät,
  • virallisesti suositellaan rasvoiksi margariinia, oliiviöljyä, rypsiöljyä, mutta minä syön myös voita
  • chia-siemenet (kuituja, proteiinia ja hyviä rasvoja)
  • lanttu

Ruokavalion tavoitteista riippuen hedelmiä voi syödä niukasti. Hedelmät sisältävät sokeria, mutta myös monia kehon tarvitsemia ravintoaineita hyvässä muodossa. Hedelmä on kuitenkin terveellisempi vaihtoehto kuin makeiset.

Ruokavaliossa tulisi välttää:

  • valmisruokia ja suolaisia snacksejä
  • runsaasti sokeria sisältäviä herkkuja: kakkuja, makeisia, leivoksia, keksejä, virvoitusjuomia, mehuja
  • tärkkelystä sisältäviä vihanneksia: peruna, maissi, riisi
  • olutta ja alkoholia, mutta erityisesti olutta ja sokeria sisältäviä alkoholeja
  • valkoista pastaa

Täysjyväleivät, linssit ja pavut sisältävät runsaasti hiilihydraatteja, mutta ruokavalion tavoitteista riippuen niitä voi satunnaisesti syödä niiden sisältämien tärkeiden ravintoaineiden vuoksi.


Kuinka hiilihydraatit vaikuttavat diabetekseen?


Vähähiilihydraattinen ruokavalio on eräs tehokkaimmista tavoista hallita verensokeria aikuistyypin diabeteksessa. Insuliiniresistenteillä ihmisillä veren glukoositasot voivat pysyä korkeina tunteja syömisen jälkeen. Runsaasti hiilihydraatteja sisältävä ruoka ei pidä kylläisenä, vaan ruokahalu palaa pian, vaikka elimistöllä ei olisi energiantarvetta. Tämä johtaa helposti naposteluun ja lihomiseen. Lue tästä.

LCHF

  • lisää energiaa, tarkkaivaisuutta ja parantaa unenlaatua
  • laskee veren keskimääräistä glukoositasoa ja HbA1c-tasoja
  • vähentää napostelua ja makeanhimoa
  • pienentää hypoglykemian riskiä
  • auttaa pudottomaan painoa tehokkaasti ja ilman nälkää
  • laskee diabetekseen liittyvien komplikaatioiden riskiä
  • laskee kolesterolia

Ketoosi on normaali aineenvaihduntaprosessi. Kun elimistöllä ei ole riittävästi glukoosia solujen energian tuotantoon, aineenvaihdunta turvautuu varastorasvoihin, joista valmistetaan energiantuotantoon kelpaavia ketoaineita.

Ketogeenisellä ruokavaliolla (kuten Atkinsin ruokavalio) tavoitellaan ketoosia, jossa keho pakotetaan käyttämään läskiä polttoaineena. Hiilihydraatit ovat elimistön tärkein polttoaine, koska olemme opettaneet kehon käyttämään hiilihydraatteja energianlähteenä.

Elimistö osaa kuitenkin tuottaa energiaa varastoimastaan rasvasta. Se on oikeastaan rasvan keräämisen eli lihomisen tärkein pointti: rasva on varastoenergiaa.

Elimistö käyttää varastoenergiaa sitten, kun helppoja hiilihydraatteja ei ole saatavilla. Niin pitkään, kun elimistöä hemmotellaan herkullisilla sokereilla, rasvasolujen purkaminen energiaksi ei pääse alkamaan. Oleellista on veren insuliinipitoisuus. Kun veressä on insuliinia, glukagonia ei vapaudu. Glukagoni kuitenkin on välttämätön hormoni sokeri- ja rasvavarastojen purkamisessa. Vasta kun glukoosi loppuu ja insuliinin määrä laskee, glukagoni aloittaa rasvan muuttamisen energianlähteeksi kelpaavaan muotoon.

Käytännössä myös kaloreita rajoittamalla (vähärasvaisella) ruokavaliolla päästään samaan, mutta siinä hiilihydraateilla ”tekohengitetään” sokeripolttoista konetta, joten laihtuminen on ensimmäisten kuukausien aikana hitaampaa, ja nälkä sekä ruokaan liittyvät mielihalut suurempia. Myös vähärasvainen ruokavalio pakottaa elimistön turvautumaan varastorasvoihin, mutta hitaammin, koska helppoa glukoosia tarjotaan kokoa ajan.

Totesin aiemmin, että ketogeeninen ruokavalio ei ole suositeltava tyypin 1 diabetesta sairastaville. Ketoasidoosin riski siinä on suurempi kuin terveillä ja tyypin 2 diabetesta sairastavilla.

Tyypin 1 diabetesta sairastavat voivat hieman vähentää hiilihydraattien saantia välttääkseen verensokerin piikkejä, mutta vähähiilihydraattisella ruokavaliolla ei kannata leikkiä. Diabetes on hyvin vakava sairaus ja hiilihydraatit tyypin 1 diabeteksessa voivat olla elämän ja kuoleman asia.

Ketoosi

  • Ketoosi käynnistyy, kun elimistöllä ei ole riittävästi glukoosia solujen energiantuotantoon
  • Ketoosissa varastorasvoja muutetaan solujen energianlähteeksi kelpaaviksi ketoaineiksi
  • Ketoaineet ovat happoja ja niiden lisääntyminen lisää veren happamuutta
  • Hallitsematon ketoosi tyypin 1 diabetesta sairastavilla voi johtaa ketoasidoosiin eli happomyrkytykseen, joka on diabetesta sairastavalle hengenvaarallinen tila.

Onko LCHF sitten terveellistä?

On ja ei ole. Jos ketogeeniseen ruokavalioon saa lisättyä välttämättömät ravintoaineet, kuituja ja antioksidantteja, ketogeeninen ruokavalio voi olla hyvin terveellinen. Jos ruokavaliosta karsii kaikki kasvikset ja syö vain rasvaa ja proteiineja, se ei ole pidemmän päälle hyväksi. LCHF saattaa vaikuttaa suotuisasti esimerkiksi:

  • sydän- ja verisuonitauteihin
  • diabetekseen
  • metaboliseen oireyhtymään
  • aivojen terveyteen
  • kolesteroliarvoihin
  • verensokeriarvoihin
  • verenpaineeseen

Terveyshyödyt ovat seurausta terveellisempien ruokavalintojen, laihtumisen ja elimistön hiljaisen tulehduksen helpottamisen yhteisvaikutuksesta. Kuitujen ja hyvien rasvojen lähteeksi suosittelen esimerkiksi chia-siemeniä.

Ketogeenistä ruokavaliota hyödynnetään lääkärin valvonnassa epilepsiaa sairastavien lasten hoidossa, sillä se vähentää sellaisten lasten epileptisiä kohtauksia, joilla muista hoidoista ja lääkkeistä ei ole apua. On jonkin verran tutkimusnäyttöä myös siitä, että aikuiset epileptikot hyötyvät ketogeenisen ruokavalion noudattamisesta, mutta tämä edellyttää laajempia ja kattavampia tutkimuksia.

Ketoosi ja diabetes

Diabeetikoilla ketoosi kertoo siitä, että veressä ei ole riittävästi insuliinia glukoosin prosessoimiseen. Virtsanäytteen ketoaineet kertovat, että potilaan diabetes-hoidot eivät pure toivotulla tavalla.

Tyypin 2 diabetesta (non-insulin dependent diabetes eli NIDDM) sairastaville voidaan suositella ketogeenistä ruokavaliota. Heillä haima tuottaa yhä jonkin verran insuliinia, mutta solut eivät pysty hyödyntämään insuliinia tehokkaasti sokeriaineenvaihdunnassa.

Ketogeenisessä ruokavaliossa ravinnon sisältämien hiilihydraattien määrää vähennetään. Hiilihydraattien vähentämisen tarkoitus on laskea veren glukoositasoja. Kaikki hiilihydraatit muutetaan glukoosiksi tai tuhansista glukoosimolekyyleistä muodostuviksi glykogeeneiksi. Hiilihydraatit siis kohottavat veren sokeripitoisuutta.

Ketogeenistä ruokavaliota noudattavien diabeetikkojen on seurattava tunnollisesti veren ketoaineiden tasoja. Jos ketoaineiden määrä nousee liian korkeaksi, seurauksena voi olla ketoasidoosi.

Ketoosissa ketoaineiden määrä on noin kymmenesosa ketoasidoosiin verrattuna. Tyypin 1 diabetesta sairastavien riski saada ketoasidoosi on merkittävästi suurempi kuin tyypin 2 diabetesta sairastavilla.

Ketoasidoosi

Ketoasidoosissa veren ketoaineiden määrät nousevat poikkeuksellisen korkeiksi ja myrkyttävät elimistöä. Tämä on äärimmäisen vakava tila, joka diabeetikoilla edellyttää lääkärin hoitoa.

Ketoasidoosin voi laukaista useampikin tekijä. Usein siihen vaikuttaa jokin sairaus ja sen seurauksena häiriintynyt hormonien tuotanto, jolloin insuliinin vastavaikuttajia voi muodostua normaalia enemmän.

Ketoasidoosi voi myös aiheutua liian vähäisestä insuliinilääkityksestä tai

  • huumeiden käytön
  • stressin
  • fyysisen vamman
  • leikkauksen

seurauksena. Ketoasidoosi on selvästi yleisempi tyypin 1 diabetesta sairastavilla, koska näillä haima ei tuota insuliinia.

Ketoasidoosin varhaisia oireita ovat:

  • vatsakipu
  • sekavuus ja keskittymisvaikeudet
  • kuiva ja punoittava iho
  • kova jano ja kuiva suu
  • makeahkolta tai hedelmäiseltä haiseva hengitys
  • lisääntynyt virtsaamistarve
  • pahoinvointi ja oksentelu
  • hengen ahdistus, nopea hengitys

Esidiabetes: Mitä syödä ja mitä vältellä?

Diabeteksen ehkäisyyn tähtäävä ohjelma (Diabetes Prevention Program) on osoittanut, että laihtuminen laskee diabeteksen riskiä 16 % jokaista vuodessa laihdutettua painokiloa kohden.

Perinteisesti esidiabetekseen sairastuneita kehotetaan syömään vähärasvaisia, vähäkalorisia ja runsaasti kuituja sisältäviä ruokia. Onko sellainen hyvä ruokavalio? Ravinnosta saadun kokonaisenergian vähentäminen laihduttaa ja ylläpitää kyllä terveyttä.

Jo muutaman kilon karistaminen elopainosta laskee huomattavasti diabeteksen riskiä. Vuonna 2001 julkaistu suomalainen diabeteksen ehkäisytutkimus osoitti, miten esidiabetes-vaiheessa diabeteksen syntyä voidaan ehkäistä. Tutkimuksessa seurattiin 500 esidiabetes-diagnosoitua lihavaa henkilöä. Puolet heistä sai ohjausta- ravinto ja liikuntatottumuksiin ja puolet toimi vertailuryhmänä. Koeryhmän tavoitteina oli: 5 prosentin painonpudotus, ruoan rasvan vähentäminen (alle 30 prosenttiin päivittäisestä energiasta), kovien rasvojen välttäminen ja vähärasvaisten tuotteiden suosiminen, ravinnon kuitujen lisääminen (täysjyväviljat) ja kohtuullinen liikkuminen (esim. puolen tunnin kävelylenkki päivittäin). Vuoden seurannan jälkeen koeryhmä oli laihtunut 4 kiloa enemmän kuin vertailuryhmä. Neljän vuoden seurannan jälkeen diabetes todettiin koeryhmässä 11:lla ja vertailuryhmässä 23:lla.

Esidiabetes ja diabetes

Terveillä paaston verensokeri on aamulla vähintään 8 tunnin syömättömyyden jälkeen alle 6 mmol/l tasolla, eikä verensokeri nouse laboratoriossa tehtävässä sokerirasitustestissä yli 7,7 mmol/l.

Esidiabeteksessa aamun paastoverensokeri on välillä 6,1-6,9 mmol/l tai kun verensokeri nousee sokerirasitustestissä välille 7,8-11,0 mmol/l.

Diabeteksessa paaston verensokeri (IP-gluc) on aamulla 7 mmol/l tai korkeampi kahtena eri päivänä tai verensokeri sokerirasitustestissä ylittää arvon 11,0 mmol.

Niin kutsuttu ”pitkäaikaissokeri” voidaan mitata verinäytteestä määrittämällä veren punasolujen hemoglobiinin sokeroituminen sokerihemoglobiini- eli HBA1c-kokeessa. Tämä kuvaa noin parin kuukauden verensokeritasoa. Jos HBA-1c on yli 48 mmol/mol, todetaan diabetes.

Glykeeminen indeksi ja glykeeminen kuorma

Glykeeminen indeksi (GI) kuvaa ruoka-aineen imeytyvien hiilihydraattien aiheuttamaa muutosta verensokerissa verrattuna referenssiruoka-aineeseen. Tällä pyritään seuraamaan hiilihydraattien imeytymisnopeutta. Suuri GGI tarkoittaa sitä, että verensokeri nousee nopeasti ja vereen vapautuu paljon insuliinia. Pieni GI kertoo hiilihydraatin tasaisemmasta imeytymisestä ja vähäisemmästä vaikutuksesta verensokeriin. Korkean glykeemisen indeksin elintarvikkeita ovat mm. perunat, valkoinen riisi, leipä, keksit, makeiset, sokeri jne.

Verensokeria säätelee monet tekijät. Elimistö pyrkii ylläpitämään tasaista verensokeria sillä, että maksan glykogeeneista vapautuu glukagonin vaikutuksesta glukoosia verenkiertoon aterioiden välillä. Syöminen kohottaa verensokeria, jolloin haimasta vapautuu insuliinia verenkiertoon. Insuliini pysäyttää maksan glykogeenien purkamisen ja käynnistää sokerivarastojen täydentämisen.

GI-taulukko (100 kuvaa suurinta vaikutusta verensokeriin. GI 0 ei vaikuta verensokeriin)

Ruoka-aine GI Ruoka-aineen määrä, joka
sisältää 50 g hiilihydraattia
Hiilihydraattien määrä
100 g:ssa ruoka-ainetta
GK/ 100 g ruoka-ainetta
A                   
Ananas 81 462 11 9
Appelsiini 58 545 9 5
Appelsiinimehu 63 481 10 6
B
Banaani 72 250 20 14
Bataatti 77 268 19 15
C
Cashewpähkinät 30 192 26 8
Cornflakes 112 58 87 97
Croissant (voisarvi) 92 110 46 43
D
Dextrosol-rypälesokeri 146 55 91 133
G
Greippi 35 545 9 3
Greippimehu 66 625 8 5
H
Hapanleipä, ruis- 83 100 50 42
Hedelmäsokeri (fruktoosi) 26 50 100 26
Herneet, tuoreet 66 571 9 6
Hunaja 76 69 72 55
J
Jogurtti, kevyt,
hedelmiä ja sokeria
46 323 16 7
K
Kaali 99 750 7 7
Kauralese 76 100 12 9
Kauraryynipuuro 80 568 9 7
Kiivi 73 500 10 7
Kikherneet 39 250 20 8
Kirsikka 30 500 10 3
Ksylitoli 11 50 100 11
Kurpitsa keitetty 104 1000 5 5
Kuskus 90 431 12 11
L
Laktoosi 63 50 100 63
Lanttu 99 750 7 7
Leipä, hampurilais- 84 100 50 42
Leipä, täysjyväruis- 80 107 47 38
Linssit, punaiset 36 417 12 4
Linssit, vihreät 41 441 11 5
Luumu 54 500 10 5
M
Maapähkinät 19 417 12 2
Maissi, pakaste 67 270 18 67
Maissi, tuore 73 234 21 15
Maito, 0,5 % 44 962 5 2
Maito, 0,1 % 44 962 5 2
Makaronit 65 188 27 18
Mango 70 353 14 10
Mansikat 55 2000 3 2
N
Nektari 94 500 10 9
Nuudelit, mungopapu- 46 200 25 11
Nuudelit, pika- 65 225 22 14
Nuudelit, riisi- 84 231 22 19
Näkkileipä 95 63 79 75
O
Ohraleipä, täysjyvä- 39-66 100 50 20-33
Omena 52 400 13 7
Omenamehu 55 431 12 7
P
Pannukakut 92 69 73 67
Papaija 81 353 14 11
Patonki 131 100 50 66
Pavut, kidney- 39 300 17 7
Pavut, säilykekidney- 72 441 11 8
Pavut, mung- 43 441 11 5
Pavut, idätetyt mung- 35 441 11 4
Pavut, musta- 28 300 17 5
Pavut, mustasilmä- 58 250 20 12
Pavut, pinto- 54 288 17 9
Pavut, ruskeat 33 100 50 17
Pavut, soija- 25 1250 4 1
Pavut, säilykesoija- 19 1250 4 1
Pavut, valkoiset,
tomaattikastikkeessa
66 500 10 7
Pavut, vihreät 52 242 21 11
Persikka 58 545 9 5
Persikka, säilyke sokeriliemessä 79 353 14 11
Peruna, keitetty, jauhoinen 90 300 17 15
Peruna, keitetty, kiinteä 80 300 17 14
Peruna, raaka 79 357 14 11
Perunamuusi 102 375 13 13
Porkkana, keitetty 80 667 8 6
Porkkana, raaka 22 500 10 2
Porkkanamehu 59 543 9 5
Popcorn 99 91 55 55
Punajuuri 88 571 9 8
Päärynä 52 545 9 5
R
Ranskalaiset perunat 104 259 19 20
Riisi, basmati- 80 197 25 20
Riisi, esikeitetty 65 208 24 16
Riisi, jasmin- 150 179 28 42
Riisikakut 126 60 83 104
Ruisleipä, kokojyvä- 69 125 40 28
Ruisleipä, pellavansiemenillä 57 78 100 50
Ruisleipä, täysjyvä- 89 100 50 45
Rusinat 88 68 73 64
Rypäleet 63 333 15 10
Rypälesokeri (glukoosi) 138 50 100 138
S
Soijamaito, kevyt- 61 735 7 4
Soijamaito, täys- 55 694 7 4
Sokeri 94 50 100 94
Spagetti, keitetty 10 – 15 min. 59 188 27 16
Spagetti, täysjyvä- 51 214 23 12
Sushi 72 135 37 27
T
Taatelit, kuivatut 142 75 67 95
Tattari 75 205 20 15
Tomaattimehu 52 1389 4 2
U
Uuniperuna 117 250 20 23
V
Vesimeloni 99 1000 5 5
Viikunat, kuivatut 84 15 43 36
Viili 15 136 4 1
Viinimarjat 30 500 10 3
Vohvelit 105 135 37 39

Taulukon lähde: Keittotaito

Glykeeminen indeksi on hyödyllinen työkalu hiilihydraattien ja niiden vaikutusten arviointiin. Esidiabetesta ja diabetesta sairastavien on tärkeää seurata hiilihydraattien määrää ja laatua. Mitä korkeampi GI, sitä nopeammin hiilihydraatit nostavat verensokeria.

Glykeeminen kuorma (glycemic load /GL)

Glykeeminen kuorma määrittelee ravinnon sisältämien hiilihydraattien laatua ja määrää. Sitä voidaan hyödyntää, kun lasketaan aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen. Pelkkä GI ei kerro koko totuutta. Vähäisellä määrällä korkean GI-arvon ruokia ei ole suurta vaikutusta verensokeriin, ja siksi on tärkeämpää arvioida koko aterian vaikutusta verensokeriin ja insuliinivasteeseen eli glykeemista kuormaa. GL lasketaan seuraavasti:

GI x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa arvioitaessa lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Mitä tämä tarkoittaa?

Täysjyväviljat ja runsaasti kuitua sisältävät ravintoaineet imeytyvät ruoansulatuskanavasta verenkiertoon hitaammin kuin ”nopeat hiilihydraatit”. Elimistö prosessoi sokerit ja raffinoidut hiilihydraatit nopeasti. Se kohottaa verensokerin nopeasti.

Korkea verensokeri ja happomyrkytys

Korkea verensokeri eli hyperglykemia aiheuttaa yleensä väsymystä, janon tunnetta, lisääntynyttä virtsaamistarvetta, pahoinvointia ja kuivumista. Pitkään jatkuessaan korkea verensokeri lisää riskiä sairastua diabeteksen lisäsairauksiin. Korkea verensokeri on 10-13,9 mmol/l ja hyvin korkea verensokeri yli 13,9 mmol/l.

Rasvahappojen aineenvaihdunta tuottaa ketoaineita, eli beetahydroksivoihappoa, asetetikkahappoa ja asetonia. Näiden määrä kasvaa elimistössä paastotilassa ja insuliininpuutoksen seurauksena. Ketoaineiden tuotanto on elimistön luontainen prosessi, mutta diabeetikoilla insuliinin puute voi johtaa elimistön happamoitumiseen ja happomyrkytykseen eli ketoasidoosiin, joka diabeetikoilla voi olla hengenvaarallinen tila. Ketoosi ja ketoasidoosi ovat kaksi eri asiaa.

Esidiabetesta sairastavien on tärkeää välttää sokeripiikkejä.

  • ruoat, joiden GI on 55 tai vähemmän, nostavat verensokeria hitaasti
  • ruoat, joiden GI on 56-69, kohottavat verensokeri keskinopeasti
  • ruoat, joiden GI on 70 tai suurempi, nostavat verensokeria nopeasti
  • Puhtaiden (raffinoitujen) sokereiden GI on yleensä korkeampi kuin luonnollisia sokereita sisältävien elintarvikkeiden, kuten hedelmien GI.
  • Täysjyväviljojen GI on matalampi kuin raffinoitujenviljojen GI.
  • Bataattien, useimpien vihannesten ja palkokasvien GI on pienempi kuin tärkkelystä sisältävien perunoiden ja maissin GI.
  • Hedelmien kypsyminen lisää hedelmän sokeripitoisuutta ja GI-arvoa.
  • Pastojen tärkkelyssidokset voivat olla sellaisia, että niillä on matalahko GI.
  • Esikiehautetun (parboiled) riisin, basmati-riisin ja täysjyväriisin GI on pienempi kuin lyhytjyväisten puuroriisien ja jasmiiniriisin GI.

Hiilihydraattien laskeminen

Hiilihydraattimäärien laskeminen voi helpottaa ruokavalion seuraamista. Hiilihydraattien täydellinen poistaminen ruokavaliosta ei ole suositeltavaa, sillä monet hiilihydraatteja sisältävät vihannekset sisältävät tärkeitä terveyttä ylläpitäviä ravintoaineita.

Toisaalta monet vähän hiilihydraatteja sisältävät ravintoaineet voivat korvata runsaasti hiilihydraatteja sisältävät ravintoaineet.

Esimerkiksi:

Seuraavat ruoat sisältävät runsaasti tärkkelystä eli hiilihydraatteja:

  • perunat
  • pavut ja linssit
  • riisi
  • viljat
  • maissi

Paljon hiilihydraatteja sisältävät kasvikset voi korvata mm. seuraavilla ravinne- ja kuitupitoisilla vähän hiilihydraatteja sisältävillä kasviksilla:

  • parsa
  • parsakaali
  • porkkanat (vähän)
  • selleri
  • vihreät pavut
  • salaatit ja tummanvihreät lehtivihannekset
  • paprika
  • pinaatti
  • tomaatti
  • kesäkurpitsa

Syö tasaisin väliajoin

Esidiabetesta sairastavan tulee pitää verensokeri mahdollisimman tasaisena.

Paastoaminen voi vaikuttaa merkittävästi verensokeritasoihin, joten pienet matalan- tai keskitason GI-arvon omaavat ruoat tasaisesti pitkin päivää pitävät verensokerin tasaisena ilman suuria piikkejä.

Asiantuntijat suosittelevat:

  • syömään kolmesti päivässä. Aterioiden välillä ei tulisi olla yli 6 tunnin jaksoa.
  • syömään tasapainoisesti ravinteiltaan rikasta, sopivassa suhteessa hiilihydraatteja, rasvoja ja proteiineja sisältävää ruokaa

Lautasmalli

Yksi tapa syödä terveellisesti ja tasapainoisesti on ns. lautasmalli, jota Yhdysvalloissa suosittelee paikallinen Diabetesliitto. Siinä puolet lautasesta täytetään vihanneksilla, neljännes proteiinia sisältävillä ruoka-aineilla ja neljännes hiilihydraateilla, kuten ruskealla riisillä tai kvinoalla.

Lautasmallissa jokaisen aterian tulee sisältää kolmea seuraavista neljästä ruoka-aineryhmästä.

  • hedelmä tai vihannekset
  • täysjyväviljat
  • maito- ja meijerituotteet
  • liha, kala, palkokasvit, linssit tms.

Laihtumisessa auttaa terveellisen ruokavalion lisäksi pienempi lautanen ja se, että välttää santsaamista ja ähkyksi syömistä.

DASH-dieetti

DASH on laajalti suositeltu ja terveelliseksi todettu ruokavalio. Sen tiedetään laskevan verenpainetta, mutta se voi myös ehkäistä diabetesta seuraamalla yhtäältä hiilihydraattien saantia ja toisaalta ravintoaineiden glykeemistä indeksiä.

DASH ei perustu kaloreiden vähentämiseen, vaan terveellisiin valintoihin.

DASH suosittelee syömään:

  • vihanneksia
  • hedelmiä
  • täysjyväviljoja
  • rasvattomia tai vähärasvaisia meijerituotteita
  • kalaa
  • siipikarjaa
  • papuja
  • pähkinöitä
  • kasvisöljyjä

Vältettäviä ruokia DASH-ruokavaliossa ovat esimerkiksi:

  • rasvaiset lihat
  • täysirasvaiset meijerituotteet
  • trooppiset öljyt, kuten kookosöljy ja palmuöljy
  • makeiset
  • vaaleat leivät
  • leivonnaiset, snacksit, keksit
  • makeat juomat

Pahoittelut, jos tekstiin jäi ylettömästi toistoa, asia- ja/tai kirjoitusvirheitä. Siinä oli tiistain ja keskiviikon välisen yön anti Ruokasodalle. Ehkä tuosta jotain oppi. Jokseenkin noin homma toimii ketogeenisen ruokavalion ja diabeteksen kanssa, mutta toki asioita  voi käsitellä toisesta näkövinkkelistä ja laajemminkin.

Ravitsemuksen osalta konsensuksen löytäminen on mahdotonta. Todetaan siis sama, mitä totesin aiemmin: On monta tapaa syödä oikein ja monta tapaa syödä väärin.

Kuvat: Pixabay tai ja huonommat kuvat ovat omia




Ketoherkut: Lassaka

Lassaka on vähähiilihydraattinen ja ihanan rasvainen ketoherkku. Ruoka on lasagnen ja moussakan kesäkurpitsapohjainen variaatio. Lassaka maistuu myös useimmille ketoilua vierastaville. Tästä on olemassa monenlaisia versioita. Tämä on yksi:


Raaka-aineet


Kesäkurpitsa
Sipuli
Valkosipuli
Chili
Paprika
Jauheliha
Kerma
Tomaattipyre tai -murska
Mozzarella tai Emmental-raaste
Suola, pippuri, oregano


Ohje


Viipaloi ja itketä kesäkurpitsat. Itkettäminen kannattaa, sillä kesäkurpitsat sisältävät niin paljon nestettä, että jos sitä ei poista, tuloksena on keitto. Eli levitä viipaloidut kesäkurpitsat liinalle ja ripottele päälle suolaa. Viipaleet kannattaa pyyhkäistä kuiviksi ennen käyttöä.


Silppua sipuli, valkosipulia (maun mukaan), chili ja puolikas paprika.


Ruskista jauheliha. Mausta suolalla ja pippurilla ja lisää silputut sipulit, valkosipulit, paprikat ja chili. Chilin voi korvata silputulla jalapenolla. Paista hetkinen ja lisää tomaattipyre tai murska. Täyte kannattaa keittää hyvin kokoon. Lopuksi täytteeseen voi lisätä reilusti oreganoa.


Perinteisen valkokastikkeen tilalla on kermasta ja mozzarellasta tehty kastike,joka maustetaan suolalla ja pippurilla. Erittäin kivan vivahteen antaa feta ja sinihomejuusto, joita voi lisätä maun mukaan kermaan.


Hifistelijöillä on varmasti jokin tiukka järjestys, jossa ainekset ladotaan uunivuokaan. Minä laitoin kolmessa kerroksessa keskurpitsaa, jauhelihatäytettä ja mozzarellakastiketta. Lopun mozzarella kerman lorottelin vuoan päälle ja lisäsin vielä reilusti juustoraastetta.

Lassakaa paistetaan 200-asteisessa uunissa 30-45 minuuttia tai kunnes juustokuorrutus on saanut kauniin kullanruskean värin.




Mitä, miten ja miksi LCHF-ruokavalio?

Mitä, miten ja miksi LCHF`Vähän hiilihydraatteja ja runsaasti rasvoja sisältävässä ruokavaliossa (LCHF) hiilihydraattien saantia korvataan hyvillä rasvoilla. LCHF-ruokavaliot (ketogeeninen ruokavalio ja Atkinsin dieetti) ovat suosittuja etenkin laihduttajien keskuudessa, sillä ne laihduttavat nopeasti ja tehokkaasti.

Vähän hiilihydraatteja sisältävässä ruokavaliossa elimistö opetetaan käyttämään energianlähteenä sekä ravinnosta saatua että rasvasoluihin varastoitua rasvaa, josta aineenvaihdunta valmistaa energiaravinteiksi kelpaavia ketoaineita.

Lääketieteellisesti suhtautuminen LCHF-dieetteihin on hyvin kaksijakoinen. Perinteisemmän rasvateorian mukaan rasvat ovat syypäitä lähes kaikkiin terveysongelmiin ja kaikkiin maailman muihinkin ongelmiin nälänhädästä Antti Rinteen hallitukseen.

Kasvavan tutkimusaineisto haastaa perinteiset ja fakkiutuneet opit rasvojen haitallisuudesta. Yleistä tieteellistä konsensusta rasvojen terveyshaitoista ja -hyödyistä ei kuitenkaan vallitse.


Miten noin niin kuin aikuisten oikeasti? Kannattaako ketoilu?


Täällä Ruokasodan ketonurkkauksessa haluan tarjota objektiivisen ja kattavan kuvan ketogeenisistä ruokavalioista, Atkinsin dieetistä ja muista pahamaineisista moraalia ja terveyttä turmelevista LCHF-ruokavalioista. Yritän tarjota terveellisiä LCHF-reseptejä ja vinkkejä ketoiluun. Katsotaan kuin tämä etenee.

Lähdin tähän seikkailuun 02.12.2019. Aiemmat kokemukseni vähähiilihydraattisesta ruokavaliosta olivat hyvin rohkaisevia, mutta niistä on jo vuosia. Sen jälkeen vyötärönympärys on harpannut kolme paitakokoa ja paino 20 kiloa. Tervetuloa mukaan!

Asetun itse ruokavalion keskiöön koekaniiniksi. Kommentoin ketonurkkauksessa viimeaikaista keskustelua ketogeeenisten ruokavalioiden ympärillä, tuoreita tutkimuksia ja uutisia sekä omia havaintojani. Lähtöpainoni on 92 kg ja vyötärölihavuus alkaa olla hengenvaarallisella tasolla. Lisäksi sairastan etenevää multippeliskleroosia, mikä vaikuttaa fyysiseen aktiivisuuteen sitomalla minut käytännössä tuoliin. Tavoitepainoni on 72 kg. Verenpaineeni ovat nyt riskirajoilla (keskimäärin 80-90 alapaine ja yläpaine 135-150 tasolla).

Vähän hiilihydraatteja, mutta runsaasti rasvaa ja proteiineja sisältävä ruokavalio ylläpitää kylläisyyden tunnetta hiilihydraatteja paremmin. Tämän seurauksena ravinnosta saatu kokonaisenergia yleensä laskee, mikä edistää laihtumista. Kaikissa ruokavalioissa on kuitenkin muistettava turvata välttämättömien ravintoaineiden saanti. Se on terveyden kannalta olennaista.

Laihtumisen lisäksi LCHF-dieetti auttaa ylläpitämään terveyttä, kuten European Journal of Clinical Nutrition kertoo katsauksessaan. Tuoreiden tutkimusten valossa LCHF-ruokavaliolla on suotuisia vaikutuksia

  • aikuistyypin diabetekseen
  • eräisiin syöpiin
  • munasarjojen monirakkulaoireyhtymään (PCOS)
  • Alzheimerin tautiin
  • sydämen terveydelle
  • etenevään multippeliskleroosiin

Varoituksen sana on paikallaan: tutkimukset ovat antaneet ristiriitaisia tuloksia LCHF-ruokavalioiden terveysvaikutuksista. Vähän hiilihydraatteja, kohtuullisesti proteiineja ja runsaasti rasvoja sisältävien ruokavalioiden pitkäaikaisvaikutuksia ei vielä tunneta.

Lääketieteellisessä Lancet-julkaisussa esitetyn tutkimuksen mukaan LCHF lisää kuolleisuutta kaikkiin syihin, mutta sama ilmiö toteutuu U-käyrän toisessa päässä; myös eniten hiilihydraatteja syövien kuolleisuus kasvaa saman tutkimuksen perusteella verrokkeihin nähden. Mistä tällainen voisi johtua?

On luultavaa ja jopa todennäköistä, että molemmissa ääripäissä ruokavalion yksipuolisuuden vuoksi syntyy puutoksia välttämättömistä ravintoaineista. Erään toisen tutkimuksen mukaan terveyden kannalta tärkeintä ei ole se, kuinka monta pizzaa tai hampurilaista syö, vaan se, että samalla saa kaikki välttämättömät ravintoaineet. Välttämättömien ravintoaineiden merkitystä terveydelle ei voi korostaa liikaa.

On jännä, että varsin monille LCHF-ruokavalio on punainen vaate, joka herättää suoranaista raivoa. Samanlainen vihainen asennoituminen on havaittavissa suhtautumisesta kasvisruokaan, lihan rajoittamiseen, vegaanisuuteen ja paleo-dieetin noudattamiseen. Yhteistä kaikille näille ruokavalioille on se, että niillä pyritään ylläpitämään terveyttä. Jonkin rajatun ruokavalion noudattaminen johtaa nopeasti paljon syvällisempään ravintoaineiden ja aineenvaihdunnan ymmärtämiseen, kuin mihin raivokkaimmat ruokavalioiden vastustajat koskaan yltävät. Miksi sortua trendikkäisiin ruokavalioihin, jotka muuttuvat nopeammin kuin muoti?

En halua asettaa ruokavalioita paremmuusjärjestykseen. Useimmat niistä painottavat välttämättömien ravintoaineiden saantia ja karsivat epäterveellisiä tai elimistön kannalta turhia ravintoaineita pois. On valtavasti tutkimusnäyttöä siitä, että esimerkiksi kasvisruokavaliot ja vegaanisuus ovat oikein noudatettuina hyvin terveellisiä.


Tärkeimmät syyt miettiä mitä suuhunsa laittaa ovat


Aikuistyypin diabetes

The International Diabetes Federation arvioi maailmanlaajuisesti aikuistyypin diabetekseen sairastuneiden määräksi yli 400 miljoonaa vuonna2015. Sairastuneiden määrä lisääntyy nopeasti.

Tutkimusten mukaan Yhdysvalloissa esidiabetesta sairastaa yksi kolmesta aikuisesta ja yhdeksän kymmenestä esidiabetesta sairastavasta ei tiedä olevansa sairas ennen kuin esidiabetes pahenee diabetekseksi. Pelkästään Yhdysvalloissa aikuistyypin diabetesta sairastavia on lähemmäksi 10 % väestöstä ja joka vuosi diagnosoidaan 1,4 miljoonaa uutta sairastunutta. Yhdysvalloissa diabeteksen hoitomenot olivat 245 miljardia dollaria vuonna 2012 ja kasvavat vuosittain.

Maailmanlaajuisesti diabetes aiheutti arviolta 1,5 miljoonaa ennenaikaista kuolemantapausta vuonna 2012. Sairastuneiden määrä, hoidon hinta ja kuolleisuus lisääntyvät joka vuosi.

Tyypin 2 diabetes on elintaso- ja elintapasairaus, johon vaikuttavat mm. lihavuus (erityisesti vyötärölihavuus), ikä, vähäinen liikunta ja huonot ravitsemustottumukset. Tutkimusten mukaan LCHF-ruokavaliot pienentävät sairastumisen riskiä ja vähentävät aikuistyypin diabetesta sairastavien lääkkeiden tarvetta. Esimerkiksi Ruotsissa LCHF on aikuistyypin diabeteksen hoidossa hyväksytty ruokavalio.


Lihavuus

Lihominen on maailmanlaajuinen ongelma. Se tappaa jo enemmän ihmisiä kuin aliravitsemus. Vuoden 1975 jälkeen lihavien määrä on kolminkertaistunut. Ylipainoisia aikuisia maailman väestöstä oli vuonna 2016 yli 1,9 miljardia. Näistä 650 miljoonaa eli 39 % oli lihavia. Alle 5-vuotiaista lapsista jopa 41 miljoonaa ja 5-19-vuotiaista 340 miljoonaa oli samana vuonna ylipainoisia tai lihavia. Luvut ovat käsittämättömiä. (WHO)

WHO:n mukaan ylipainoisia ovat ihmiset, joiden BMI (painoindeksi) on 25 tai suurempi. Lihavia ovat ihmiset, joiden BMI on 30 tai suurempi.

Lihavuus on lisääntynyt dramaattisesti. Lihavien ja ylipainosten osuus lapsista oli 4 % vuonna 1975. Nyt lapsista lähes viidennes (18 %) on ylipainoisia tai lihavia. Vuonna 1975 ylipainoisten ja lihavien 5-19-vuotiaiden osuus ikäryhmässä oli vain 1 %, vuonna 2016 saman ikäisten ylipainoisten ja lihavien osuus oli ikäryhmän tytöistä 6 % ja pojista 8 %.

Lihavuus kasvattaa mm. sydän- ja verisuonitautien, metabolisen oireyhtymän, aikuistyypin diabeteksen, syöpien, luunmurtumien ja erilaisten nivel- ja selkävaivojen sekä ennenaikaisen kuoleman riskiä.


Suolistotulehdukset (ärtyvän suolen oireyhtymä eli IBS)

Ärtyvän suolen oireyhtymä (IBS) vaivaa jopa 10-15 prosenttia maailman aikuisväestöstä. IBS ei sinänsä ole hengenvaarallinen sairaus, mutta sen vaikutukset elämänlaatuun ja terveydenhoidolliset kustannukset ovat merkittäviä. IBS on suurin sairauspoissaolopäivien syy tavallisen flunssan jälkeen.

Tulehdukselliset suolistosairaudet yleistyvät nopeasti. Suomessa myös paksusuolen syöpä lisääntyy, mutta lisääntymisen syytä ei tunneta.

Crohnin tauti ja haavainen paksusuolentulehdus ovat kroonisia suoliston tulehduksellisia sairauksia, jotka oireilevat mm. ripulina, verisenä ulosteena ja vatsakipuina. Molemmat edellyttävät perinnöllisen alttiuden sairastua, mutta sairastuminen käynnistyy usein jonkin infektion (kuten turistiripulin) tai stressin seurauksena. Riskitekijöitä ovat lisäksi runsaasti eläinperäistä proteiinia sisältävä ja rasvainen ruoka sekä D-vitamiinin puutos.

Ärtyvän suolen oireyhtymää sairastaa Suomessa jo noin 300 000 henkilöä ja esiintyvyys aikuisväestössä on 10 %. Diagnosoitujen keliakiatapausten ja tulehduksellisten suolistosairauksien esiintyvyys on 1 prosentin luokkaa molempien kohdalla.

Ärtyvän suolen oireyhtymän tavallisia oireita ovat: vatsan turvotus, vatsakipu sekä ummetus- ja ripulioireet. Oireiden taustalla voi olla mm.

Tavallista herkempi vatsan alueen kipuaistimus (alhainen kipukynnys)

  • Lisääntynyt kaasun tuotto paksusuolessa ja mahdollisesti ohutsuolessa
  • Häiriöitä suoliston mikrobitasapainossa
  • Matala-asteinen tulehdus suolessa
  • Suoliston voimakas ja kivulias supistelu tai suolen toiminnan laiskistuminen


    FODMAP-hiilihydraattien (fermentoituvien hiilihydraattien) rajoittaminen helpottaa viimeaikaisen tutkimusnäytön perusteella ärtyvän suolen oireyhtymää. FODMAP-hiilihydraatit ovat kasvikunnan tuotteissa esiintyviä huonosti ohutsuolessa imeytyviä kuitumaisia hiilihydraatteja. FODMAP-hiilihydraattien huono imeytyminen ohutsuolessa päästää näitä paksusuoleen, jossa ne fermentoituvat paksusuolen mikrobien vaikutuksesta. Fermentaatio on sinänsä aivan luonnollinen ja hyvä reaktio, mutta IBS-potilailla se aiheuttaa oireita.

    Laktoosi-intoleranteilla ihmisillä oireita aiheuttaa maitotuotteet. Ksylitoli, sorbitoli, laktitoli, maltitoli, mannitoli ja isomalti, luumut ja kivelliset hedelmät, omenat, sienet, raffinoosi, inuliini, vehnä, ruis, ohra, palkokasvit, sipulit, kaalikasvit ja vesimelonit, jogurtit ja fruktoosi selittävät oireita monilla ärtyvän suolen oireyhtymää sairastavilla.

Kesäkuussa 2009 Clinical Gastroenterology and Hepatology -lehdessä julkaistun tutkimusraportin mukaan hyvin vähän hiilihydraatteja sisältävä ruokavalio helpottaa ärtyvän suolen oireyhtymän oireita. On jonkin verran tieteellistä näyttöä siitä, että suolisto-oireet helpottavat LCHF-ruokavaliolla.

Alkoholista riippumaton rasvamaksa (NAFLD)

Alkoholista riippumaton rasvamaksa yleistyy nopeasti myös Suomessa. Maksan vähäinen rasvoittuminen ei välttämättä ole vaarallista, mutta se voi johtaa vakavampiin sairauksiin, kuten NASH (non-alcoholic steatohepatitis), jossa maksan rasvoittuminen assosioituu maksan tulehdukseen. Se voi johtaa maksan arpeutumiseen ja maksakirroosiin. Rasvamaksa ei välttämättä juuri oireile ennen kuin se pahenee maksatulehdukseksi.

NAFLD liittyy lihomiseen, metaboliseen oireyhtymään, esidiabetekseen ja aikuistyypin diabetekseen. Mikä maksan rasvoittumista aiheuttaa. Tästä vallitsee useita tieteellisesti perusteltuja näkemyksiä. Tutkimuksissa on havaittu, että vakavampaan NASH-tautiin vaikuttavat mm.

– Oksidatiivinen stressi
– Inflammaatio
– Maksasolujen nekroosi eli maksasolujen kuoleminen
– Rasvakudoksen inflammaatio
– Suoliston mikrobiomin epätasapaino (huono bakteerikanta)

Alkoholista riippumattoman rasvamaksan riskitekijöistä lihavuus on ylivoimainen ykkönen. Lihavista kahdella kolmanneksella on rasvoittunut maksa. Insuliiniresistenssi ja aikuistyypin diabetes sekä PCOS kasvattavat myös maksan rasvoittumisen riskiä.

Tehokkain tapa hoitaa rasvoittunutta maksaa on laihduttaminen. Myös lisättyjen sokereiden ja aivan erityisesti teollisen fruktoosisiirapin saannin vähentäminen päivittäisestä energiansaannista on järkevää, koska fruktoosin aineenvaihdunta tapahtuu maksassa ja pieni osa fruktoosista muutetaan aina triglyserideiksi maksassa.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävistä LCHF-ruokavalioista ja niiden terveysvaikutuksista voidaan toki olla montaa mieltä, mutta varmaa on se, että oheiset ravitsemukseen liittyvät epidemiana leviävät sairaudet eivät johdu siitä, että kourallinen ihmisiä rajoittaa hiilihydraatteja ja korvaa merkittävän osan päivän energiansaannista rasvoilla.

Jos LCHF ei paranna mainittuja sairauksia, on todennäköistä, että oksidatiivisen stressin ja inflammaation hillitseminen sekä laihtuminen helpottavat oheisten sairauksien oireita ja laskevat sairastumisriskiä LCHF-ruokavaliolla.

Nykyiset elintavat, energiatiheät ja ravitsemukseltaan köyhät ruoat sekä stressi ja jatkuva kiire ylläpitävät ja levittävät lihavuusepidemiaa, metabolista oireyhtymää, suolistosairauksia, diabetesta, rasvamaksaa jne. Siksi mikä tahansa ruokavalio kasvisruokavaliosta välimerelliseen tai LCHF-ruokavalioon sekä ymmärrys ravintoaineista ja aineenvaihdunnasta voi laskea sairastumisen riskiä ja ylläpitää terveyttä ja terveellistä painonhallintaa.

Joskus lääketieteessä tuntuu olevan vallalla ajatus, että jos auto liikkuu, ei autolla kannata ajaa ennen kuin tiedetään mihin sen liikkuminen perustuu. Tarvitaan siis lisää tutkimuksia. Se on hyvä asia. LCHF toimii ja sitä noudattavat ihmiset raportoivat jatkuvasti laihtumisesta ja terveyden kohenemisesta, mutta teoriassa sitä ei kannata noudattaa, koska vielä ei sataprosenttisesti ymmärretä, miksi se toimii. LCHF-ruokavalion pitkäaikaisvaikutuksista ei ole olemassa tutkittua tietoa ja siksi siihen suhtaudutaan vielä hyvin varovaisesti. Jokaisen on järkevää kuunnella ja seurata oman elimistönsä lähettämiä viestejä.

Ruokasotaa aloitellessani vuosia sitten uskoin, että jos kysyn oikeat kysymykset, löydän myös oikeat vastaukset. Nykyään olen paljon skeptisempi. Uskon, että ei ole oikeita kysymyksiä ja oikeita vastauksia. Kaikkiin lupauksiin, joita nettivideoissa ja kirjoituksissa annetaan, kannattaa suhtautua terveen skeptisesti.

Helppoja ja yleispäteviä vastauksia vaikeisiin kysymyksiin ei ole. LCHF ei ole ruokavalio, joka soveltuu kaikille tai parantaa kaikki vaivat. Se on tehokas laihdutusruokavalio, joka tutkimusten mukaan voi vähentää oksidatiivista stressiä ja inflammaatiota. Stanfordin yliopistossa tehdyn tutkimuksen mukaan sekä kaloreita rajoittamalla että runsaasti rasvaa sisältävällä ruokavaliolla laihtuu, mutta molemmissa tutkimusryhmissä esiintyi paljon vaihtelua seurattujen henkilöiden laihtumisen suhteen.

Kesäkurpitsanuudelit


Okei, miten aloitan?


Aineenvaihdunta on mutkikas järjestelmä. Ihmisten painonhallintaan vaikuttaa lukemattomia tekijöitä stressistä hormoneihin ja perinnölliseen lihomisalttiuteen. Jotkut eivät liho ja toiset keräävät varastorasvoja luokattoman helposti ja nopeasti. Toisaalta joillekin arkiliikunta ja tasapainoinen ruokavalio riittävät hyvän terveyden ylläpitoon, kun taas sairaalloisen lihavien laihtuminen vaikuttaa jo mahdottomalta.

Jörn Donner totesi, että lukeminen kannattaa aina. Hän oli oikeassa. Sama pätee laihduttamiseen ylipainoisilla. Laihtuminen parantaa terveyttä ja lisää terveitä elinvuosia. Se, miten ihminen laihtuu, on vähemmän tärkeää kuin se, että ihminen laihtuu. Tavallaan on ristiriitaista, että ihmisiä syyllistetään ja pelotellaan onnistumisesta, perustuu onnistuminen sitten vegaaniruokavalioon tai Atkinsin dieettiin. Jos ihmisen verenkuva, paino, verenpaine, verensokeri ja yleinen hyvinvointi kohenevat, onko sillä väliä, päästiinkö tulokseen LCHF-ruokavaliolla vai kasvisruokavaliolla.

Tärkeintä on, että ihminen saa ravinnostaan kaikki välttämättömät ravintoaineet. Laajemmin on havaittu, että vähemmän energiaa sisältävä ravinto (syödyistä makroravinteista riippumatta) ylläpitää terveyttä ja terveitä elinvuosia. Tämä johtunee sirtuiineista (histonideasetylaaseista). Esimerkiksi SIRT1 säätelee keskeisiä metabolisia prosesseja ja sillä on tärkeä merkitys aineenvaihdunnan säätelyssä.

SIRT1 säätelee mm. mitokondrioiden biogeneesiä sekä energia- ja rasvametaboliaa, oksidatiivista stressiä ja vaikuttaa esimerkiksi lihavuuteen ja diabetekseen. SIRT1 säätelee todennäköisesti tulehdusvaisteita ja kudosten atrofioitumista sitoutumalla NF-kB:en. SIRT2 vaikuttaa solunjakautumiseen.

Henkilöiden, jotka päättävät kohentaa terveyttä ja laihtua LCHF-ruokavalion avulla, on syytä syödä hiilihydraattirajoitteista riippumatta mahdollisimman monipuolisesti.

On jonkin verran tutkimusnäyttöä, jonka mukaan kasviperäisten proteiinien ja rasvojen saanti LCHF-ruokavaliossa ylläpitää terveyttä paremmin kuin eläinperäiset rasvat ja proteiinit. Ruokavalion sallimia kasviksia on hyvä syödä runsaasti. Niistä saa kuituja, antioksidantteja, polyfenoleita, vitamiineja, mineraaleja jne., joita elimistö tarvitsee. Rasva on LCHF-ruokavaliossa polttoaine, mutta keho tarvitsee myös aminohappoja, kuituja, vitamiineja jne.

Ensimmäinen ja kenties yksi tärkeimmistä ravintoon liittyvistä valinnoista koskee lisättyjen sokereiden, valkoisten jauhojen ja voimakkaasti raffinoitujen elintarvikkeiden välttämistä. Pelkästään tämä pieni muutos elämäntavoissa voi auttaa laihtumaan ja parantamaan yleistä hyvinvointia. Vaaleat leivät kannattaa korvata täysjyväviljoista leivottuihin leipiin, makeisista ja virvoitusjuomista on hyvä luopua kokonaan jne.

Minä en laske kaloreita tai hiilihydraatteja lainkaan. Tiedän suurin piirtein, mitä kasviksia voin syödä ja sen jälkeen seuraan vain omaa kylläisyyttäni. Luultavasti saan päivittäisestä energiastani nyt yli puolet rasvasta, 30 prosenttia proteiineista ja 10-20 % hiilihydraateista. Se ei aivan noudata ketogeenistä ruokavaliota tai Atkins-ruokavaliota, mutta toisaalta olen luopunut lisätyistä sokereista, runsaasti tärkkelystä sisältävistä perunoista ja riisistä sekä viljoista ja korvaan noiden rajoittamisen tuottaman energiavajeen rasvoilla.

Tämä on kolmas päivä ruokavaliomuutokseni jälkeen. Kaksi ateriaa päivässä on pitänyt minut kylläisenä ja energisenä kahtena ensimmäisenä päivänä. Olen syönyt lounasbrunssin puolen päivän tienoilla ja päivällisen 17-18 aikaan.

Molempien päivien ruoka on koostunut suuresta määrästä sallittuja kasviksia (tomaatit, kurkku, kaali, paprika, salaatti, kesäkurpitsa), rasvasta ja proteiinista (jauheliha, kana). Mitään välipaloja tms. ei ole tehnyt mieli. Yhtenä huomiona olen havainnut, että suoli on toimin poikkeuksellisen hyvin ja täsmällisesti. Se on ilahduttavaa, sillä minulla on ollut ärsyttäviä suolistovaivoja.

Eilinen ruoka (0.12.2019)

Heräsin viiden aikaan. Join aamun ja aamupäivän aikana 4 kupillista mustaa kahvia. En ole koskaan ollut aamupalan ystävä.

Nälkä tuli kello 11 ja 12 välillä, jolloin tein kanasalaattia lounaaksi. Salaattiin tuli jäävuorisalaattia, kurkkua, tomaatteja ja keitettyjä vihreitä papuja. Paistoin ja maustoin (pippurilla, suolalla ja chilillä) kanafileistä leikkaamani suikaleet runsaassa voissa. Tein majoneesin itse: 2 dl rypsiöljyä, muna, korkillinen etikkaa, 0,5 tl suolaa, 1 tl mustapippuria, 1 tl valkosipulijauhetta, 1 tl chilimurskaa öljyssä, 2 tl currya. Näin syntyy hyvin kiinteä majoneesi, jota pehmensin 1,5 desillä rasvaista maustamatonta turkkilaista jogurttia. Sekoitin ainekset keskenään ja hyvää tuli. Se oli lounas.

Iltapäivällä join melkoisesti vettä. Päivälliseksi tein ison täytetyn kesäkurpitsan, johon tuli täytteeksi mm. paistettua jauhelihaa, tomaattikastiketta ja runsas juustokuorrutus. Päivällisen jälkeen join vielä 4 kupillista teetä.

Ruokavalion noudattamisessa on tärkeää seurata ja kuunnella omaa elimistöä

LCHF sisältää useita koulukuntia ja erilaisia ravintohifistelijöitä mahtuu jokaiseen koulukuntaan ruokavalioista riippumatta. En pidä hifistelyä tarkoituksenmukaisena. Pääpiirteitten ollessa selvät henkilön tulee kuunnella omaa elimistöään, eikä jotain gurua. Hiilihydraattien määrä LCHF-ruokavaliossa lasketaan maksimissaan 50 grammaa päivätasolle, mutta mieluummin vieläkin alemmalle tasolle, jos tarkoituksena on ketoosiin pääsy.

Atkinsin ruokavalio

Atkinsin ruokavalio koostuu neljästä vaiheesta:

  • Vaihe 1: Hiilihydraattien määrä lasketaan 20 grammaan päivässä. Tämä jatkuu 2 viikkoa.
  • Vaihe 2: Päivittäiseen syömiseen lisätään pähkinöitä, vähäisiä määriä hedelmiä ja vähähiilihydraattisia vihanneksia.
  • Vaihe 3: Asetetun painotavoitteen lähestyessä hiilihydraattien saantia voidaan lisätä.
  • Vaihe 4: Ruokavalioon otetaan mukaan täysjyväviljoja ja muita terveellisiä hiilihydraatteja sen verran, että paino pysyy tasaisena.

The ketogeeninen ruokavalio

Ketogeeninen ruokavalio rajoittaa hiilihydraatteja merkittävästi ja tähtää ketoosiin, jossa elimistö alkaa tehokkaasti käyttää rasvoja solujen energian lähteenä.

Ketogeeniset ruokavaliot jakautuvat opillisten ja tavoitteellisten erojen puitteissa eräänlaisiin koulukuntiin. Tavallisesti tavoitteena on laskea päivittäinen hiilihydraattien saanti 5-10 prosenttiin päivittäisestä energiasta. Määrällisesti tämä tarkoittaa noin 20-50 grammaa hiilihydraatteja/päivässä.

Ruokavalion tavoitteena on ketoosi, joka on luonnollinen tila, kun elimistö ei saa riittävästi energiaa hiilihydraateista. Ketoosissa elimistö alkaa pilkkomaan varastoimiaan rasvahappoja ketoaineiksi, joita solut voivat hyödyntää energian tuotannossa. Ketoosia ei tule sekoittaa vaaralliseen happomyrkytykseen, ketoasidoosiin. Ketoasidoosissa veren ketoainepitoisuudet nousevat jopa kymmenkertaisiksi ketoosiin verrattuna.

Kanasalaatti


Hyvin suunniteltu on puoliksi tehty


Kaikki ruokavaliot edellyttävät hieman valmistelua ja suunnittelua. Ongelmia syntyy, jos ruokavalio yksipuolistuu liikaa. Silloin se ruokavalion noudattamisesta tulee vaikeaa ja laihduttaminen loppuu nopeasti alkuinnostuksen jälkeen. Siksi on tärkeää suunnitella ruokavaliota niin, että se sisältää vaihtelua, monipuolisia raaka-aineita ja tarjoaa kaikki tarvitut ravinteet.


Mitä söisin tänään?


LCHF-ruokavalioissa hiilihydraattien rajoittaminen rajoittaa syötävien ruokien määrää. Tämä voi tuottaa motivaatio-ongelmia.

Alkavan ketoilijan kauppalista

– Cashew-pähkinät (hyviä rasvoja ja proteiineja)
– Lihat (possu, nauta, kana, kalkkuna, lammas)
– Kalat (erityisesti rasvaiset lohi, sardiinit ja makrilli)
– Juustot
– Voi
– Avokadot
– Öljyt (oliivi-, kookos-, avokado- ja pellavansiemenöljy)
– Pähkinät (maapähkinät, mantelit, cashew-pähkinät)
– Siemenet (auringonkukan siemenet, chia ja pellavansiemenet)
– Munat
– Pinaatti ja muut tummanvihreät lehtivihannekset
– Marjat (mustikat, mustaviinimarjat, mansikat )
– Parsakaali
– Kukkakaali
– Valkokaali
– Ruusukaali
– Parsa
– Kesäkurpitsa
– Tomaatit
– Paprika
– Myskikurpitsa
– Juomaksi (vesi, kahvi, tee)

Seuraavia voi ketogeenisella ruokavaliolla syödä hieman ruokavalion tavoitteista riippuen:

– Porkkanat (vähän)
– Punajuuret (vähän)
– Omena, vesimeloni tai persikka (vähän)
– Kvinoa (vähän)
– Bataatti (vähän)
– Pavut ja palkokasvit (vähän)
– Kauraa (vähän)
– Täysjyviä (vähän)

Rajoitettavia ruokia ovat

Kaikilla LCHF-ruokavalioilla rajoitetaan hiilihydraatteja ja aivan erityisesti puhtaita sokereita ja runsaasti tärkkelystä sisältäviä kasviksia, kuten perunoita ja riisiä. Ruokavalio ei suosittele virvoitusjuomia, mehuja, kakkuja, leivoksia, makeisia, fruktoosisiirapilla tai millään teollisilla makeutusaineilla makeutettuja raffinoituja elintarvikkeita tai alkoholisokereita. Muita rajoitettavia ovat:

  • valkoinen pasta
  • valkoinen riisi
  • leipä, sämpylät ja patongit
  • leivonnaiset, pullat, muffinssit jne.
  • makeiset
  • virvoitusjuomat, mehut
  • olut
  • dieettijuomat ja yleensäkin dieetti-mitkä tahansa
  • vähärasvaiset elintarvikkeet, sillä niissä rasvat on korvattu sokereilla

Kaikkia hiilihydraatti- ja tärkkelyspitoisia ruokia ei ole pakko poistaa ruokalistalta. LCHF-ruokavaliota voi noudattaa, jos siihen sisältyy rajoitetusti papuja ja muita palkokasveja sekä täysjyväviljoja. Niiden määrien tulisi olla vähäisiä, eikä niitä suositella päivittäiseen ruokavalioon.

Ja lopuksi

LCHF-ruokavaliot vaikuttavat eri ihmisiin eri tavoin. Korostan jälleen, että välttämättömien ravintoaineiden saannista tulee huolehtia, vettä tulee juoda riittävästi ja elimistöä pitää kuunnella. LCHF-ruokavaliot voivat aiheuttaa (ainakin kuurin alkuvaiheessa)

  • väsymystä ja heikkoutta
  • kramppeja
  • päänsärkyä
  • ummetusta tai ripulia
  • kutinaa
  • pahanhajuisen hengityksen

Kun elimistö sopeutuu ruokavalion muutoksiin, sivuoireet vähenevät ja katoavat. Tsemppiä ja hyvää terveyttä kaikille, jotka tämän tien valitsevat. Omat kokemukseni olivat ja ovat rohkaisevia, mutta nähtäväksi jää. Oli LCHF-ruokavalio terveellinen tai ei, se ei ainakaan voi olla huonompi vaihtoehto kuin ravinneköyhien ja energiatiheiden transrasvoja runsaasti sisältävien eines- ja pikaruokien, makeisten ja makeiden virvoitusjuomien ahmiminen pitkin päivää.

Kuvat: Pixabay




Ketogeeninen ruokavalio ja MS

Noudatin vähähiilihydraattista ruokavaliota vuosia sitten. Kokeilu jäi vain vajaan vuoden mittaiseksi, mutta kokemukseni olivat sekä painonhallinnan että yleisen hyvinvoinnin kannalta rohkaisevia. Oloni oli erinomaisen hyvä ja painoni laski.

Ruokavalion noudattaminen kaatui jouluherkkuihin. Noiden aikojen jälkeen olen lihonut 20 kiloa ja rasvaa on kerääntynyt erityisesti keskivartalolle haitallisena viskeraalisena läskinä. On aika tehdä jotain.

Ketogeeninen ruokavalio ja MS selvittää vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion vaikutuksia etenevää MS-tautia sairastavan terveyteen. 

Ketogeeninen ruokavalio herättää voimakkaita tunteita. Monien on yhä vaikea hyväksyä sitä, että syöty rasva voi laihduttaa. Ketogeeninen ruokavalio kuitenkin toimii mainiosti laihdutusruokavaliona.

MS on siinä mielessä viheliäinen sairaus, että se vaikuttaa vääjäämättä fyysiseen aktiivisuuteen. Painoa alkaa kertyä huomaamatta. Minä olen nauttinut invaliditeetin tuomasta joutenolosta syömällä epäterveellisesti ja juomalla pikkukylän vuosittaista vedenkulutusta vastaavan määrän olutta. Siinäpä tekosyyt.

Mitä ketogeenisella ruokavaliolla tarkoitetaan?

Ketogeeninen dieetti on vähähiilihydraattinen ja runsaasti rasvaa sisältävä ruokavalio. Proteiinien määrä pidetään ruokavaliossa maltillisena.

Evidenssiä tämän ruokavalion hyödyistä laihdutusruokavaliona on runsaasti. Sen sijaan näyttö siitä, että ketogeeninen ruokavalio helpottaisi etenevän multippeliskleroosin oireita, on vähäistä.

Laihtumisella ja elimistön hiljaisen tulehduksen – inflammaation – hillitsemisellä on terveyttä edistäviä vaikutuksia. En usko, että ruokavalio tekee ihmeitä sairaudelleni, mutta toivon laihtuvani sen avulla.

Ruokavaliossa hiilihydraattien, kuten tärkkelyksen ja sokereiden määrää rajoitetaan. Tämä tarkoittaa, että monet yleiset ruoka-aineet, kuten perunat, pastat, riisi, leivät ja hedelmät ovat rajoitettavien ravintoaineiden listalla.

Lihakasvis-vartaat

Ruokavalion puolestapuhujat korostavat, että ketogeeninen ruokavalio voi auttaa laihtumaan ja hillitsemään keskushermostoa degeneroivia tulehdusreaktioita.

Ketogeenisen aineenvaihdunnan perusteet ja toivotut hyödyt

Ketogeeninen ruokavalio voi mahdollisesti hillitä multippeliskleroosin oireita. Mihin ruokavalio ja tällaiset väitteet perustuvat?

Ketogeenisen ruokavalion tarkoituksena on ohjata solujen energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Kehon energiantuotantoa säätelee monet hormonit ja entsyymit, joista ketogeenisen ruokavalion kannalta mielenkiintoisimpia ovat insuliini ja glukagoni.
Ketogeeninen ruokavalio perustuu pitkälti juuri insuliinin ja glukagonin toiminnan ymmärtämiseen ja hyödyntämiseen.

Solujen energiantuotanto

Solut rakastavat glukoosia, sillä se on helppo ja nopea energianlähde. Ruoansulatuskanavassa hiilihydraatit, kuten tärkkelystä sisältävät perunat ja riisi, pilkotaan sokereiksi ja muiksi ravinteiksi. Glukoosi kulkee ohutsuolen endoteelin läpi verenkiertoon eräiden glut-molekyylien kuljettamana ja kohottaa verensokeria.

Haima reagoi sokeripitoisuuden lisääntymiseen erittämällä vereen insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, jolloin solun sisältämät solukalvon läpäisevät glukoosia kuljettavat kanavat tulevat solukalvolle. Näiden avulla glukoosi pääsee soluun.

Solun sytoplasmassa käynnistyy glykolyysi, jossa glukoosimolekyyli pilkotaan kahdeksi pyruvaatiksi. Reaktiossa syntyy myös kaksi korkeaenergistä ATP-molekyyliä ja kuusi vetyionia kumpaakin pyruvaattia kohden. Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit.

NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen. Anaerobinen (hapeton) energiantuotanto loppuu siihen, että pyruvaatit pelkistyvät laktaatiksi.

Sitruunahappokierto
Kuvan lähde: Wikipedia

Aerobinen (hapellinen) energiantuotanto jatkuu soluhengityksenä sitruunahappokierrossa sellaisissa soluissa, joilla on käytettävänään happea ja mitokondrioita. Sitruunahappokierto (Krebsin sykli, trikarboksyylihappokierto (TCA-kierto)) käynnistyy sitraattisyntaasientsyymin katalysoidessa sitraatin muodostumista oksaaliasetaatista ja asetyylikoentsyymi-A:sta.  

Sitraatista kierto etenee isositraattiin, siitä alfa-ketoglutaraattiin, edelleen sukkinyyli-koentsyymi-A:han, sitten sukkinaattiin, edelleen fumaraattiin, sitten malaattiin, kunnes kierto palaa oksaaliasetaattiin. Tuloksena asetyyliryhmä on hapetettu täydellisesti hiilidioksidiksi ja kolme NADH:ta, yksi FADH2 ja yksi GTP on tuotettu. Ketoilijoiden kannalta oleellista on, että rasva muutetaan sitruunahappokierron väliaineeksi – asetyylikoentsyymi-A:ksi.

Ennen kuin hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi.

 Mitokondrioissa tapahtuvassa sitruunahappokierrossa syntyy vielä parikymmentä korkeaenergistä ATP-molekyyliä ja protoneja elektroninsiirtoketjuun. Soluhengityksen lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat ihon ja hengityksen kautta. Sokerit ja rasvat siis palavat solujen mitokondrioissa vedeksi ja hiilidioksidiksi. Glukoosi kelpaa sellaisenaan solujen energiantuotantoon. Rasvat ja proteiinit on ensin muokattava asetyylikoentsyymi-A:ksi ja sokerit glukoosiksi.

Kun elimistö pakotetaan hyödyntämään rasvasoluihin varastoitua rasvaa energianlähteenä, läskin palaminen tehostuu huomattavasti.

Kaikki sokerit eivät kelpaa suoraan energiantuotantoon, vaan ne pitää ensin muuttaa glukoosiksi ja glykogeeneiksi, jotka muodostuvat jopa kymmenistä tuhansista yksittäisistä glukoosimolekyyleistä. Ravinnosta saatavan fruktoosin aineenvaihdunta eli fruktolyysi tapahtuu maksassa. Suurin osa fruktoosista syntetisoidaan glykogeeneiksi maksan nopeisiin sokerivarastoihin. Osa fruktoosista muutetaan maksassa glukoosiksi, joka vapautuu verenkiertoon ja ravitsee solujen energiantarvetta. Pari prosenttia fruktoosista muutetaan maksassa suoraan triglyserideiksi eli varastorasvaksi. Fruktoosin aineenvaihdunta rasittaa ja voi pahimmillaan rasvoittaa maksaa. Ilmeisesti epidemiaksi äitynyt alkoholista riippumaton rasvamaksa palautuu väestön ylettömään sokerin kulutukseen.

Jos veressä on liikaa glukoosia solujen ravinteiksi sekä lihasten ja maksan glykogeenivarastoihin, aineenvaihdunta alkaa muuttaa sokereita triglyserideiksi eli varastorasvaksi de novo lipogeneesissa. Insuliini osallistuu myös rasvanhappojen varastoimiseen rasvasoluihin. Tähän perustuu sokereiden lihottava vaikutus.

Kun veren sokeripitoisuus laskee, haima erittää vereen glukagonia. Glukagoni on insuliinin vastavaikuttaja ja sillä on monia tärkeitä tehtäviä aineenvaihdunnan säätelyssä.

1. Glukagoni purkaa maksan glykogeenivarastoja glukoosiksi verenkiertoon solujen energiantuotannon turvaamiseksi ja lihasten glykogeenivarastoja lihasten energiantuotantoon.

2. Glukagonin vaikutuksesta rasvasoluihin varastoituja triglyseridejä vapautuu verenkiertoon. Maksassa ja munuaisissa käynnistyvät ketogeneesi ja glukoneogeneesi. Ne valmistavat verenkiertoon vapautuneista vapaista rasvahapoista yms. aineista solujen energiantuotantoon kelpaavia ketoaineita ja glukoosia. Glukoneogeneesi syntetisoi mm. vapaista aminohapoista ja sitruunahappokierron välituotteista glukoosia.

Verensokerin kohotessa insuliini keskeyttää ketogeneesin ja glukoneogeneesin.

3. Rasvahappojen beetaoksidaatio käynnistyy

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Sen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta, kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Ketogeenisessä ruokavaliossa elimistö alkaa aktiivisesti muuttaa varastoimiaan rasvoja energiaksi kelpaavaan muotoon, koska soluille ei tarjota helppoa ja nopeaa glukoosia energianlähteeksi. Keho siis pakotetaan polttamaan rasvaa. Tästä ketoosissa ja ketogeenisessä ruokavaliossa on kyse.

Aineenvaihduntaprosessi on täysin luonnollinen. Elimistö osaa käyttää rasvaa polttoaineena, mutta koska solut on lapsuudesta lähtien tehokkaasti opetettu käyttämään polttoaineena sokeria, rasvavarastoja ei juurikaan pureta; lihominen jatkuu niin kauan kuin tarjolla on helppoja hiilihydraatteja ja veren insuliinipitoisuus säilyy korkeana. Elimistö alkaa purkaa rasvavarastoja, kun sille ei tarjota helppoa energiaa. Tavallaan kaloreita merkittävästi rajoittamalla päädytään samaan tilanteeseen, jossa kehon on turvauduttava varastoenergiaan.


Ketoosin hyödyt

Elimistö menee ketoosiin, kun veren sokeripitoisuus ja sen seurauksena insuliinipitoisuus ovat matalat. Varsinainen ketoaineita tuottava ketoosi käynnistyy muutamassa vuorokaudessa, jos hiilihydraattien saantia rajoitetaan 20-50 grammaan vuorokaudessa. Kehon varastoimien rasvojen tehokas käyttö energianlähteenä alkaa noin kolmessa viikossa edellyttäen, että hiilihydraattien saanti pysyy hyvin matalana. Ketoosissa:

  • paino laskee ja elimistö käyttää tehokkaasti varastorasvoja energianlähteenä
  • muuttunut aineenvaihdunta suojaa soluja
  • inflammaatio ja hapetus-pelkistysreaktion epätasapainon seurauksena syntyneet happiradikaalit vähenevät ja antioksidatiiviset prosessit tehostuvat
  • stressihormonien määrä elimistössä ja stressitasot laskevat


Ketogeeninen ruokavalio ja MS

Eräs ketogeeniseen ruokavalioon liitetty vaikutus on se, että se suojelee elimistöä solutasolla vaikuttamalla hapetusstressiin (oksidatiivinen stressi). Verensokerin nousu assosioituu oksidatiiviseen stressiin ja se ylläpitää inflammaatiota.  

Lihavilla myös ylimääräinen rasvakudos ylläpitää elimistön tulehdustilaa, koska rasvakudos erittää erilaisia tulehdussytokiineja eli tulehdusta välittäviä aineita. Laihduttaminen vähentää tällaista inflammaatiota ja tehokas laihtuminen voi laskea tulehdusarvoja (CRP) merkittävästi ja siten parantaa yleistä terveyttä.  

Mitä tutkimukset sanovat?

Saksalaisen 2015 toteutetun seurantatutkimuksen perusteella ketogeeninen ruokavalio parantaa multippeliskleroosia sairastavien elämänlaatua. Tutkimuksen miinuksena on, että se oli hyvin pienimuotoinen (60 osallistujaa) ja kesti vain puoli vuotta.

Saman vuoden aikana ilmestynyt tutkimusraportti löysi viitteitä siitä, että ketogeeninen ruokavalio suojaa etenevää multippeliskleroosia sairastavien keskushermostoa etenevään multippeliskleroosiin assosioituvilta neurodegeneratiivisilta tuhoilta.

”Until recently, multiple sclerosis has been viewed as an entirely inflammatory disease without acknowledgment of the significant neurodegenerative component responsible for disease progression and disability. This perspective is being challenged by observations of a dissociation between inflammation and neurodegeneration where the neurodegenerative component may play a more significant role in disease progression. In this review, we explore the relationship between mitochondrial dysfunction and neurodegeneration in multiple sclerosis. We review evidence that the ketogenic diet can improve mitochondrial function and discuss the potential of the ketogenic diet in treating progressive multiple sclerosis for which no treatment currently exists.” Lue tutkimus
tästä.

Ketogeeninen ruokavalio näyttää hyödyttävän multippeliskleroosia sairastavia solutasolla. Se vähentää oksidatiivista stressiä ja lisää veren antioksidanttitasoja. Tämä suojaa hermo- ja aivosoluja neurodegeneraatiolta. Vastaavia havaintoja on tehty dementian ja Alzheimerin taudin kohdalla; ketogeeninen ruokavalio on tutkimuksissa liitetty pienempään muistisairauksien riskiin.

Oksidatiivinen stressi ja antioksidantit

Oksidatiivinen stressi tarkoittaa solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Käytännössä hapettavien tekijöiden liiallinen määrä ja antioksidatiivisten järjestelmien vajavainen toiminta välittyy reaktiivisten happi- ja typpiradikaalien kautta, mikä ylläpitää elimistön inflammaatiota.

Verensokeri vaikuttaa oksidatiiviseen stressiin ja inflammaatioon sitä enemmän, mitä korkeammalle verensokeri nousee ja mitä suuremmasta syödystä hiilihydraattimäärästä on kyse. Suuren glykeemisen kuorman sisältävät ruoka-annokset nostavat verensokeria rajusti. Oksidatiivisen stressin aiheuttamia tulehdusta lisääviä vaikutuksia voi vähentää tulehdusta jarruttavilla tekijöillä: polyfenoleilla, C-vitamiinilla, kanelilla ja etikalla, kuiduilla ja rasvalla.

Miten se toimii?

Reaktiivinen happiradikaali sisältää parittoman elektronin ja on siksi hyvin reaktiivinen. Energiataloudellisesti parittomat elektronit ovat epäedullisia ja siksi yhdiste pyrkii parilliseen elektronimäärään reagoimalla läheisyydessä olevien muiden yhdisteiden kanssa. Happiradikaali vaurioittaa kohtaamiaan molekyylejä. Tämä voi ilmetä eri tavoin:

Lipidiperoksidaatiossa rasvat härskiintyvät. Oksidatiivisessa stressissä rasvat hapettuvat happiradikaalien liiallisen määrän vuoksi ja seurauksena voi olla esimerkiksi rasvakalvojen virheellinen toiminta, joka vaikuttaa hormonien ja muiden viestiaineiden aikaansaamien signaalien välittymisessä solukalvon kautta soluun.
– Proteiinien vauriot. Proteiinit toimivat entsyymikatalyytteina, jotka mahdollistavat elintoiminnoille välttämättömät kemialliset reaktiot. Jotkin proteiinit toimivat reseptoreina, jotka vastaanottavat soluun tulevia kemiallisia viestejä. Happiradikaalien vaikutukset proteiineihin voivat aiheuttaa monenlaisia elintoimintojen häiriöitä.
– Myös DNA voi vaurioitua hapettumisen seurauksena. Tämä aiheuttaa geneettisiä vaurioita eli mutaatioita DNA:n emäsjärjestyksissä. Tällaiset muutokset voivat muuttaa ko. aluetta koodinaan käyttävän proteiinin rakennetta ja edelleen pysyvästi solun toimintaa, minkä seurauksena solut saattavat muuttua pahanlaatuisiksi. Se altistaa syövän kehittymiselle.  

Happiradikaaleja syntyy elimistön normaalin toiminnan seurauksena esimerkiksi ruokailun jälkeen ja soluhengityksessä, kun mitokondrioiden elektroninsiirtoketju käyttää happea energiantuotannossa. Happiradikaalien muodostuminen on osa perusaineenvaihduntaa, mutta niiden määrää rajoittaa elimistön omat antioksidatiiviset järjestelmät. Hapetus-pelkistystiloissa tapahtuvat muutokset ovat osa solujen välistä viestintämekanismia (redox signaling). Keho voi hyödyntää happiradikaaleja myös immuunijärjestelmän osana. Luontainen immuniteetti ja siihen liittyvät fagosytoivat solut tuhoavat elimistölle vieraita mikrobeja tuottamalla happiradikaaleja.

Elimistöllä on omia mekanismeja reaktiivisten happiradikaalien määrän rajoittamiseen. Näistä tärkeimpiä ovat happiradikaaleja vaarattomiksi molekyyleiksi muuttavat entsyymit, kuten superoksididismutaasi, katalaasi ja glutationiperoksidaasi.  Ravinnosta saatavat pienimolekyyliset antioksidantit pystyvät myös inaktivoimaan happiradikaaleja. Antioksidantteihin kuuluu eräitä vitamiineja ja flavonoideja. Tutuimpia ovat C- ja E-vitamiinit.

Liiallinen oksidatiivinen stressi voi johtaa solukuolemaan ja kudostuhoon. Inflammaatio on kaikkien kroonisten sairauksien riskitekijä.

Tässä on syytä painottaa sitä, että kovin paljon tutkimustietoa ketogeenisen ruokavalion hyödyistä multippeliskleroosia sairastavien oireiden helpottajana ei ole. Havaitut hyödyt on todennettu lähinnä eläinkokeissa ja pitkäaikaisvaikutuksista ei ole tietoa. Toisaalta tutkimusten tulokset ovat hyvin rohkaisevia.

Huomioitavaa

Ketogeenisen ruokavalion noudattaminen voi aiheuttaa multippeliskleroosia sairastavilla väsymystä (fatiikkia). Omalla kohdallani en sellaista huomannut, mutta multippeliskleroosi vaikuttaa eri ihmisiin eri tavoin, joten varoituksen sana on paikallaan.

Usein vähän hiilihydraatteja sisältävää ruokavaliota noudattavia varoitetaan kuitujen ja välttämättömien ravintoaineiden mahdollisista puutoksista hiilihydraattirajoitteiden seurauksena. Se voi olla yksipuolisella ketogeenisella dieetillä ongelma, mutta myös vähän hiilihydraatteja sisältävällä ruokavaliolla saa kaikki välttämättömät ravintoaineet ja riittävästi kuituja, jos ruokavalio on riittävän monipuolinen.

Mitä pitäisi vältellä

Ketoosi edellyttää hiilihydraattien tuntuvaa rajoittamista päivittäisessä ruokavaliossa ja hiilihydraattien korvaamista rasvalla ja proteiineilla. Välteltäviä ravintoaineita ovat erityisesti sokerit ja tärkkelys, jauhot ja niistä valmistetut ruoat sekä riisi, peruna, maissi ja hedelmät.

Rasvat

Hyväksyttyihin ravintoaineisiin kuuluvat hyvät rasvat ja proteiinit sekä vähän hiilihydraatteja sisältävät kasvikset ja pähkinät. Voi kuuluu monissa virallisissa ravintosuosituksissa vältettäviin epäterveellisiin rasvoihin, mutta minä suhtaudun voihin äärimmäisen myönteisesti. Sen sijaan margariineja en mielelläni syö. Voin terveysvaikutuksista vallitsee kaksi koulukuntaa: klassinen rasvavastainen koulukunta ja uusimpiin tutkimuksiin perustuva modernimpi lähestymistapa. Jokainen tehköön valintansa itse. Yhtä totuutta voin terveysvaikutuksista ei ole olemassa.

  • oliiviöljy
  • voi (tai ei, jos syö mieluummin voimakkaasti raffinoituja margariineja)
  • avokadot
  • pähkinät, mantelit, pistaasit
  • rasvaiset kalat, kuten lohi, sardiinit ja makrilli

Proteiinit

Ketogeeniseen ruokavalioon voi sisältyä sekä eläin- että kasvisperäisiä proteiineja.

  • liha
  • meijerituotteet (juustot yms.)
  • munat
  • pähkinät, maapähkinät ja cashew-pähkinät

Hiilihydraatit

Ketogeenisella ruokavaliolla rajoitetaan erityisesti seuraavien hiilihydraattien saantia:

  • sokerit
  • hedelmämehut, virvoitusjuomat ja makeutetut teet
  • makeiset ja leivonnaiset
  • maitoa, sillä se sisältää maitosokeria eli laktoosia
  • pasta
  • leipä
  • pavut
  • hedelmät
  • murot, puurot yms.
  • tärkkelyspitoiset vihannekset, kuten perunat ja maissi

Esimerkki päivän ruoista ketogeenisella ruokavaliolla

Aamiainen

  • pari paistettua munaa
  • pekonia
  • kahvia

Välipala

  • puolikas avokado, kourallinen pähkinöitä

Lounas

  • viipaloitua kurpitsaa
  • lihapullia ja tomaattikastiketta

Välipala

  • manteleita

Päivällinen

  • paistettua lohta
  • kukkakaalia ja voita
  • pinaattia

Tuo on vain eräs esimerkki päivittäisen ruokavalion sisällöstä. Tulen lisäämään tänne ketonurkkaukseen erilaisia hyviksi koettuja reseptejä sekä muuta aihetta sivuavaa infoa.  

Lopuksi

En voi sietää sanaa ”karppaaminen”. Siinä on jotenkin negatiivinen sointi. Lisäksi se kuulostaa pikemminkin hiilihydraattien syömiseltä kuin niiden rajoittamiselta. Käytän itse ketoilu-sanaa vähän hiilihydraatteja ja runsaasti rasvaa sisältävästä ruokavaliosta.

 Aloitin ketoilun eilen 2.12.2019. Söin päivän aikana kaksi ateriaa. Brunssi-lounaalla naudan jauhelihapihvin, runsaasti paistettua valkosipulilla ja chilillä maustettua kaali-paprika-sekoitusta ja juustoraastetta. Päivällisellä 3 paistettua munaa, kaali-paprikasekoituksen jämät ja paistetun naudan jauhelihapihvin. Pysyin kylläisenä, enkä kaivannut välipaloja tai iltapalaa.

Aloitan tulevien viikkojen aikana kokoamaan Ruokasotaan erityistä Ketonurkkausta, jossa kerron ketoiluun liittyvistä tutkimuksista, omista havainnoistani ja hyvistä resepteistä.

 




Runsas gluteenin saanti varhaislapsuudessa voi selittää keliakiaan sairastumista

CNN raportoi 14.8.2019 päivätyssä uutisessa tutkimuksesta, jonka mukaan varhaislapsuuden runsaasti gluteenia sisältävä ravinto voi selittää gluteeniyliherkkyyteen ja keliakiaan sairastumista.

Mitä gluteeni on

Gluteeni on viljojen sisältämien gliadiini- ja gluteliini-ryhmän varastoproteiineista muodostuva aine, joka antaa viljoille leivonnassa hyödyllisen sitkon. Taikinassa gliadiini ja gluteniini järjestyvät gluteeniksi, eli tiiviiksi, venyväksi ja joustavaksi verkostoksi.

Vehnän sisältämä gluteeni sisältää glysiinejä, seriinejä ja treoniineja. Rukiissa on sekaliineja, ohrassa hordeiineja ja kaurassa aveniineja. Gluteenia on kaikissa yleisimmissä viljatuotteissa, mutta monet keliakiaa sairastavat sietävät kauran aveniinista muodostuvaa gluteenia.

Suomessa noin 6 prosenttia väestöstä sairastuu gluteeniyliherkkyyteen ja 2 prosenttia keliakiaan. Keliakiassa gluteenin prolamiiniosa gliadiini aiheuttaa ohutsuolessa tulehduksen. Tutkimusten mukaan gliadiini kasvattaa suolen läpäisevyyttä  ja soluliitosten väljentymistä suoliston seinämissä.

JAMA:n julkaiseman tutkimuksen mukaan runsaasti gluteenia sisältävä ravinto lapsen ensimmäisten viiden elinvuoden aikana assosioituu kasvaneeseen keliakian, suolistotulehdusten ja ohutsuolen vaurioiden riskiin.

Normaalia suurempi gluteenin saanti kasvatti lapsen riskiä sairastua keliakiaan 6,1 %. Gramman lisäys päivittäiseen gluteenin saantiin kasvatti sairastumisen riskiä edelleen 7,2 %.

Tutkimuksessa arvioitiin yli 6600 vuosien 2004 ja 2010 välillä syntyneen lapsen ravintotottumuksia Yhdysvalloissa, Suomessa, Saksassa ja Ruotsissa. Kaikilla tutkimuksessa mukana olleilla lapsilla oli lapsuustyypin diabetekselle ja keliakialle altistava genotyyppi.

Lasten gluteenin saanti tarkistettiin muutaman kuukauden välein aina viidenteen ikävuoteen asti. Saantia verrattiin saman ikäisten terveiden verrokkilapsien gluteenin saantiin.

Tutkimuksen aikana 1216 lapsella (lähes 20 %) havaittiin gluteenin liittyvä autoimmuniteettireaktio, joka on elimistön ensimmäinen merkki huonosta gluteenin siedosta, kertoi tutkimusta johtanut Carin Andrén Aronsson Lundin yliopistosta. Lisäksi lapsista 450 (n. 7 %) sairastui keliakiaan. Keliakiaan sairastuminen diagnosoitiin useimmiten 2 ja 3 ikävuoden välillä.


Keliakia vaikuttaa miljoonien elämään


Keliakiaa sairastavilla gluteeni vahingoittaa ohutsuolen limakalvon nukkaa. Keliakia edellyttää perinnöllisen alttiuden sairastua, sekä jonkin taudin laukaisevan ympäristötekijän. Tämän tutkimuksen perusteella runsas gluteenin saanti varhaislapsuudessa voi laukaista taudin sellaisilla lapsilla, joilla on perinnöllinen alttius sairastua.

Pienelle osalle keliakiaa sairastavista kehittyy iho-oireita (dermatitis herpetiformis). Suolen keliakiaa sairastavista kaksi kolmasosaa on naisia. Ihokeliakiaa esiintyy yhtäläisesti miehillä ja naisilla.

Keliakia on autoimmuunitauti, jossa elimistön immuunijärjestelmä tuottaa vasta-aineita omia kudoksia vastaan. Keliakiaa sairastavilla on muuta väestöä useammin myös jokin muu autoimmuunitauti. Taudin laukaisee vehnässä, rukiissa ja ohrassa esiintyvä gluteeni, joka perinnöllisesti alttiilla henkilöillä vahingoittaa immunologisen reaktion seurauksena ohutsuolen sisäpintaa verhoavan limakalvon soluja.


Keliakian oireet


Suolistonukan vaurioituminen vaikuttaa ravintoaineiden imeytymiseen. Tämä voi johtaa joidenkin ravintoaineiden puutosoireisiin. Yleisimmät puutosoireet liittyvät raudan ja foolihapon imeytymishäiriöön, mikä voi aiheuttaa anemiaa. Myös ravinnosta saatavan D-vitamiinin imeytyminen voi heikentyä, mikä aiheuttaa kalsiumin imeytymishäiriöitä.

Keliakian tavallisimmat oireet ovat ripuli, löysät ulosteet, ylävatsan turvotus, ilmavaivat, painon lasku ja lapsilla kasvun hidastuminen.

Nykyisin tiedetään, että keliakiaan kuuluu myös oireita, jotka eivät suoraan liity suolistoon. Melkein puolella keliakiaa sairastavista maksaentsyymit ovat koholla. Vakavat maksavauriot ovat kuitenkin harvinaisia. Keliakia aiheuttaa myös hermostoon liittyviä oireita, muistihäiriöitä ja lapsettomuutta.

Ihokeliakiassa esiintyy kutisevia rakkuloita etenkin kyynärpäissä, polvissa ja pakaroissa. Lähes kaikilla ihokeliakiaa sairastavilla on myös suoliston keliakia, mutta usein se on lieväoireinen tai oireeton.

Maailmanlaajuisesti keliakiaa sairastaa arviolta yksi ihminen sadasta. On mahdollista, että jopa kaksi miljoonaa ihmistä sairastaa keliakiaa tietämättään. Celiac Disease Foundation.

Gluteenin osuus keliakiaan tunnetaan, mutta JAMA:n julkaiseman tutkimuksen perusteella myös gluteenin määrällä on sairastumisen kannalta merkitystä.


Gluteeniton ruokavalio kasvattaa suosiotaan


Gluteenittomuus on yhä suositumpaa myös terveiden parissa. Monet välttelevät gluteenia viljojen aiheuttaman turvotuksen tunteen vuoksi.

Gluteenin rajoittaminen voi kuitenkin aiheuttaa vajausta erityisesti täysjyväviljojen sisältämien tärkeiden ravintoaineiden saannissa. Viljojen korvaaminen maissi- tai riisijauhoilla ei ole erityisen terveellistä. Gluteenia sisältävät viljatuotteet sisältävät yleensä runsaasti terveellistä suoliston hyvää mikrobikantaa ravitsevaa sulamatonta kuitua.

Asiantuntijoiden mukaan gluteenista luopuminen ei ole erityisen järkevää, jos ei sairasta gluteeniyliherkkyyttä tai keliakiaa. Aronssonin mukaan geneettisessä riskiryhmässä olevien lasten vanhempien tulisi rajoittaa lastensa gluteenin saantia pienentääkseen sairastumisen riskiä. Mitään tarkkaa ja turvallista saantisuositusta geneettisen sairastumisalttiuden omaaville ei toisaalta ole olemassa.

Tohtori Alessio Fasano (Center for Celiac Research and Treatment, Massachusetts General Hospital) on yksi gluteenin kärjekkäimmistä vastustajista. Hänen hypoteesinsa vuotavan suolen oireyhteydestä kaikkien autoimmuunitautien perimmäisenä syynä on herättänyt paljon polemiikkia, mutta mitään lääketieteellistä konsensusta hypoteesista ei vallitse.

Fasanon mukaan gluteenittomuus on tällä hetkellä Hollywoodin suosituin ruokatrendi, mutta hänkään ei näe järkevänä vältellä gluteenia vain sen vuoksi, että se sattuu olemaan muodikasta. Fasano korostaa, että keliaakikoille gluteenittomuus on rinnastettavissa insuliinin diabeetikoilla; se on ainoa lääketietellinen keino hillitä tautia.

Gluteenittomuuden hyödyistä ei ole tutkittua tietoa muiden kuin keliakiaa tai gluteeniyliherkkyyttä sairastavien kohdalla.


Gluteenittomuuden lyhyt historia

Toisen maailmasodan jälkeen Eurooppa oli raunioina ja lapset kärsivät aliravitsemuksesta. Viljasta, hedelmistä ja vihanneksista oli suuri puute. Aliravitsemuus johti kuitenkin yllättävään havaintoon: terveet lapset heikkenivät, mutta keliakiaa sairastavat vahvistuivat.

Keliakia oli tunnettu jo pitkään ja sitä pidettiin erityisesti lastentautina. Hollantilainen lastenlääkäri Dr. Willem-Karel Dicke havaitsi, että sota-aikana keliakiaa sairastavien lasten oireet helpottivat. Ennen sotaa lasten kuolleisuus keliakiaan oli 30 prosentin luokkaa. Vuonna 1941 Dicke julkaisi tutkimuspaperin vehnättömään ruokavalioon liittyvistä havainnoistaan (PDF).

”There’s nothing specifically bad about gluten or specifically good about a gluten-free diet, outside of for these specific — not uncommon but relatively small — populations of people with celiac disease, which is about 1% of people in the general population,” –  Dr. Daniel Leffler (Celiac Center at Beth Israel Deaconess Medical Center, Boston).

Miksi gluteeni aiheuttaa oireita keliakiaa sairastaville? Aluksi ajateltiin, että kyse on ruoka-allergiasta.

1970-luvulla geenit paljastuvat

Lefflerin mukaan tutkijat oivalsivat 1970-luvulla, että keliakia ei ole allergia, vaan autoimmuunitauti. Taudin patogeneesi paljastui vähitellen 1970-luvun puoliväliin mennessä.

Tutkimukset johtivat havaintoon, että keliakia assosioituu immuunivasteeseen osallistuvaan geeniin HLA-DQ2. Myös HLA-DQ8-geeni vaikuttaa keliakiassa.

”This was sort of a surprise, because HLA-DQ2 was already known to be linked to type 1 diabetes, which is another classic autoimmune disease, but not to any of the allergic diseases. So the genetics that people with celiac disease have is much more similar to autoimmune diseases.” – Leffler

1980-luku: Keliakiasta riippumaton gluteeniyliherkkyys

Keliakiasta riippumaton gluteeniyliherkkyys nousi framille 1980, kun Gastroenterology julkaisi tutkimuspaperin kahdeksan naisen keliakiaa muistuttavista oireista (vatsakipu, krooninen ripuli), jotka katosivat gluteenittomalla ruokavaliolla. Tutkimuspaperin kuvaamien naisten ohutsuolinäytteet eivät osoittaneet merkkejä keliakiasta. Nykyisin keliakia voidaan diagnosoida perhehistorian, verikokeiden, iho- ja geeninäytteiden ja ohutsuolinäytteen avulla.

Gluteeniyliherkkyys tunnetaan yhä huonosti. Nykyisin ajatellaan, että keliakiasta riippumaton gluteeniyliherkkyys aiheuttaa keliakiaan viittaavia suolisto-oireita ilman, että immuunijärjestelmä vahingoittaa suolistonukkaa.

Oireet ovat todellisia ja potilaiden olo helpottaa gluteenittomalla ruokavaliolla, mutta syytä ei vielä ymmärretä. Onkin hyvin mahdollista, että gluteeni ei aiheuta gluteeniyliherkkyyden oireita, vaan jotkin muut viljojen sisältämät proteiinit, kuten vehnän ATI-proteiinit.




Ruokavaliot: MIND

Tieto erilaisten ravintoaineiden vaikutuksista terveyteen vahvistuu jatkuvasti. Tämä synnyttää monenlaisia ravitsemuksellisia oppisuuntia. Tavoite on kaikissa ruokavalioissa sinänsä sama: hyvä terveys. Kognitiivista terveyttä edistävä MIND on eräs tuoreimmista ruokavaliotrendeistä.

Useimmat ruokavaliot sisältävät hyviä ja ravitsemuksellisesti arvokkaita osia. Joidenkin ruokavalioiden selkein päämäärä on laihtuminen ja painonhallinnan ylläpitäminen. Ruokavaliot, kuten ketogeeninen dieetti tai Atkinsin dieetti nojaavat aineenvaihdunnan mekanismeihin, jotka pakottavat aineenvaihdunnan turvautumaan kehon varastorasvoihin energianlähteinä. DASH painottaa sydän- ja verisuoniterveyttä. Vegaaninen ruokavalio voi olla eettinen tai terveydellinen valinta. MIND perustuu kognitiivista terveyttä ylläpitävien ravintoaineiden syömiseen.

Se, mitä suuhunsa laittaa, ei koskaan ole täysin samantekevää. Kaikilla ravintoaineilla on useita tehtäviä elimistössä, mutta minkään yksittäisen ruoka-aineen korostaminen ei liene pitkällä tähtäimellä erityisen terveellistä. Olennaisinta tervellisessä ja tasapainoisessa ruokavaliossa on välttämättömien ravintoaineiden saanti.

MIND (Mediterranean-DASH Intervention for Neurodegenerative Delay)

MIND-ruokavalio on Välimeren ruokavalion ja DASH-ruokavalion sekoitus. Ruokavalio perustuu havaintoihin, että tietyt ravintoaineet parantavat aivojen hyvinvointia ja pienentävät ikääntymiseen liittyvien muistisairauksien, kuten Alzheimerin taudin riskiä.

MIND-ruokavalion mukainen ruoka kootaan ensisijaisesti täysjyväviljoista, marjoista, vihreistä lehtivihanneksista, vihanneksista, oliiviöljystä, kalasta ja siipikarjan lihasta.

Tutkimusnäyttö MIND-ruokavalion terveyshyödyistä on varsin niukkaa, mutta eräiden epidemiologisten tutkimusten mukaan ruokavalio laskee Alzheimerin taudin riskiä.

Huomionarvoista on, että MIND-ruokavalion hyödyt tutkimuksissa vertautuvat erityisesti perinteiseen amerikkalaiseen arkiruokaan, joka ei välttämättä sisällä juurikaan hyviä rasvoja, kasviksia, marjoja, hedelmiä ja kokojyväviljoja.

MIND-ruokavalion kehittäminen alkoi 2015, kun tutkijat selvittivät ravinnon ja aivojen terveyden välistä yhteyttä. Tavoitteena oli kehittää ruokavalio, joka suojaa ikääntymisen aiheuttamilta muistisairauksilta.

Sydän- ja verisuoniterveyttä edistävä DASH (Dietary Approaches to Stop Hypertension) on monissa ruokavalioita vertailevissa tutkimuksissa arvioitu terveellisimmäksi ruokavalioksi. Myös Välimeren ruokavalio ylläpitää terveyttä. MIND yhdistää hyviksi todettuja malleja DASH- ja Välimeren ruokavalioista.

DASH kehitettiin NHLBI:n (National Heart, Lung and Blood Institute) rahoittamien kliinisten tutkimusten rohkaisemana. MIND eroaa Välimeren ruokavaliosta ja DASH-ruokavaliosta:

  • marjojen merkitystä korostetaan hedelmiin nähden marjojen antioksidanttipitoisuuden vuoksi
  • kalaa suositellaan vähintään kerran viikossa
  • MIND korostaa vihreiden lehtivihannesten ja vihannesten tärkeyttä terveydelle

MIND-ruokavalion fokus on kymmenessä suositeltavassa ravintoaineessa ja viidessä ravintoaineessa, joita tulisi välttää.

Suositeltavia ovat:

  • Vihreät lehtivihannekset
  • Kaikki vihannekset
  • Marjat
  • Pähkinät
  • Oliiviöljy
  • Täysjyväviljat
  • Kala
  • Pavut ja palkokasvit
  • Siipikarjan liha
  • Viini (mutta vain lasillinen päivässä)

Vältettäviä ravintoaineita ovat:

  • Voi ja margariini
  • Juusto
  • Punainen liha
  • Paistettu ja uppopaistettu ruoka
  • Makeiset

MIND ja terveys

Välimeren ruokavaliota ja DASH-ruokavaliota on tutkittu paljon. Tutkimusaineiston tulokset ovat varsin koherentteja ja vahvoja. Kumpikin ruokavalio assosioituu tutkimuksissa matalampaan verenpaineeseen, pienempään sydän- ja verisuonitautien riskiin ja pienempään tyypin 2 diabeteksen riskiin.

Toistaiseksi MIND-ruokavaliosta ei ole laajoja epidemiologisia tutkimuksia, mutta kourallinen tehtyjä tutkimuksia viittaisi MIND-ruokavalion hidastavan kognitiivisten sairauksien kehittymistä ja etenemistä sekä pienentävän Alzheimerin taudin riskiä.

Tärkeä huomio MIND-ruokavaliossa on se, että se sisältää paljon antioksidantteja, jotka vähentävät oksidatiivista stressiä. Oksidatiivinen stressi tarkoittaa soluja vaurioittavien vapaiden happiradikaalien ja niitä torjuvien antioksidanttien epätasapainoa elimistössä. Ruokavalion myös uskotaan ylläpitävän sydän- ja verisuoniterveyttä ja vähentävän aikuistyypin diabeteksen riskiä.

MIND laskee Alzheimerin taudin riskiä

Alzheimer’s & Dementia: The Journal of the Alzheimer’s Association-lehdessä julkaistun tutkimuksen mukaan MIND-ruokavalio laskee Alzheimerin taudin riskiä jopa 35 %. Ruokavalion on kehittänyt Rush yliopistossa työskentelevä ravitsemustiteeseen erikoistunut epidmologi Martha Clare Morris kollegoineen.

MIND-ruokavalion vaikutuksia tarkastelevassa tutkimuksessa seurattiin 923 Chicagossa asuvan 58-98-vuotiaan ravitsemustottumuksia osana laajempaa seurantaa (Rush Memory and Aging Project), jonka tavoitteena on tunnistaa muistisairauksiin vaikuttavia tekijöitä. Informaatiota kerättiin osallistujilta kyselytutkimuksina vuosien 2004 ja 2013 välisenä aikana. Ruokatottumukset pisteytettiin sen mukaan, kuinka läheisesti ne muistuttivat MIND-, DASH- tai Välimeren ruokavaliota. Tutkimuksessa seurattiin,  miten erilaisia ruokavalioita noudattavien henkilöiden ravintotottumukset korreloivat Alzheimerin taudin kanssa.

Tutkijat havaitsivat, että ruokatottumukset, jotka olivat lähimpänä MIND-, DASH- ja Välimeren ruokavaliota korreloivat pienimpään Azlheimerin taudin sairastumisriskiin. Välimeren ruokavaliota lähimmin muistuttavat ravintottottumukset laskivat Alzheimerin taudin riskiä 54 %, lähimmin MIND-ruokavaliota muistuttavat ravintotottumukset laskivat Alzheimerin taudin riskiä 53 % ja lähimmin DASH-ruokavaliota noudattavien tottumukset laskivat Alzheimerin taudin riskiä 39 % suhteessa niihin seurannassa oleviin henkilöihin, joiden ravitsemustottumukset erosivat eniten näistä.

Kognitiivista terveyttä edistävät tekijät lienevät MIND-ruokavalion sisältämissä ravintoaineissa, vitamiineissa, mineraaleissa, hyvissä rasvoissa ja fytokemikaaleissa sekä erityisesti folaateissa ja antioksidanteissa.

Ratkaisevaa oli havainto, jonka mukaan toisinaan DASH- tai Välimeren ruokavaliota noudattavien Alzheimerin taudin riski ei laskenut muihin nähden, mutta MIND-ruokavaliota muistuttavaa ruokavaliota satunnaisestikin noudattavien Alzheimerin taudin riski laski 35 %.




Terveet elämäntavat laskevat dementian riskiä

Terveelliset elämäntavat laskevat dementian riskiä niilläkin, joilla geneettinen alttius sairastua on suuri, kirjoittaa Jen christensen CNN:llä.

Terveellinen ruokavalio ja säännöllinen liikunta auttavat tunnetusti painonhallinnassa. JAMA:n sunnuntaina (14.07.2019) julkaiseman tutkimuspaperin mukaan säännöllinen liikunta ja terveellinen ruokavalio laskevat dementian riskiä jopa ihmisillä, joilla on korkea geneettinen alttius sairastua.

Dementia & Alzheimerin tauti

Dementialla tarkoitetaan oireita, jossa muistin ja muiden kognitiivisten kykyjen heikkeneminen alentavat potilaan kykyä selviytyä normaaleista arjen toiminnoista ja haittaavat sosiaalista ja ammatillista selviytymistä. Dementia aiheuttaa tunne-elämän ailahtelevuutta, ärtyisyyttä, apatiaa ja sosiaalisen käyttäytymisen muutoksia.

Dementiaan liittyy muistihäiriöiden lisäksi tyypillisesti kielellisiä vaikeuksia, kuten sanojen muistamiseen ja ymmärtämiseen liittyviä ongelmia. Myös koordinaatiota ja motoriikkaa vaativat toimet sekä esineiden ja ihmisten tunnistaminen ja vieraassa ympäristössä suunnistaminen vaikeutuvat.

Lievässä dementiassa muistivaikeudet haittaavat jokapäiväisiä toimintoja, mutta eivät estä itsenäistä elämää. Keskivaikeassa dementiassa kognitiivisten kykyjen heikentyminen haittaa merkittävästi itsenäistä elämää ja arjessa selviytymistä. Vaikea dementia ilmenee täydellisenä kyvyttömyytenä painaa mieleen uutta informaatiota, aiemmin opitusta on jäljellä vain sekavia katkelmia.

Dementian riskitekijät

Dementiaan sairastumiselle voi olla geneettinen alttius. Sydän- ja verisuonitaudit, korkea verenpaine, unenpuute ja tupakointi kasvattavat dementian riskiä.

Tavallisimmat dementiaa aiheuttavat sairaudet ovat Alzheimerin tauti, vaskulaariset dementiat sekä aivovammat. Yleisin aiheuttaja on Alzheimerin tauti, josta johtuu 65–75 prosenttia keskivaikeista ja vaikeista dementioista. Muita aiheuttajia tai taustatekijöitä ovat muun muassa Parkinsonin tauti, lihaskipuja aiheuttava aivo-selkäydintulehdus eli krooninen väsymysoireyhtymä, HIV, kuppa, Lymen borrelioosi, Huntigtonin, Creutzfeldt-Jakobin taudit), Lewyn kappale -tauti, hoitamaton alkoholismi ja eräiden lääkeaineiden tai huumeiden pitkäaikainen käyttö. Myös eräiden ravintoaineiden, kuten jodin tai niasiinin, puute voi aiheuttaa dementiaa.” Wikipedia

Alzheimerin tauti

Alzheimerin tauti aiheuttaa Suomessa noin 70 prosenttia dementioista. Suomessa on arviolta noin 80 000 eriasteista Alzheimerin tautiin sairastunutta.

Alzheimerin tauti aiheuttaa harmaan aivokudoksen tuhoutumista ja aivojen surkastumista. Vuonna 2011 julkaistun tutkimuksen mukaan diabetes, korkea verenpaine, ylipaino, tupakointi, masennus, liikunnan puute ja vähäinen koulutus muodostavat jopa puolet Alzheimerin taudin kokonaisriskistä. Muita riskitekijöitä ovat altistuminen torjunta-aineille, insuliiniresistenssi, alle kuusi vuotta kestänyt koulunkäynti, suvullinen alttius, korkea kolesteroli, aivoverenkiertohäiriöt, heikentynyt glukoosinsieto ja mahdollisesti vakavat aivovammat. – Wikipedia

On myös havaittu, että mitä useampi hammas ihmiseltä puuttuu, sitä suurempi riski hänellä on sairastua Alzheimerin tautiin.


Faktat

– Alzheimerin tauti on yleisin dementia
– Alzheimeriin ei tunneta parannuskeinoa ja se johtaa lopulta kuolemaan
– Useimmilla ensimmäiset oireet alkavat 60 ikävuoden jälkeen
– Sairastumiselle on vahva perinnöllinen alttius

Mahdollisia syitä

Alzheimerin syytä ei tunneta. Beeta-amyloidin ja tau-proteiinin kertyminen aivoihin voi viitata ongelmiin aivojen glymfaattisen puhdistusjärjestelmän toiminnassa. Tämä voisi olla seurausta unen huonosta laadusta. Kliiniset havainnot tukevat oletusta siinä mielessä, että uniongelmat lisäävät Alzheimerin taudin riskiä.

Alzheimerin tauti voi myös olla tulehduksellinen sairaus, joka aiheutuu aivojen lepotilassa olevien bakteerien tai virusten aktivoitumisesta immuunijärjestelmän heikkenemisen seurauksena. Myös tulehduksen aiheuttamien happiradikaalien vaikutusta oireiden aiheuttajana on tutkittu mm. Oulun yliopistossa. Teoriaa tukee kliiniset löydöt, sillä Alzheimerin tautia sairastavien verestä löytyy tulehdukseen viittaavia tulehdusmarkkereita.


Vaikuttavatko terveelliset elämäntavat dementian riskiin?


” In this retrospective cohort study that included 196 383 participants of European ancestry aged at least 60 years without dementia at baseline, participants with a high genetic risk and unfavorable lifestyle score had a statistically significant hazard ratio for incident all-cause dementia of 2.83 compared with participants with a low genetic risk and favorable lifestyle score. A favorable lifestyle was associated with a lower risk of dementia and there was no significant interaction between genetic risk and healthy lifestyle.” JAMA


Terveet elämäntavat laskevat dementian riskiä

JAMA:n julkaisema tuore tutkimus tarkasteli elämäntapojen vaikutusta dementiaan sairastumisen riskiin. Dementiaan ja sen yleisimpään muotoon, Alzheimerin tautiin, ei tunneta parannuskeinoa tai ehkäisevää lääkitystä. Sen sijaan kasvava tutkimusnäyttö viittaa siihen, että elintavoilla on huomattava merkitys sairastumisen riskiin.

Tutkimuksessa havaittiin, että ihmisillä, joilla on korkea perinnöllinen riski sairastua dementiaan, sairastumisen riski laski merkittävästi terveiden elämäntapojen noudattamisen seurauksena.

Tutkimus osoitti, että tupakoimattomuus, vähäinen alkoholin käyttö, säännöllinen liikunta ja terveellinen ruokavalio laskivat sairastumisen riskiä niilläkin, joilla perinnöllinen alttius sairastua dementiaan oli olemassa.

JAMA:n julkaisemassa tutkimuksessa seurattiin 196 383 terveen yli 60-vuotiaan riskiä sairastua dementiaan. Terveellisiä elintapoja noudattaneista 1,13 % sairastui dementiaan myöhemmin elämässä, kun taas vähemmän terveitä elämäntapoja noudattavista 1,78% sairastui dementiaan. Tilastollisesti ero on merkittävä.

Tutkittavat liittyivät seurantaan 2006-2010 välisenä aikana ja heidän elintapojaan ja terveyttä seurattiin 2016-2017 asti.

”Tutkimus antoi jännittäviä tuloksia, sillä se osoitti, että dementian riskiä voi laskea terveitä elintapoja noudattamalla myös silloin, kun sairastumiselle on olemassa vahva geneettinen alttius,” totesi tutkimukseen osallistunut Elzbieta Kuźma (Exeter Medical School).

Tutkimusta arvioitaessa on hyvä muistaa, että siihen osallistui vain eurooppalaistaustaisia ihmisiä, jotka raportoivat elintavoistaan itse.

”While this well-conducted study adds to data suggesting that a healthy lifestyle can help prevent dementia in many people, it is important to remember that some people will develop dementia no matter how healthy their lifestyle,” – Tara Spires-Jones (UK Dementia Research Institute)

Spires-Jones, joka työskentelee aivotutkimukseen keskittyvän tiedekunnan varajohtajana Edinburghin yliopistossa, ei osallistunut tähän tutkimukseen. ”Tarvitsemme lisää tutkimustietoa aivojen sairastumista aiheuttavista muutoksista, jotta voimme kehittää tehokkaita tapoja ehkäistä dementiaa ja hoitaa sairastuneita,” Spires-Jones sanoi.

Toinen Alzheimerin tautia käsittelevässä konferenssissa esitelty tutkimus sisälsi samanlaisia havaintoja elintapojen vaikutuksesta Alzheimerin tautiin, kuin JAMA:n julkaisema tutkimus. Siinä analysoitiin kahden tutkimusprojektin yhdeksän vuoden aikana keräämää dataa (Chicago Health and Aging Project & Rush Memory and Aging Project).

Tässä tutkimuksessa havaittiin, että niillä ihmisillä, jotka omaksuivat neljä viidestä terveellisestä elintavasta (terveellinen ruokavalio, 150 minuuttia liikuntaa viikossa, vähäinen alkoholin käyttö, tupakoimattomuus ja henkisesti haasteelliset harrastukset) Alzheimerin taudin riski laski jopa 60 % niihin nähden, jotka omaksuivat vain yhden oheisista terveellisistä elintavoista.

Konferenssissa esitellyt muut tutkimukset osoittivat, että alkoholia paljon nauttivien naisten riski sairastua dementiaan kasvoi selvästi vähän alkoholia käyttäneisiin verrokkeihin nähden. Myös tupakointi voi tutkimusten mukaan liittyä kognitiivisten kykyjen heikentymiseen jo keski-iässä.

Aiemmissa tutkimuksissa on osoitettu, että terveet elämäntavat ehkäisevät joitain dementiatyyppejä, muuta tutkijat eivät vielä tiedä miksi näin on. Alzheimerin tauti on kuudenneksi yleisin kuolinsyy Yhdysvalloissa, josa tautiin sairastuneita on noin 5,8 miljoonaa. Tutkijat ennakoivat sairastuneiden määrän kasvavan 14 miljoonaan vuoteen 2050 mennessä.

”Vaikka Alzheimerin tautiin ei tunneta parantavaa hoitoa, kasvava tutkimusnäyttö tukee oletusta, että terveiden elämäntapojen noudattaminen tukee aivojen terveyttä ja laskee kognitiivisten sairauksien riskiä, ” sanoi johtava tutkija Maria C. Carrillo (Alzheimer’s Association).

Lähteitä:

https://edition.cnn.com/2019/07/14/health/dementia-risk-lifestyle-study/index.html

https://fi.wikipedia.org/wiki/Dementia#cite_note-7

https://fi.wikipedia.org/wiki/Alzheimerin_tauti

https://edition.cnn.com/2013/08/23/health/alzheimers-disease-fast-facts/index.html

https://jamanetwork.com/journals/jama/fullarticle/2738355




Atkinsin dieetti

Atkinsin dieetti on tunnetuin pysyvään laihtumiseen tähtäävä vähähiilihydraattinen ruokavalio.

Atkinsin mukaan insuliinilla on tärkeä rooli rasvan varastoimisessa ja rasvakudoksen rakentamisessa. Atkinsin dieetin tavoitteena on hiilihydraatteja rajoittamalla laskea haiman erittämän insuliinin määrää verenkierrossa, mikä Atkinsin mukaan vähentää rasvan varastoitumista rasvakudokseen, tehostaa varastoidun rasvan ”polttamista” energiaksi ja auttaa laihtumaan.

Amerikkalainen kardiologi Robert Atkins laati Atkinsin dieetin 1970-luvun alussa. Ruokavalio on kehittynyt vuosikymmenten saatossa. Nykyisin Atkinsin dieetti kehottaa täydentämään liha- ja rasva-painotteisen ruokavalion laihduttavia vaikutuksia runsaskuituisilla, vähän tärkkelystä sisältävillä kasviksilla ja liikunnalla.

Kahden viikon vähähiilihydraattisen induktiovaiheen tavoitteena on käynnistää ketoosi. Induktion jälkeen hiilihydraattien määrää lisätään varovasti jatkuvan laihtumisen, esiylläpidon- ja ylläpidon vaiheiden aikana, kunnes ihannepaino saavutetaan.


Atkinsin dieetti ja aineenvaihdunta


Ketoosi on aineenvaihdunnan tila, joka käynnistyy, kun ravinnosta saatavien hiilihydraattien määrä ei riitä täyttämään elimistön energiantarvetta. Hiilihydraateista saatava glukoosi on elimistön ensisijainen ”polttoaine”, mutta aineenvaihdunta osaa tuottaa tarvitsemansa energian myös rasvasta ja proteiineista. Kun glukoosi ei täytä energiantarvetta, aineenvaihdunta aloittaa energiantuotannon rasvoista.

Kun veren insuliinipitoisuus laskee, haiman erittämän glukagonin määrä veressä lisääntyy. Glukagoni käynnistää maksaan ja lihaksiin varastoitujen glykogeenien purkamisen vereen glukoosi- eli sokerimolekyyleiksi. Glukagonin vaikutuksesta maksassa ja munuaisisten kuoriosissa alkaa glukoneogeneesi ja ketogeneesi sekä rasvahappojen hiiliä asetyylikoentsyymi-A:ksi hapettavan β-oksidaatio.

Ketoosissa vapaista rasvahapoista muodostetaan ketoaineita, joita solut voivat käyttää energiantuotantoon.

Ketoosin aikana rasvasoluista vapautuu rasvahappoja verenkiertoon. jolloin aineenvaihdunta alkaa hyödyntää vapaita rasvahappoja energianlähteenä.

Ketoosi ja varastorasvojen hyödyntäminen

Glukoneogeneesin käynnistyessä elimistö alkaa muodostaa glukoosia vapaista aminohapoista, rasvojen glyseroliosista ja maitohaposta. Glukoneogeneesin rinnalla käynnistyy ketogeneesi.

Ketogeneesi vähentää glukoosin tuottamisen tarvetta, mikä säästää vapaita aminohappoja solujen uusiutumiseen.

Ketogeneesi muodostaa verenkierron vapaista rasvahapoista ketoaineita (asetoasetaatti, beeta-hydroksibutyraatti), joita useimmat solut pystyvät käyttämään energianlähteenä palauttaen ketoaineet asetyylikoentsyymi-A:ksi, joka on suoraan käytettävissä oksidatiiviseen energiantuotantoon sitruunahappokierron kautta mitokondrioissa samaan tapaan kuin glukoosi.

Insuliini

Insuliini, jolla on keskeinen merkitys Atkinsin ajattelussa, on ihmiselle elintärkeä sokeriaineenvaihduntaa säätelevä hormoni, jota erittyy haiman Langerhansin saarekkeiden β-soluista, kun hiilihydraateista ohutsuolesta verenkiertoon imeytyvä sokeri (glukoosi) nostaa veren sokeripitoisuutta.

Vereen erittyneet insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, mikä saa solussa olevat solukalvon läpäisevät glukoosinsiirtäjäproteiinit siirtymään solukalvolle. Näiden avulla glukoosimolekyylit pääsevät verestä solun sisälle.

Solussa glukoosimolekyylit osallistuvat energiantuotantoon glykolyysissä ja sitruunahappokierrossa. Ylimääräinen glukoosi varastoidaan lihasten ja maksan glykogeeneihin ja / tai muutetaan rasvasynteesin avulla varastorasvaksi.

Veren sokeripitoisuuden kasvu lisää insuliinin eritystä. Verensokerin lasku puolestaan aktivoi haimaa erittämään glukagonia, jonka vaikutuksesta maksan ja lihassolujen glykogeenejä puretaan glukoosimolekyyleiksi. Kun glykogeenivarastot tyhjentyvät, elimistö siirtyy ketoosiin ja alkaa tuottaa energianlähteiksi kelpaavia ketoaineita mm. rasvahapoista.

Insuliinireseptori

Insuliinireseptorin tehtävä on ohjata veren sokeria siirtävät proteiinit kuten SLC2A4 solukalvolle, edelleen ohjata näiden reseptoreiden suorittamaa glukoosin siirtoa soluihin ja glykogeenin sekä rasvahappojen synteesiä.

Insuliinimolekyylin elinkaari kestää noin 71 minuuttia. Haiman erittämästä insuliinista suuri osa on tavallisesti kiinnittyneenä maksan insuliinireseptoreihin. Osa insuliinista vapautuu reseptoreista takaisin verenkiertoon. Insuliinimolekyylit voivat hajota verenkierrossa monella tavalla.

Endoteliinit

Verenkierrossa insuliini stimuloi myös endoteliinien, eli verisuonten endoteelisolujen tuottamien peptidihormonien tuotantoa. Endoteliinit säätelevät verisuonten sileiden lihassyiden supistumista ja osallistuvat verenkierron paikalliseen säätelyyn. Endoteliinit voivat myös paksuntaa ja jäykentää verisuonia, mikä kohottaa verenpainetta ja altistaa sydän- ja verisuonitaudeille.


Atkinsin dieetti käytännössä


Atkinsin ruokavalioon sopivat vähähiilihydraattiset vihannekset, proteiinit ja rasvat.

Atkinsin kehittämässä ruokavaliossa hiilihydraattien saantia ravinnosta vähennetään rajusti, mutta rasvojen ja proteiinien määrää ei tavallisesti rajoiteta lainkaan.

Atkinsin mukaan prosessoidut hiilihydraatit, sokerit, maissisiirappi ja valkoiset jauhot ovat lihomisen tärkeimmät aiheuttajat. Atkins ei usko perinteiseen kaloriteoriaan.

Atkinsin ruokavalion päämääränä on vähentää glykeemistä kuormaa ja tehostaa laihtumista.

Glykeeminen kuorma (GL) ja glykeeminen indeksi (GI) kertovat ravinnon sisältämien hiilihydraattien laadusta, määrästä ja imeytymisnopeudesta. Sitä voidaan hyödyntää arvioitaessa aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen.

Nopeilla ja hitailla hiilihydraateilla viitataan korkean glykeemisen indeksin hiilihydraatteihin ja matalan glykeemisen indeksin hiilihydraatteihin. Yleensä nopean glykeemisen indeksin hiilihydraatteja pidetään terveyden ja painonhallinnan kannalta huonompina kuin hitaasti imeytyviä hiilihydraatteja.

Glykeeminen kuorma

Glykeeminen kuorma voidaan laskea, ja siten selvittää syödyn ravinnon vaikutus veren sokeriin ja elimistön insuliinivasteeseen. Suuri hiilihydraattimäärä ja hiilihydraattien korkea glykeeminen indeksi kasvattavat ravinnon glykeemista kuormaa. Glykeemisen indeksin ja kuorman ymmärtäminen on erityisen tärkeää diabeetikoille.

Glykeeminen kuorma lasketaan seuraavasti: aterian glykeeminen indeksi x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa määritettäessä lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Glykeeminen indeksi

Glykeeminen indeksi määrittelee ruoka-aineen imeytyvien hiilihydraattien aiheuttaman vaikutuksen verensokeriin verrattuna referenssiruoka-aineeseen kuten glukoosiliuokseen tai valkoiseen leipään.

Hiilihydraatin korkea GI kertoo, että se kohottaa verensokeria nopeasti ja vereen vapautuu paljon insuliinia. Matala GI kertoo, että hiilihydraattien imeytyminen on hitaampaa ja tasaisempaa.

Runsaasti prosessoidut hiilihydraatit, kuten leivokset, karamellit ja valkoinen leipä sekä runsaasti tärkkelystä sisältävät hiilihydraatit, kuten perunat ja riisi, ovat korkean glykeemisen indeksin ruokia ja ne kohottavat verensokeri- ja insuliinitasoja nopeasti aterian jälkeen. Määrä on kuitenkin laatua keskeisemmässä asemassa, joten glykeeminen kuorma on parempi indikaattori aterian vaikutuksista verensokeri- ja insuliinitasoihin.

Jotkin hiilihydraatit, kuten kaura, kohottavat veren glukoositasoja hitaasti ja tasaisesti. Niiden glykeeminen indeksi on matala.

Nettohiilihydraatit

Nettohiilihydraattien määrä saadaan, kun hiilihydraattien kokonaismäärästä vähennetään kuidut ja sokerialkoholit. Sokerialkoholeilla on minimaalinen vaikutus veren sokeripitoisuuteen. Atkinsin mukaan parhaita hiilihydraatteja ovat ne, joiden glykeeminen kuorma on vähäisin.

Vitamiinit lisäravinteina

Atkinsin ruokavaliossa vältetään monia mineraali- ja vitamiinirikkaita vihanneksia ja hedelmiä, joten vitamiini- ja mineraalilisien ottaminen on suositeltavaa Atkinsin dieetin aikana.

Kuinka Atkinsin ruokavalio toimii?

Atkinsin ruokavalion neljä perustavoitetta:  

  • Laihtuminen
  • Painonhallinta
  • Hyvä terveys
  • Sairauksien ehkäisy

Atkinsin ruokavalion tavoitteena on muuttaa elimistön energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Se muistuttaa monin tavoin muita vähähiilihydraattisia ruokavalioita, kuten ketogeenistä ruokavaliota.

Hiilihydraattien korvaaminen rasvalla ja proteiineilla ohjaa elimistön käyttämään energianlähteenä ravinnon sisältämien rasvojen lisäksi kehoon varastoituneita rasvoja.

Aloittaminen

Atkinsin dieetti aloitetaan kahden viikon idnuktiovaiheella, jossa hiilihydraattien saanti rajoitetaan alle 20 grammaan vuorokaudessa. Tavoitteena on elimistön ketoositilan nopea saavuttaminen.

Induktion jälkeen hiilihydraattien määrää nostetaan kuukausien mittaan eri vaiheissa vähitellen, kunnes saavutetaan ihannepaino ja sopiva ylläpitotaso.

Ruokavalion laihduttava vaikutus perustuu siihen, että elimistö oppii käyttämään energianlähteenä rasvasoluihin varastoimiaan rasvoja, kun energia-aineenvaihdunnan kannalta nopeita ja helppoja hiilihydraatteja ei ole tarjolla ja veren insuliinitaso pidetään hiilihydraatteja rajoittamalla matalana.

Toisaalta Atkinsin ruokavalio hillitsee myös ruokahalua, jolloin ravinnosta saatava energiamäärä laskee luonnostaan.

Huomioi ennen Atkinsin dieetin aloittamista!

Jos sairastat jotain kroonista sairautta ja syöt siihen säännöllisesti lääkkeitä, sinun on syytä neuvotella lääkärin tai ravitsemusasiantuntijan kanssa ennen Atkinsin ruokavalion aloittamista.
Eräillä lääkkeillä, kuten insuliinilla, voi Atkinsin ruokavaliota noudatettaessa olla odottamattomia ja negatiivisia vaikutuksia.

Muista juoda riittävästi

Atkinsin dieetti on diureettinen, eli nesteitä poistava, joten myös nesteitä poistavien lääkkeiden ja muiden diureettien, kuten kahvin ja alkoholin välttäminen on suotavaa dieetin aikana. Riittävän nesteensaannin turvaaminen ja kehon nestetasapainon ylläpitäminen on Atkinsin ruokavaliossa erittäin tärkeää. Nestehukka aiheuttaa yleensä päänsärkyä, joten Atkinsin ruokavalioon liittyvä päänsärky viittaa usein liian vähäiseen nesteytykseen.

Diabeetikoilla insuliinintarve muuttuu Atkinsin ruokavalion seurauksena, joten on ehdottoman tärkeää, että diabetesta sairastavat neuvottelevat Atkinsin ruokavalioon siirtymisestä lääkärin kanssa ja noudattavat ruokavaliota asiantuntijan tai lääkärin valvonnassa.


Induktio ja syöminen


Atkinsin ruokavaliossa ketoosi käynnistetään nopeasti pudottamalla syötyjen hiilihydraattien määrä alle 20 grammaan vuorokaudessa. Tämä induktiovaihe jatkuu kaksi viikkoa. Proteiineja ja rasvaa voi induktiovaiheen aikana syödä nälkäänsä rajoituksetta.

Ruokavalioon sopivat kaikki lihat, kalat, linnut, äyriäiset, kananmunat ja juustot ja vihannekset, joissa on alle 10 % hiilihydraatteja. Atkinsin ruokavaliossa ei syödä induktio-, laihdutus- ja esiylläpitovaiheen aikana hedelmiä, viljoja, margariinia, tärkkelystä (kuten perunat, riisi, maissi), pastoja tai vähärasvaisia maitotuotteita.

Hiilihydraattien rajoittamisesta seuraava verensokerin lasku aktivoi haiman erittämään insuliinin vastavaikuttajaa, glukagonia, joka käynnistää ketogeneesin ja glukoneogeneesin. Glukagoni myös aktivoi soluissa tapahtuvan β-oksidaation käynnistymisen.

β-oksidaatio

β-oksidaatio tapahtuu solujen mitokondrioissa ja peroksisomeissa. Oksidaatiossa ravinnon ja rasvasolujen rasvahappojen β-hiiliä hapetetaan karbonyyleiksi. Reaktioketju tapahtuu neljässä vaiheessa:

– Dehydraus
– Hydraatio
– Hapetus-pelkistysreaktio
– Tiolyysi

Reaktiosarja toistuu, kunnes rasvahappo on kulunut loppuun. Joka toistossa rasvahapoista poistuu 2 hiiltä asetyylikoentsyymi-A:na. Tiolyysin asetyylikoentsyymi-A siirtyy yleensä sitruunahappokiertoon mennen siten ATP:n tuottoon. Muissa vaiheissa saadut NADH ja FADH2 päätyvät ATP:n tuottoon menemällä mitokondrion elektroninsiirtoketjuun. Lähde: Wikipedia


Kuvakaappauksen lähde. Wikipedia

Ketoosin käynnistyminen

Tavoitteena oleva ketoosi saavutetaan yleensä parissa viikossa, kun maksan ja lihasten polysakkarideista muodostuvat glykogeenivarastot tyhjenevät. Tämän vaiheen tavoitteena on katkaista energia-aineenvaihdunnan hiilihydraattiriippuvuus ja siirtää elimistön aineenvaihdunta käyttämään sokerin sijasta rasvaa ja varastorasvoja energianlähteenä.

Atkinsin ruokavalion alkuvaiheessa elimistöstä poistuu paljon nesteitä. Ensimmäisen puolentoista viikon aikana painonpudotus johtuu pääasiassa elimistöstä poistuvista nesteistä.


Atkinsin dieetti sisältää neljä vaihetta


Vaihe 1: Induktio

Hiilihydraattien saanti lasketaan alle 20 grammaan päivässä. Päivittäiset hiilihydraatit saadaan hyvin vähän tärkkelystä ja hiilihydraatteja sisältävistä vihanneksista.

Ruokavaliossa syödään runsaasti rasvaa ja proteiineja sekä salaatteja tms. vihreitä lehtivihanneksia.

Vaihe 2: Jatkuva laihtuminen / tasapainottaminen

Ravinnerikkaita ja runsaasti kuituja sisältäviä ruokia lisätään päivittäiseen ruokavalioon. Hiilihydraattien päivittäistä määrää nostetaan viidellä grammalla kerrallaan niin kauan kuin laihtuminen jatkuu.

Sallittuihin ruokiin sisältyvät edellisten lisäksi mm. pähkinät, vähähiilihydraattiset vihannekset ja vähäinen määrä hedelmää.

Vaihe 3: Esiylläpitovaihe

Hiilihydraattien määrää nostetaan tasolle, jossa painonpudotus hidastuu tai loppuu. (25-90 g /vuorokausi), kun dieetissä on päästy noin viiden kilon päähän tavoitepainosta. Tämä esiylläpitovaihe jatkuu vähintään 2 kuukautta siten, että painoa putoaa alle puoli kiloa viikossa.

Vaihe 4: Ylläpitovaihe

Kun asetettu tavoitepaino on saavutettu, siirrytään Atkinsin dieetissä ylläpitovaiheeseen. Laihduttaja lisää ruokavalioonsa monipuolisesti erilaisia hiilihydraatteja, mutta tarkkailee samalla, että paino pysyy vakiona, eikä lähde kasvuun. Ylläpitovaiheessa ketoosi ei enää ole tarpeellinen.

Ylläpitovaiheen aikana voi jo syödä lihan ja rasvan lisäksi monipuolisemmin useimpia vihanneksia, pähkinöitä, marjoja ja kokojyväviljoja sekä joskus hiukan perunaa ja hedelmiä. Lisättyä sokeria ei suositella. Alkoholia ja kahvia tulee käyttää kohtuudella. Robert Atkinsin mukaan liikunta on tärkeä osa Atkinsin laihdutusohjelmaa.

Atkins suositteli, että tyydyttyneen rasvan osuus päivittäisestä energiansaannista pysyisi alle 20 prosentissa.

Atkins 40:

Atkinsin ruokavaliosta on olemassa erilaisia variaatioita. Atkins 40 on hieman helpompi noudattaa, sillä alun induktiovaiheessa saa syödä 40 grammaa hiilihydraatteja vuorokaudessa.

Atkinsin ruokavaliota noudatettaessa omaan hyvinvointiin tulee kiinnittää huomiota. Ruokavalio ei välttämättä sovi kaikille. Jos paino alkaa nousta, päivittäisten hiilihydraattien määrää tulee jälleen laskea laihduttavalle tasolle.

Atkins ja kasvisruokavalio

Atkinsin dieetin noudattaminen kasvisruokavaliona on ongelmallista, koska kasviproteiinit esiintyvät yleensä yhdessä hiilihydraattien kanssa. Dieetistä voi toisaalta muokata kasvisruokavalion, kun siihen sisällyttää maitotuotteita ja kananmunia. Lakto-ovovegetaristinen Atkinsin dieetti suositellaan aloittamaan kakkosvaiheesta, eli jatkuvan painonpudotuksen vaiheesta, jossa hiilihydraattien määrä pidetään 30 grammassa vuorokaudessa.

Atkinsin kasvisversio sisältää runsaasti kasviöljyjä. Myös vegaaninen Atkinsin dieetti on mahdollinen, jos hiilihydraattien määrä pidetään 50 grammassa päivässä, mutta siinä proteiinien saannin kanssa on oltava erityisen tarkkana. Proteiininlähteiksi soveltuvat esimerkiksi siemenet, pähkinät, soijaruoat, kvinoa ja vegaanisessa Atkinsin dieetissä myös palkokasvit.

Mitä Atkinsin dieetissä saa ja ei saa syödä

Syötävät ruoat:

Laihduttajat saavat syödä avokadoja, sillä ne sisältävät terveellisiä rasvoja.

  • kaikki lihat ovat
  • rasvaiset kalat ja äyriäiset
  • munat
  • avokadot
  • vähän hiilihydraatteja sisältävät vihannekset, kuten valkokaali, parsakaali ja parsa
  • täysirasvaiset maitotuotteet, kuten juustot
  • pähkinät ja siemenet
  • terveelliset rasvat, kuten neitsytoliiviöljy, kookosöljy ja avokadoöljy

Dieettiin sopivia juomia ovat vesi, kahvi ja vihreä tee

Päivän ruokavalio on esimerkiksi tällainen:

  • Aamiainen: Juustomunakas ja vähän hiilihydraatteja sisältäviä vihanneksia
  • Lounas: Kanasalaatti ja pähkinöitä
  • Päivällinen: Lihapullia ja vähähiilihydraattisia vihanneksia

Välipaloiksi sopivat esimerkiksi pähkinät, siemenet, kananmunat ja kreikkalainen jogurtti

Vältettävät ruoat:

  • sokeri, virvoitusjuomat, leivokset ja makeiset
  • kaikki viljat, kuten vehnä, speltti ja riisi
  • vähärasvaiset laihdutusruoat, koska niissä rasva on usein korvattu hiilihydraateilla
  • palkokasvit, kuten linssit, pavut, herneet

Induktiovaiheen aikana runsashiilihydraattisia hedelmiä, kuten banaaneita, omenoita ja rypäleitä sekä runsashiilihydraattisia vihanneksia, kuten porkkanoita, tulee välttää.

TL;DR

Atkinsin mukaan verensokeri ja pohjukaissuolen erittämä GIP-hormoni stimuloivat insuliinin eritystä ja insuliinia tarvitaan rasvan ja sokereiden varastoimiseen rasvasoluihin. Rasvasoluissa myös sokerimolekyyleistä syntetisoidaan rasvahappoja. Insuliinin erityksen vähentäminen hiilihydraattien rajoittamisella vähentää rasvan varastoitumista, tehostaa varastorasvojen käyttämistä energiaksi ja auttaa laihduttamaan.


Kritiikki


”Insuliinilla on aineenvaihdunnassa muitakin tehtäviä. Verensokerin ohella se säätelee myös rasvahappojen siirtymistä verestä rasvasoluihin, jotka varastoivat ne rasvana. Varastorasva on juuri sitä tuttua rasvaa, jota nimitämme läskiksi. – – – Vaikka päättely insuliinista saattaa kuulostaa loogiselta, se on täysin virheellinen yksinkertaistus. Sen esittäjät ovat poimineet ihmisen aineenvaihdunnasta yhden palan ymmärtämättä rasvan varastoitumisen kokonaisuutta.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Pertti Mustajoki korostaa, että Atkinsin dieetin laihduttavat ominaisuudet perustuvat siihen, että Atkinsin ruokavaliota noudattava saa ravinnostaan vähemmän kaloreita. Vastakkain ovat klassinen kaloriteoria ja uudempi aineenvaihdunnan erilaisia mekanismeja korostava näkemys. Tutkimuksissa on osoitettu, että vähähiilihydraattinen ruokavalio laihduttaa vähän kaloreita sisältävää ravintoa selvästi tehokkaammin dieetin ensimmäiset kuukaudet, mutta erot ruokavalioiden välillä tasoittuvat noin vuoden laihduttamisen jälkeen.

”Oikeastaan ei tarvita edellä kuvattujen monimutkaisten aineenvaihdunnan tapahtumien tuntemusta. Energian häviämättömyyden lain perusteella voidaan helposti ymmärtää, että painonhallinnassa ruuan rasva ei suinkaan ole viaton. Jos saamme ruuasta energiaa enemmän kuin ”poltamme” eli kulutamme, ainoa mahdollisuus on varastoida se. Ylimääräinen energia ei voi hävitä. Se jää meihin, oli se sitten peräisin hiilihydraateista, proteiinista tai rasvoista.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Kuinka rasvasolut vaikuttavat painonhallintaan?

Rasvasolut eli adiposyytit tai liposyytit ovat kantasoluista kehittyneitä soluja, joiden tärkein tehtävä on varastoida ylimääräistä energiaa. Ihmisillä on kahdenlaisia rasvasoluja: valkoisia rasvasoluja (WAT) ja ruskeita rasvasoluja (BAT).

Ravinnon sisältämä ylimääräinen energia varastoidaan rasvasoluihin. Kun rasvasolut täyttyvät ja kasvavat riittävän suuriksi, ne jakautuvat ja tekevät näin varastoitavalle energialle enemmän tilaa.

Kerran muodostuneet rasvasolut eivät katoa mihinkään, vaikka paino putoaisi. Se on eräs laihduttamisen vaikeuteen vaikuttava tekijä. Laihtumisen ja lihomisen seurauksena rasvasoluihin varastoituneen rasvan määrä vaihtelee; solut eivät katoa.

Valkoiset rasvasolut

Valkoiset rasvasolut ovat yhden nesterakkulan soluja, jotka sisältävät ohuen sytoplasman ympäröimän ”rasvapisaran”. Valkoiset rasvasolut varastoivat ensisijaisesti triglyseridejä.

Valkoiset rasvasolut muistuttavat toiminnaltaan elintä, sillä ne erittävät aineenvaihduntaan vaikuttavia hormoneja, adipokiinejä kuten resistiiniä, adiponektiinia, leptiiniä ja apeliinia. Näillä hormoneilla on suuri vaikutus painonhallintaan. Esimerkiksi rasvasolujen erittämä leptiini kertoo aivoille, kun kehon energiavarastot ovat täyttyneet. Leptiini on siis kylläisyyshormoni.

Mitä enemmän ihmisellä on rasvasoluja, sitä hitaammin kehon energiavarastot täyttyvät ja rasvasolujen kemiallinen viesti energiavarastojen täyttymisestä hidastuu.

Suuri määrä energiatyydyttyneitä rasvasoluja voi aiheuttaa leptiinisignaaleilla eräänlaisen oikosulun aivojen leptiinireseptoreissa. Tällainen aiheuttaa leptiiniresistenssin, jossa aivot eivät enää reagoi kylläisyyshormoniin normaalisti. Kun rasvasolujen määrä kasvaa tai leptiinin toiminta heikkenee, ihminen syö enemmän kuin tarvitsee.

Ihmisellä on keskimäärin 30 miljardia valkoista rasvasolua, joihin on varastoitunut noin 13,5 kiloa rasvaa.

Ruskeat rasvasolut

Ruskeat rasvasolut sisältävät useita nesterakkuloita, joihin on varastoitunut rasvapisaroita. Ruskeat rasvasolut poikkeavat valkoisista rasvasoluista erityisesti koska ne sisältävät runsaasti energiaa tuottavia mitokondrioita. Ruskeaa rasvaa kutsutaan joskus vauvanrasvaksi ja se tuottaa elimistöön lämpöä.

Atkinsin dieetti voi vaikuttaa suotuisasti tyypin 2 diabetesta tai metabolista oireyhtymää sairastavien terveyteen ja vähentää lääkkeiden tarvetta. Diabetekseen erikoistuneet lääkärit varoittavat kuitenkin, että Atkinsin dieetti ei ole yksinkertainen ratkaisu tyypin 2 diabeteksen hoitoon, vaikka hiilihydraattien ja glukoosin saannin seuraaminen on tärkeä osa diabeteksen hoitoa.


Entä vaikutukset – toimiiko Atkinsin dieetti?


Atkinsin ruokavalion tavoitteena on laihtua ja ehkäistä eräitä sairauksia, kuten metabolista oireyhtymää, tyypin 2 diabetesta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja.

Tutkimuksen mukaan useimmat lopettavat Atkinsin ruokavalion noudattamisen 2-3 vuodessa.

Stanfordin yliopiston tutkimuksessa Atkinsin dieettiä noudattavien verenpaine ja kolesterolitasot kehittyivät suotuisaan suuntaan, ja dieetti laihdutti tehokkaammin kuin vertailtavat laihdutusruokavaliot.

Ruokavalion alkuvaiheessa joillain laihduttajilla ilmenee:

  • päänsärkyä
  • huimausta
  • heikotusta
  • väsymystä
  • ummetusta

Atkinsin dieetin puolestapuhujien mukaan ruokavalio sopii painonpudotuksen ohella diabeteksen ja korkean verenpaineen hoitoon. Muunneltua Atkinsin dieettiä käytetään myös lasten vaikean epilepsian lääketieteelliseen hoitoon.

Hyödyt

Ruokavalion kehittäjän Robert Atkinsin mukaan vähähiilihydraattisen ruokavalion etuja ovat:

  • Ruoan määrää tai kalorimäärää ei rajoiteta
  • Nälkää ei tarvitse tuntea
  • Ruokahalu vähenee
  • Ruoansulatus paranee
  • Paino laskee eikä tule takaisin, koska ruokavalio sopii pysyvään painonhallintaan
  • Useimmat ylipainoisuuteen liittyvät terveysongelmat helpottuvat

Atkinsin mukaan vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion myötä veren kolesteroliarvot paranevat ja sydäntautien riski vähenee. Atkinsin mukaansa ruokavalioon liitetyt terveysongelmat eivät johdu rasvasta, vaan 1800-luvun jälkeen yleistyneiden prosessoitujen hiilihydraattien käytöstä.

ketogeenisen ruokavalion hyötyjä:

1. Vähähiilihydraattinen ruokavalio vähentää ruokahalua

Monissa laihdutusruokavalioissa jatkuva näläntunne tuottaa ongelmia. Se johtaa helposti dieetin lopettamiseen. Vähähiilihydraattinen ruokavalio ylläpitää kylläisyyden tunnetta erinomaisesti, vaikka se samalla leikkaa energiansaantia.

Tutkimusten mukaan hiilihydraatteja rasvalla ja proteiineilla korvaavat saavat ravinnosta vähemmän kaloreita kuin hiilihydraattipainotteista ruokavaliota noudattavat.

2. Atkinsin dieetti on tehokkain laihdutusruokavalio ensimmäiset kuukaudet

Hiilihydraattien rajoittaminen on yksinkertaisin ja tehokkain tapa laihtua. Tutkimusten mukaan vähän hiilihydraatteja sisältävää ruokavaliota noudattavat laihtuvat nopeammin kuin laihduttajat, jotka rajoittavat rasvaa ja laskevat kaloreita.

Tutkimuksissa, joissa on vertailtu vähähiilihydraattisen ruokavalion ja vähärasvaisen ruokavalion tehoa laihduttamisessa, on havaittu, että hiilihydraatteja rajoittamalla laihtuu selvästi nopeammin ja enemmän tuntematta nälkää.

Vähän hiilihydraatteja sisältävä dieetti on muita laihdutusruokavalioita tehokkaampi ensimmäisen puolen vuoden aikana, mutta sen jälkeen erot ruokavalioiden välillä tasoittuvat.

3. Viskeraalinen vyötärölihavuus vähenee selvästi

Kaikki rasvat eivät ole samanarvoisia. Pahinta elimistöön kertyvää rasvaa on vatsaonteloon elinten ympärille varastoituva viskeraalinen rasva eli sisälmysrasva.

Sillä mihin kehon osaan rasva varastoituu, on merkitystä terveyden ja sairastumisriskin kannalta. Viskeraalinen rasva on yleisintä ylipainoisilla miehillä. Vyötärölihavuuteen liittyy usein myös maksan rasvoittuminen.

Viskeraalinen rasva kerääntyy vatsaontelossa elinten ympärille ja kasvattaa inflammaation sekä insuliiniresistenssin riskiä.

Vähän hiilihydraatteja sisältävät ruokavaliot, kuten Atkinsin dieetti, vähentävät hyvin tehokkaasti erityisesti vatsaonteloon kerääntyvää viskeraalista rasvaa.

4. Triglyseridien määrä veressä laskee merkittävästi

Triglyseridit ovat verenkierrossa kiertäviä vapaita rasvahappoja. Koholla olevat triglyseridit on tunnettu sydäntautien riskitekijä. Runsaasti hiilihydraatteja sisältävä ravinto ja etenkin fruktoosi kasvattavat veren triglyseridipitoisuutta.

Hiilihydraatteja rajoittavassa ruokavaliossa veren vapaat rasvahapot – triglyseridit siirtyvät ketoaineiden ja energiantuotantoon.

5. Atkinsin ruokavalio lisää hyvän HDL-kolesterolin määrää

HDL tunnetaan ns. ”hyvänä” kolesterolina: ts. mitä enemmän HDL-kolesterolia veressä on suhteessa LDL-kolesteroliin, sitä pienempi sydäntautiriski. Vastaavasti LDL-kolesterolin kasvu kasvattaa sydäntautien riskiä.

Paras tapa lisätä hyvän HDL-kolesterolin määrää, on syödä rasvaa. Atkinsin ruokavalio ja muut ketogeeniset ruokavaliot ovat runsasrasvaisia dieettejä. Lähde1, Lähde2.

6. Veren sokeri- ja insuliinipitoisuus laskee

Vähähiilihydraattiset ja ketogeeniset ruokavaliot saattavat vähentää lääkkeiden tarvetta metabolista oireyhtymää ja tyypin 2 diabetesta sairastavilla. Hiilihydraattien rajoittaminen laskee verensokeria ja veren insuliinitasoja.

Joidenkin aikuistyypin diabetesta sairastavien insuliinintarve laskee Atkinsin ruokavalion myötä jopa 50 %. Yhden tutkimuksen mukaan tyypin 2 diabetesta sairastavista 95 prosenttia vähensi lääkkeiden käyttöä 6 kuukauden sisällä Atkinsin dietiin aloittamisesta. Lähde.

Jos sairastat diabetesta ja aloitat vähähiilihydraattisen ja ketogeenisen ruokavalion, konsultoi asiasta lääkäriäs, sillä riskinä on hypglykemia.

7. Atkinsin ruokavalio voi laskea verenpainetta

Kohonnut verenpaine lisää sydän- ja verisuonitautien riskiä. Vähän hiilihydraatteja sisältävät ruokavaliot voivat joidenkin tutkimusten mukaan laskea verenpainetta.

Lähteitä:

Glykemiakuorma
Ketoosi
What to know about low-carb, high-fat diets
Atkins diet: What is it and should I try it?
Aktins.com
Atkinsin dieetti




Sokeriaineenvaihdunta: Fruktolyysi ja glykolyysi

Hiljattain joukko amerikkalaisia professoreita määritteli sokerin terveydelle haitallisimmaksi ravintoaineeksi.  Sokerin terveydelliset vaikutukset palautuvat erityisesti glukoosin ja fruktoosin aineenvaihduntaan. Kuinka glykolyysi ja fruktolyysi eroavat toisistaan?

Sokereiden aineenvaihdunta

Ravinto sisältää useita sokereita erilaisina molekyylirakenteina. Niiden pilkkominen imeytyvään muotoon alkaa jo suussa. Yleisimmät ravinnosta saatavat sokerit ovat, glukoosi, fruktoosi, laktoosi, galaktoosi ja maltoosi.

Kasvien sisältämä tärkkelys on sokerin varastomuoto. Tärkkelys on monimutkainen glukoosiyksiköistä muodostuva haarautumaton amyloosi tai haarautunut amylopektiini. Se on polysakkaridi, jossa glukoosimonomeerit ovat liittyneet toisiinsa. Kasvit valmistavat tärkkelystä fotosynteesissä. Erityisen tärkkelyspitoisia ravintoaineita ovat esimerkiksi perunat, maissi ja riisi.

Solujen energiantuotannon kannalta glukoosi ja fruktoosi ovat tärkeimpiä sokereita. Niilläkin on omat aineenvaihduntapolkunsa.

Sokereita kuljettavat molekyylit

Glukoosimolekyylejä kuljettavat ohutsuolesta verenkiertoon insuliinin säätelemät GLUT1- ja GLUT4-molekyylit. Fruktoosi ei aktivoi insuliinintuotantoa ja sitä  kuljettavat GLUT5-molekyylit.

Käytännössä GLUT1-molekyyli kuljettaa glukoosimolekyylin ohutsuolen endoteelisoluun ja GLUT4-molekyyli kuljettaa glukoosimolekyylin endoteelisolusta verenkiertoon.

Fruktoosimolekyyli kulkeutuu ohutsuolesta endoteelisoluun GLUT5-molekyylin kuljettamana ja endoteelisolusta verenkiertoon GLUT2-molekyylin kuljettamana.

Sokereita pilkkovat entsyymit

Ruoansulatuskanavassa sokereita pilkkoo joukko entsyymejä, joista tärkkelystä maltoosiksi pilkkova amylaasi on ehkä tutuin. Amylaasi aloittaa tärkkelyksen pilkkomisen jo suussa, johon amylaasia erittyy sylkirauhasista.  Sokereiden pilkkominen imeytyvään muotoon jatkuu vatsassa ja suolistossa. Haima erittää amylaasia ohutsuoleen.

Maltoosi on kahdesta glukoosimolekyylistä muodostuva disakkaridi. Ruoansulatuskanavassa maltoosia pilkkoo suolinesteen maltaasi-entsyymi. Laktoosi eli maitosokeri koostuu glukoosista ja galaktoosista. Laktoosia pilkkoo laktaasi. Sakkaroosi muodostuu fruktoosista ja glukoosista. Sakkaroosia pilkkoo sakkaraasi.

Ruoansulatuskanavassa sokerit pilkotaan yksinkertaisiksi sokerimolekyyleiksi, jotka kulkeutuvat ohutsuolesta verenkertoon sokereille spesifien kuljetusmolekyylien kuljettamina. Sokereiden aineenvaihduntareitit poikkeavat toisistaan.

Esimerkiksi: Aldoosi-1-epimeraasi (GALM) muuttaa β-D-galaktoosin ensin α-D-galaktoosiksi. Tämä muutetaan edelleen UDP-glukoosiksi kolmen pääasiallisen entsyymin avulla (GALK, GALT ja GALE). UDP-glukoosi (uracil-diphosphate glucose) on nukleotidin, eli nukleiinihappojen (DNA, RNA) rakenneyksikön sokeriosa. Nukleotidiin kuuluu kolme osaa, emäs, sokeriosa ja fosfaatti. Galaktoosi vaikuttaa siis nukleiinihappojen aineenvaihduntaan ja rakenteeseen.

Pöytäsokeri on fruktoosia ja glukoosia

Tavallinen pöytäsokeri on ruokosokeria eli sakkaroosia, joka muodostuu yhtäläisestä määrästä glukoosia ja fruktoosia. Sakkaroosi on disakkaridi, jossa kaksi erilaista sokerimolekyyliä on tiukasti sitoutunut toisiinsa.

Glukoosi (rypälesokeri) on elimistön tärkein energianlähde. Glukoosi on yhdestä sokerimolekyylistä muodostuva monosakkaridi. Myös glukoosia selvästi makeampi fruktoosi (hedelmäsokeri) on yhdestä sokerimolekyylistä muodostuva monosakkaridi.

Kasveissa sakkaroosi on yleinen. Sitä on paljon esimerkiksi sokeriruo’ossa, sokerijuurikkaassa, ananaksessa, maississa ja porkkanassa.

Ruoansulatus pilkkoo hiilihydraateista ja tärkkelyksestä yksinkertaisia ohutsuolesta verenkiertoon imeytyviä sokerimolekyylejä. Glukoosi ja fruktoosi ovat yleisimmät ravinnosta saatavat sokerit, mutta ne eivät toimi elimistössä aivan samalla tavalla. Näiden sokereiden reaktioketjut eroavat aineenvaihdunnan kannalta merkittävästi toisistaan.

Fruktoosi ja fruktolyysi

Fruktoosi

Fruktoosi on yhdestä fruktoosimolekyylistä muodostuva monosakkaridi, jota esiintyy luonnostaan hedelmissä, marjoissa ja vihanneksissa joko vapaina fruktoosimolekyyleinä, kahdesta sokerimolekyylistä muodostuvina disakkarideina (kuten ruokosokeri) tai fruktoosin polymeerina (inuliini).

Inuliini on fruktoosista muodostunut varastopolysakkaridi, jossa on 30-50 fruktoosimolekyyliä. Inuliinia esiintyy mm. maa-artisokassa, sipulissa, parsassa, banaanissa, rukiissa, vehnässä, mustajuuressa, ohrassa sekä asterikasvien, kuten daalian, voikukan ja sikurin juurissa ja juurimukuloissa. Inuliinia käytetään elintarviketeollisuudessa makeutusaineena. Se sisältää noin kolmanneksen vastaavan sokerimäärän energiasta.

Teollinen fruktoosi

Fruktoosi on makeampaa kuin glukoosi, joten sitä käytetään yleisesti makeutusaineena. Tavallinen kidesokeri sisältää 50:50 suhteessa glukoosia ja fruktoosia. Fruktoosia saa runsaasti mm. hedelmistä ja marjoista. Teollisesti valmistettua fruktoosia ja fruktoosisiirappia käytetään yhä useammissa elintarvikkeissa.

Edullinen nestemäinen fruktoosisiirappi on syrjäyttämässä perinteisen sakkaroosin yleisimpänä makeutusaineena. Amerikkalaisessa ruokavaliossa päivittäisestä energiansaannista jopa 10 % saadaan fruktoosista. Jos suomalaisen päivittäisestä energiansaannista 10% on peräisin lisätystä sokerista, silloin fruktoosin osuus energiansaannista voi olla jopa 5 %.

Teollinen fruktoosi korreloi vahvasti monien kardiometabolisten sairauksien kanssa. Tätä selittää todennäköisesti fruktoosin glukoosista poikkeava aineenvaihdunta. Erityisen ongelmallista on fruktoosisiirapista nopeasti elimistöön imeytyvät vapaat fruktoosimolekyylit, jotka voivat horjuttaa sokeriaineenvaihdunnan toimintaa, rasittaa maksaa ja altistaa esimerkiksi alkoholista riippumattomalle rasvamaksalle.

Huomio: Korrelaatio fruktoosisiirapin ja kardiometabolisten sairauksien välillä on vahva, mutta kausaliteettia ei välttämättä ole osoitettu.

Fruktolyysi

Fruktoosin aineenvaihdunta tapahtuu pääasiassa maksassa. Maksan lisäksi fruktolyysiä tapahtuu jonkin verran ohutsuolessa, luurankolihaksissa, kiveksissä, rasvakudoksessa ja aivoissa.

Noin prosentti syödystä fruktoosista muutetaan maksassa suoraan plasman triglyserideiksi. 29-54% fruktoosista syntetisoidaan maksassa glukoosiksi. Neljännes fruktoosista muutetaan laktaatiksi eli maitohapon suoloiksi tai estereiksi. 15-18% fruktoosista syntetisoiduista glykoosimolekyyleistä varastoidaan glykogeenien polymerisaatiossa polysakkarideina glykogeeneiksi.

Glykogeenit ovat tuhansista glukoosimolekyyleistä muodostavia pitkäketjuisia ja pitkähaaraisia polysakkarideja.

Glykogeenien polymerisaatio

Glykogeenin polymerisaation lähtöaineina toimivat sokeri-nukleotidit, joissa sokerimonomeeri on aktivoitu kiinnittämällä siihen nukleotidi. Glykogeenin polymerisaatiossa vaikuttavat glykogeenisyntaasi, joka liittää glukoosimolekyylejä pitkään ketjuun sekä entsyymi, joka tekee glykogeeniin haarakohtia. Koska glykogeenisyntaasi voi vain lisätä glukoosimolekyylejä valmiiseen ketjuun, tarvitaan oma entsyymi aloittamaan glykogeenin valmistus (glykogeniini). Lähde: Solunetti

Kehon solut voivat käyttää fruktolyysin syntetisoimaa glukoosia ja laktaattia energianlähteenä solujen glykolyysissä. Aineenvaihdunta voi myös purkaa maksaan ja lihassoluihin varastoituneita fruktoosista valmistettuja glykogeenejä glukagonin stimuloimana glykogenolyysissä, jolloin vereen vapautuu glukoosia. Tämä mekanismi turvaa solujen energiansaannin ruokailujen välillä sekä raskaissa fyysisissä suorituksissa.

Alhainen verensokeri aktivoi haiman erittämään glukagonia, joka purkaa maksan ja lihasten glykogeenejä glukoosiksi. Glukagoni aktivoi myös maksassa ja munuaisissa tapahtuvaa glukoneogeneesiä, ketogeneesiä sekä rasvojen β-oksidaatiota. Matala verensokeri aktivoi rasvan käyttämistä energianlähteenä.

Glykolyysi

Kaikki solut saavat energiaa glukoosista. Solu saa energiantuotantoon tarvittavan glukoosin joko solun ulkopuolelta, josta se kulkeutuu soluun osmoottisesti eli suuremmasta pitoisuudesta pienempään, tai purkamalla solun sisäisen glykogeenin glukoosimolekyyleiksi.

Glykolyysi on solulimassa tapahtuva monimutkainen reaktiosarja, jossa glukoosimolekyylit hajotetaan kahdeksi palorypälehapon anionimuodoksi eli pyruvaatiksi.

Yhdestä glukoosimolekyylistä saadaan kahden pyruvaattimolekyylin lisäksi kaksi ATP-molekyyliä ja kaksi NADH-molekyyliä. Solujen anaerobinen energiansaanti perustuu glykolyysiin.

Soluhengitys

Jos solussa on mitokondrioita ja happea, energiantuotanto jatkuu sitruunahappokierrossa (Krebsin sykli). Eräiden entsyymien avustuksella pyruvaateista saadaan mitokondrioissa tapahtuvassa oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Rasvahapot hajoavat energiaksi pääasiassa hapettumalla β-oksidaatiossa siten, että rasvahappoketjusta irtoaa kahden hiilen asetyyliryhmiä, jotka ovat kiinnittyneenä reaktioon osallistuvaan koentsyymi-A:han.

Asetyylikoentsyymi-A eli aktiivinen etikkahappo on kaikille ravintoaineille yhteinen välituote solun valmistaessa energiaa. Asetyylikoentsyymi-A:ta saadaan monosakkarideista, triglyserideista sekä aminohapoista erilaisten reaktiovaiheiden kautta. Asetyylikoentsyymi-A:n asetyyliryhmän hiilet hapettuvat hiilidioksidiksi Krebsin syklissä ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, esimerkiksi ATP:ksi. Lähde: Wikipedia

Anaerobinen ja aerobinen glykolyysi

Soluissa, joissa ei ole mitokondrioita (esim. veren punasolut) tai riittävästi happea, pyruvaatti pelkistyy maitohapoksi. Maitohappoon pelkistyvää glykolyysiä kutsutaan anaerobiseksi glykolyysiksi ja asetyylikoentsyymi-A:han päättyvää glykolyysiä aerobiseksi glykolyysiksi.

Asetyylikoentsyymi-A:han päättyvän reaktiossa glukoosimolekyylistä jää jäännöstuotteena hiilidioksidia ja vettä, jotka poistuvat kehosta ihon ja hengityksen kautta.

Laktaatin muodostuminen ei tuota energiaa, mutta se on välttämätöntä, jotta saadaan pelkistyneet NADH-molekyylit takaisin hapettuneeseen NAD+-muotoon, jota tarvitaan glykolyysissä.

 Glykolyysin vaiheet (Lähde: Wikipedia – Glykolyysi)

  1. Glukoosiin liitetään fosfaattiryhmä ATP:ltä heksokinaasin tai glukokinaasin avulla, jolloin syntyy glukoosi-6-fosfaattia. Heksokinaasia inhiboi glukoosi-6-fosfaatti ja glukokinaasia fruktoosi-6-fosfaatti. Lisäksi insuliini aktivoi glukokinaasin transkriptiota tumassa.
  2. Glukoosi-6-fosfaatti muutetaan fosfoheksoosi-isomeraasin avulla fruktoosi-6-fosfaatiksi.
  3. Fruktoosi-6-fosfaatti fosforyloidaan ATP:n avulla fruktoosi-1,6-bisfosfaatiksi. Tätä reaktiota katalysoi fosfofruktokinaasi-1 eli PFK-1. PFK-1:tä inhiboi ATP, sitraatti ja H+. Aktivoivia molekyylejä ovat puolestaan AMP ja fruktoosi-2,6-bisfosfaatti.
  4. Fruktoosi-1,6-bisfosfaatti muutetaan aldolaasi A:n:n avulla dihydroksiasetonifosfaatiksi ja glyseraldehydi-3-fosfaatiksi.
  5. Dihydroksiasetonifosfaatti muutetaan trioosifosfaatti-isomeraasin avulla glyseraldehydi-3-fosfaatiksi.
  6. Neljännen ja viidennen vaiheen reaktioista saaduista glyseraldehydi-3-fosfaateista muodostetaan glyseraldehydi-3-rosfaattidehydrogenaasin avulla 1,3-bisfosfoglyseraattia. Samalla NAD+ pelkistyy NADH:ksi.
  7. 1,3-bisfosfoglyseraatti defosforyloidaan fosfoglyseraattikinaasin avulla 3-fosfoglyseraatiksi. Samalla ADP fosforyloituu ATP:ksi.
  8. 3-fosfoglyseraatti muutetaan fosfoglyseraattimutaasin avulla 2-fosfoglyseraatiksi.
  9. 2-fosfoglyseraatti muutetaan enolaasin avulla fosfoenolipyruvaatiksi.
  10. Fosfoenolipyruvaatti defosforyloidaan pyruvaattikinaasin avulla pyruvaatiksi. Samalla ADP fosforyloituu ATP:ksi. Pyruvaattikinaasia inhiboivat ATP, alaniini ja glukagoni. Aktivoiva molekyyli on puolestaan glykolyysin kolmannessa vaiheessa muodostuva fruktoosi-1,6-bisfosfaatti.

Glukoosin ja fruktoosin aineenvaihduntaan osallistuu samoja entsyymejä ja solujen rakenteita sekä niitä yhdistäviä reaktioketjuja, mutta monista yhtäläisyyksistä huolimatta niiden aineenvaihdunta eroaa toisistaan merkittävällä tavalla.

Fruktoosi ei stimuloi insuliinin eritystä

Fruktoosi ei stimuloi insuliinin eritystä samalla tavalla kuin glukoosi, eikä sen pääsy soluihin ole insuliinista riippuvainen. Glukoosin aineenvaihdunta puolestaan tarvitsee insuliinia.

Insuliinin tuotannon loppuminen tyypin 1 diabeteksessa sekä solujen kasvanut insuliiniresistenssi tyypin 2 diabeteksessa aiheuttavat sen, että solut eivät saa energiantuotannossa tärkeää glukoosia, vaan glukoosimolekyylit jäävät verenkiertoon, jossa ne vaurioittavat verisuonia ja sisäelimiä.

Veren glukoosipitoisuus stimuloi haiman insuliinineritystä. Insuliinin säätelemät kuljetusmolekyylit (GLUT1 ja GLUT4) kuljettavat glukoosin soluihin. Fruktoosin kuljetusmolekyyli on GLUT5.

Haiman erittämä insuliini kiinnittyy solujen insuliinireseptoreihin, mikä käynnistää soluissa toisioviestintäjärjestelmän. Se houkuttelee solun sisällä olevan solukalvon läpäisevän glukoosinsiirtokanavan solukalvolle. Glukoosi pääsee tämän avulla solun sisälle, jossa glukoosimolekyyli osallistuu energiaa tuottavaan glykolyysiin.

Sokereiden rakenne

Monosakkaridit, kuten fruktoosi ja glukoosi voivat olla joko avoketjuisia tai renkaita, mutta elimistössä monosakkaridien vallitsevana muotona on rengasmainen rakenne.

Rengasmaisessa rakenteessa anomeerihiileksi kutsutaan hiiltä, joka on lähimpänä karbonyyliryhmää muodostavaa hiiltä. Karbonyyliryhmästä aloitetaan monosakkaridien hiilten numerointi. Hiiliketjun pituus monosakkaridissa voi olla kolme tai suurempi. Tärkeimpiä elimistössä esiintyviä monosakkarideja ovat heksoosit, joissa on kuuden hiiliatomin ketju.

  • Trioosi: kolme hiiliatomia
  • Totroosi: neljä hiiliatomia
  • Pentoosi: viisi hiiliatomia
  • Heksoosi: kuusi hiiliatomia
  • Heptoosi: seitsemän hiiliatomia

Karbonyyliryhmä koostuu toisiinsa kaksoissidoksella kiinnittyneistä hiili- ja happiatomeista. Esimerkkejä karbonyyliryhmän sisältävistä yhdisteistä ovat: aldehydi, ketoni, karboksyylihappo, esteri ja amidi. Karbonyyliryhmä antaa näille yhdisteille niille ominaisen kemiallisen luonteen.

Fruktolyysi ja glykolyysi ovat itsenäisiä metabolisia reaktioketjuja (metabolic pathway)

 ”Suuri osa syödystä glukoosista kulkeutuu maksan läpi luurankolihaksiin, jossa se metaboloituu glykolyysissa ja edelleen sitruunahappokierrossa ensin pyruvaateiksi ja edelleen hiilidioksidiksi (CO2), hapeksi (H2O) ja ATP-molekyyleiksi, tai rasvasoluihin, jossa glukoosimolekyyleistä metaboloidaan glyserolifosfaattia triglyseridien synteesiin ja energiantuotantoon.”

Fruktoosin aineenvaihdunta syntetisoi maksassa glykogeenejä ja de novo lipogeneesissä rasvahappoja ja triglyseridejä.

Tämä synteesi voidaan jakaa kahteen päävaiheeseen:

  1. Trioosien, dihydroksiasetonin (DHAP) ja glyseraldehydin synteesi.
  2. Toisessa vaiheessa trioosit jatkavat aineenvaihduntaa joko glukoneogeneesissä, täyttävät maksan glykogeenejä ja/tai fruktolyysin reaktioketjussa pyruvaatiksi; pyruvaatti muutetaan sitruunahappokierrossa sitraatiksi ja lopuksi de novo synteesissä vapaista rasvahapoista syntetisoidaan palmitiinihappoa.

Palmitiinihappo

Palmitiinihappo on yleisin tyydyttynyt rasvahappo sekä eräs yleisimmistä rakenneosasista eläin- ja kasvirasvoissa. Esimerkiksi ihrassa ja voissa on 25 % palmitiinihappoa. Myös ihmisen rasvasta 25 % on palmitiinihappoa. Palmitiinihapon estereitä ja suoloja kutsutaan palmitaateiksi.

Trioosit ovat kolmesta hiiliatomista muodostuvia monosakkarideja. Dihydroksiasetoni on kaksi hydroksyyliryhmää sisältävä ketoni. Glyseraldehydi on yksinkertaisin monosakkarideista. Se on makea yhdiste, jota syntyy hiilihydraattien hajoamisen seurauksena.

Fruktoosi metaboloituu DHAP:ksi ja glyseraldehydiksi

Fruktoosin aineenvaihdunnan ensimmäinen askel on fruktoosin fosforylaatio, jossa fruktokinaasi muuttaa fruktoosimolekyylin fruktoosi-1-fosfaatiksi. Tämä reaktioketju sitoo fruktoosin aineenvaihdunnan maksaan.

Maksassa esiintyy myös heksokinaasi IV-entsyymiä (Glukokinaasi), joka voi fosforyloida vähäisestä määrästä fruktoosia fruktoosi 6-fosfaattia (glukoneogneettisen reaktioketjun välivaihe). Käytännössä kaikki fruktoosimolekyylit fosforyloidaan maksassa kuitenkin fruktoosi-1-fosfaatiksi.

Kuvakaappaus: Wikipedia

Toisaalta suurin osa glukoosimolekyyleistä jää fosforyloimatta ja kulkee maksan läpi rasvakudokseen ja luurankolihaksiin insuliiniriippuvaisen glukoosinkuljetusmolekyylin (GLUT4) kuljettamana.

Fruktoosi-1-fosfaatti hydrolysoidaan fruktoosi-1fosfaatti aldolaasin (aldolaasi B) avulla dihydoksiasetonifosfaatiksi (DHAP). Dihydroksiasetonifosfaatti on orgaaninen molekyyli, joka esiintyy välituotteena monissa biokemiallisissa reaktioissa, esimerkiksi glykolyysissä. Aldolaasi eli fruktoosi-1,6-bisfosfaattialdolaasi on entsyymi, joka osallistuu glykolyysiin ja glukoneogeneesiin katalysoimalla fruktoosi-1,6-bisfosfaatin reversiibeliä hajoamista glyseraldehydi-3-fosfaatiksi tai glyseraldehydiksi ja dihydroksiasetonifosfaatiksi.

DHAP voi isomerisoitua glyseraldehydi-3-fosfaatiksi, tai glyseroli-3-fosfaatiksi. Glyseraldehydi kinaasi voi muuttaa glyseraldehydin glyseraldehydi-3-fosfaatiksi tai glyseroli-3-fosfaatiksi.

Fruktoosin aineenvaihdunnan tuottamat väliaineet voivat osallistua glukoneogeneesiin ja glykogeenin synteesiin, tai ne voidaan hapettaa pyruvaatiksi ja edelleen laktaatiksi, tai dekarboksyloida asetyylikoentsyymi-A:ksi mitokondrioissa sekä edelleen siirtää vapaiden rasvahappojen synteesiin ja lopulta triglyseridien synteesiin.

Kuva: Fruktoosin aineenvaihdunta dihydroksifosfaatiksi (DHAP), glyseraldehydiksi ja glyseraldehydi-3-fosfaatiksi maksassa.

Glykogeenin synteesi dihydroksiasetonifosfaatista ja glyseraldehydi-3-fosfaatista

Fruktoosin aineenvaihdunta jatkuu glukoneogeneesin lähtöaineista. Fruktoosista metaboloidaan aluksi dihydroksiasetonifosfaattia (DHAP) ja glyseraldehydia fruktokinaasin ja aldolaasi B:n katalysoimana.

Lisääntynyt DHAP- ja glyseraldehydi-3-fosfaatin konsentraatio maksassa ohjaa glukoneogeneesin reaktioketjun kohti glukoosi-6-fosfaattia, glukoosi-1-fosfaattia ja glykogeenin synteesiä.

Fruktoosi on parempi substraatti glykogeenin synteesille kuin glukoosi. Glykogeenivaraston täydennys on etusijalla triglyseridien synteesiin nähden. Kun maksan glykogeenivarasto on täydennetty, fruktoosin ylimääräiset aineenvaihduntatuotteet jatkavat triglyseridien synteesiin.

Kuva: Fruktoosin aineenvaihdunta glykogeeniksi maksassa

Triglyseridien synteesi dihydroksiasetonifosfaatista ja glyseraldehydi-3-fosfaatista

Ravinnosta saatu ylimääräinen fruktoosi voidaan muuttaa pyruvaatiksi ja siirtää sitruunahappokiertoon, jossa se muutetaan edelleen sitraatiksi, tai ohjata reaktiosarjaa vapaiden rasvahappojen synteesiin soluliman nestemäisessä sytosolissa. Fruktolyysin syntetisoima DHAP voidaan muuttaa glyseroliksi ja edelleen glyseroli-3-fosfaatiksi triglyseridien synteesiin de novo lipogeneesissa.

”Thus, fructose can provide trioses for both the glycerol 3-phosphate backbone, as well as the free fatty acids in TG synthesis. Indeed, fructose may provide the bulk of the carbohydrate directed toward de novo TG synthesis in humans.

Kuva: Triglyseridien synteesi maksassa

Maksassa fruktoosi aktivoi useita rasvahappojen synteesiin (lipogeneesi) osallistuvia insuliinista riippumattomia entsyymejä. Nämä ovat: pyruvate kinase, NADP+-dependent malate dehydrogenase, citrate lyase, acetyl CoA carboxylase, fatty acid synthase, pyruvate dehydrogenase.

Runsaasti teollista fruktoosia sisältävän ravinnon on havaittu altistavan hypertriglyseridemialle eli veren liialliselle triglyseridipitoisuudelle.

”The hypertriglyceridemic effects observed are a hallmark of increased dietary carbohydrate, and fructose appears to be dependent on a number of factors including the amount of dietary fructose consumed and degree of insulin resistance.”

Fruktoosin aineenvaihdunnan virheet

Fruktoosin aineenvaihduntaan vaikuttavien kahden tärkeän entsyymin puutos aiheuttaa kaksi synnynnäistä hiilihydraattien aineenvaihdunnan virhettä.

Fruktokinaasin puutos aiheuttaa essentiaalisen fruktosurian. Fruktokinaasi osallistuu reaktioketjuun, jossa fruktoosi muutetaan fruktoosi-1-fosfaatiksi. Tämän entsyymin puutoksen seurauksena fruktoosin aineenvaihdunta jää epätäydelliseksi, jolloin fruktoosia erittyy virtsaan. Fruktosuria on perinnöllinen tila, joka ei kuitenkaan aiheuta kliinisiä oireita, sillä fruktoosi voidaan metaboloida fruktoosi-6-fosfaatiksi heksokinaasin avulla esimerkiksi rasva- ja lihaskudoksissa.

Fruktoosin imeytymishäiriö ja perinnöllinen fruktoosi-intoleranssi

Fruktoosin imeytymishäiriö on ruoansulatuskanavan häiriö, jossa fruktoosin imeytyminen ohutsuolesta verenkiertoon on heikentynyt fruktoosinkuljetusmolekyylien vähäisyyden vuoksi. Imeytymishäiriön oireita ovat mm. vatsakipu, turvotus, ilmavaivat ja ripuli.

Fruktoosin imeytymishäiriö muistuttaa oireiltaan ärtyvän suolen oireyhtymää sekä laktoosi-intoleranssia.

Fruktoosin imeytymishäiriötä ei pidä sekoittaa mahdollisesti hengenvaaralliseen perinnölliseen fruktoosi-intoleranssiin, jossa maksassa fruktoosia pilkkovat entsyymit eivät toimi oikein.

Fruktoosi imeytyy ohutsuolesta ilman ruoansulatusentsyymien apua. Terveen henkilön ohutsuoli pystyy kerrallaan imeyttämään ohutsuolesta verenkiertoon 25-50 grammaa fruktoosia. Fruktoosin imeytymishäiriötä sairastavilla jo alle 25 g fruktoosiannos voi aiheuttaa vatsavaivoja. Sorbitoli voi edelleen heikentää fruktoosin imeytymistä ja lisätä vatsavaivoja. Imeytymätön fruktoosi fermentoituu suolistobakteerien vaikutuksesta ja lisää suolistokaasujen muodostumista.

Monet runsaasti fruktoosia sisältävät hedelmät, esimerkiksi omenat, päärynät, mangot ja vesimelonit, voivat aiheuttaa oireita fruktoosin imeytymishäiriötä sairastavalla. Oireita voi tulla myös runsaasti fruktoosia sisältävästä pöytäsokerista, hunajasta, maissisiirapista, rusinoista, hedelmämehuista ja fruktaaneista (FODMAP).

Fruktoosin imeytyshäiriöön ei ole parantavaa hoitoa, mutta sen aiheuttamia oireita voi välttää minimoimalla fruktoosin saannin. Myös FODMAP-ruokavalio voi auttaa oireiden helpottamisessa. Lähde: Wikipedia

Perinnöllinen fruktoosi-intoleranssi (HFI)

Perinnöllinen fruktoosi-intoleranssi (HFI) johtuu synnynnäisestä aldolaasi B-entsyymin puutoksesta. Puutoksen seurauksena sakkaroosi, fruktoosi ja sorbitoli aiheuttavat oireita synnynnäistä fruktoosi-intoleranssia sairastavilla. Aldolaasi-B entsyymin puutos johtaa fruktoosi-1-fosfaatin kerääntymiseen maksasoluihin, munuaisiin ja ohutsuoleen. Ajan mittaan tämä johtaa maksasolujen tuhoutumiseen. HFI vaikuttaa myös glukoneogeneesiin, glykogenolyysiin ja adenosiinitrifosfaatin (ATP) regeneraatioon. HFI aiheuttaa mm. pahoinvointia, oksentelua, kouristeluja, ärtyisyyttä, hypoglykemiaa, keltatautia, verenvuotoa, maksan liikakasvua sekä mahdollisesti munuaisten vajaatoimintaa. HFI voi johtaa kuolemaan, mutta se on melko harvinaista.

Kuva: Fruktolyysin ja glykolyysin aineenvaihdunta




Ravinto vaikuttaa syövän riskiin

Hilary Brueck raportoi Business Insiderissa laajasta kansainvälisestä seurantatutkimuksesta, joka osoitti yhteyden ruokatottumusten ja syövän riskin väliltä. 18.9.2018 julkaistu tutkimus seurasi 471 495 eurooppalaisen aikuisen ruokatottumusten ja syövän yhteyttä keskimäärin 15 vuoden ajan.

Tutkimus vahvisti aiempia havaintoja, joiden mukaan suuri annoskoko, runsas punaisen lihan, suolan ja lisätyn sokerin saanti, tyydyttyneitä rasvoja sisältävät ruoat, pikaruoat, snacksit ja alkoholi kasvattavat syöpien riskiä. Runsaasti tuoreita hedelmiä, vihanneksia ja palkokasveja sekä rasvaista kalaa ja vähärasvaista lihaa syövien riski sairastua syöpään oli pienempi ja yleinen terveys parempi.

PLOS Medicine-lehden julkaisema tutkimus osoitti, että runsaasti elimistön tarvitsemia ravinteita sekä vähän energiaa sisältävällä ruokavaliolla voi jonkin verran laskea yleisten syöpien riskiä. Vähän ravinteita ja runsaasti energiaa sisältävä ruokavalio puolestaan kasvatti hieman syöpään sairastumisen riskiä.

Tutkimuksen tehneet 56 tutkijaa seurasivat 471 495 ihmisen ravintotottumuksia kymmenessä Euroopan maassa keskimäärin 15 vuoden ajan.

”In this study, we observed a higher risk of cancer for people eating, on average, more foods with a high content in energy, sugar, saturated fat, or sodium,” the study’s lead author, Mélanie Deschasaux, told Business Insider in an email, giving examples such as processed meats, pastries, and cola.

Seurantatutkimuksessa ravintoarvoiltaan heikointa ruokavaliota noudattavien riski sairastua syöpiin oli 7 % korkeampi kuin niillä, jotka noudattivat kasvispainotteisempaa ja kevyempää ruokavaliota.

Vahvin korrelaatio ravintotottumusten ja syöpien välillä havaittiin seuraavien syöpien kohdalla:

  • Paksusuolen syöpä
  • Vatsasyöpä
  • Suun syövät (huulisyöpä, kielisyöpä)
  • Keuhkosyöpä (miehillä)
  • Maksa- ja rintasyöpä (naisilla)

Tutkimus

Tutkimuksessa kontrolloitiin syövän riskiin vaikuttavia muita muuttujia, kuten seurattujen perinnöllinen alttius sairastua johonkin syöpään, fyysinen aktiivisuus, tutkittavan painoindeksi ja tupakointi.

Näistä yleisistä syöpien riskiä kasvattavista muuttujista riippumatta epäterveellisen ruokavalion osoitettiin kasvattavan eräiden syöpien riskiä. Henkilöt, jotka söivät paljon pikaruokaa, lisättyjä sokereita, runsaasti suolaa, tyydyttyneitä rasvoja ja punaista lihaa sairastuvat todennäköisemmin syöpään kuin ravintoarvoiltaan rikkaampaa runsaasti hedelmiä ja kasviksia syövät henkilöt.

Ravinteiltaan heikoimpia ruokia syötiin runsaimmin Isossa-Britanniassa, Saksassa ja Ranskassa. Välimeren maissa ja Norjassa ihmiset olivat tutkimuksen mukaan keskimäärin terveempiä.

Tutkimus tukee kasvavaa näyttöä siitä, että kasvispainotteinen ja paljon kuituja sisältävä ravinto korreloi pitkän iän ja terveyden kanssa. Prosessoidut ruoat näyttävät sen sijaan kasvattavan erilaisten sairauksien riskiä ja lyhentävän odotettavissa olevaa elinaikaa.

Yleinen havainto ravitsemusta käsittelevissä tutkimuksissa on ollut, että paljon tuoreita hedelmiä ja vihanneksia, terveellisiä rasvoja kuten oliiviöljyä, avokadoja ja pähkinöitä sekä terveellisiä kuituja sisältävä Välimeren ruokavalio assosioituu pidempään ja terveempään elämään.

Helmikuussa julkaistu 100 000 aikuisen ruokatottumuksia analysoinut ranskalaistutkimus osoitti, että eniten prosessoituja ja pakattuja valmisruokia, sipsejä ja keksejä, sokeroituja muroja, pakasteaterioita ja makeutettuja virvoitusjuomia syövillä oli kasvanut riski sairastua mihin tahansa syöpään verrattuna niihin, jotka söivät vähemmän prosessoituja ja vähemmän sokereita sisältävää ruokia.

Lisäämällä ruokavalioon hyviä kuituja sisältäviä täysjyväviljoja sekä kasviksia, hedelmiä, hyviä rasvanlähteitä ja kasviproteiineja syövän ja erityisesti paksusuolen syövän riskiä voi hieman laskea. Prosessoitujen, runsaasti sokeria, suolaa ja huonoja rasvoja sisältävän ravinnon yleistymisen (”pikaruokakulttuurin”) vaikutus on havaittavissa paksusuolen syövän yleistymisenä erityisesti nuorilla.

Ruoansulatus ei voi pilkkoa sulamattomia ravintokuituja elimistön ravinnoksi, mutta ne parantavat suoliston hyvinvointia nopeuttamalla ruokamassan kulkua suolistossa. Samalla kuidut ja resistentti tärkkelys hyödyntävät suoliston mikrobiomia, joka vaikuttaa elimistön hyvinvointiin monin tavoin.

Ravintokuidut pienentävät suolistosyöpien riskiä. Tämä perustuu ainakin osittain siihen, että kuituja pilkkovat suoliston mikrobit tuottavat lyhytketjuisia rasvahappoja, kuten butyraattia, joka ehkäisee kasvainten kehittymistä paksusuoleen.

” Lyhytketjuisia terveydelle tärkeitä suolistossa syntyviä rasvahappoja, tai tarkemmin niiden suoloja, ovat asetaatti, propionaatti ja erityisesti butyraatti. Lyhytketjuisilla rasvahapoilla on kokeellisissa tutkimuksissa syöpää, infektioita ja suolistoinflammaatiota estävää vaikutusta. Ne myös auttavat suoliston pintaa uusiutumaan ja pysymään terveenä.” – Lähde: Pronutritionist

Täysjyväviljoista saatavat kuidut ovat erityisen hyviä suoliston terveydelle, koska viljan kuoriosat ja alkiot (bran & germ) stimuloivat hapetusstressiä vähentävien antioksidanttien toimintaa ja sisältävät useita hyviä ravinteita, kuten sinkkiä, kuparia ja E-vitamiinia.

Lähde: Business Insider




Kuinka ravinto ja elintavat vaikuttavat MS-taudin etenemiseen? Osa 3:

Kuinka ravinto ja elintavat vaikuttavat MS-taudin etenemiseen? Osa 3 jatkaa ravinnon ja elintapojen vaikutuksen selvittämistä MS-taudin ja siihen assosioituvien oireiden taustalla.

Mitä eroa on infektiolla ja inflammaatiolla?

Autoimmuunitaudin voi laukaista jokin infektio, kuten Epstein-Barr- tai herpesvirus. Inflammaatio altistaa sairastumiselle ja pahentaa immuunivälitteisten tulehduksellisten sairauksien oireita. Eräät ravintoaineet aiheuttavat oksidatiivista stressiä, joka ylläpitää ja pahentaa inflammaatiota.    

Infektio ja inflammaatio menevät helposti sekaisin, koska molemmat kertovat tulehduksesta. Ne eivät kuitenkaan tarkoita samaa asiaa.

Infektion aiheuttama lyhytaikainen tulehdus (tartuntatulehdus) auttaa elimistöön tunkeutuneen sairastuttavan mikrobin tuhoamisessa. Jatkuva matala-asteinen tulehdus (inflammaatio) on kudoksia ärsyttävä tila, joka voi kehittyä mm. vamman, ravinnon (postbrandiaalinen tulehdus), tupakoinnin, alkoholin ja eräiden toksiinien sekä joidenkin tuntemattomien syiden seurauksena, kuten eräät autoimmuunitulehdukset (esimerkiksi reuma).

Matala-asteinen tulehdus ei tavallisesti näy ulospäin tai oireile kipuna. Tutkimukset viittaavat siihen, että matala-asteinen tulehdus on kuitenkin lähes kaikkien kroonisten tautien osatekijä.

”Ne ruoka-aineet, jotka vähentävät tulehdusta tuntuvat edistävän ihmisen terveyttä muutoinkin. Ruokavalio, joka vähentää voimallisesti tulehdusta, vähentää myös kolesterolia, verenpainetta, aterian jälkeistä hapetusstressiä, LDL-kolesterolin hapettumista ja verensokeria aterian jälkeen ja paastossa sekä estää lihomista.” – Pronutritionist

Infektio siis puolustaa elimistöä mikrobeja vastaan. Pitkään jatkuva matala-asteinen inflammaatio on elimistölle haitallinen tila, koska se voi aiheuttaa kudosvaurioita. Wikipedian mukaan autoimmuunitulehdus vahingoittaa elimistöä immuunipuolustuksen hyökätessä elimistön omia soluja vastaan.

C-reaktiivinen proteiini eli CRP

Elimistön tulehduksista kertoo verinäytteestä mitattava CRP eli C-reaktiivinen proteiini. CRP on maksan syntetisoima akuutin infektion proteiini, joka sitoutuu solun erilaisiin ainesosiin, kuten polysakkarideihin, lipideihin, nukleiinihappoihin, nukleotideihin sekä kationeihin kuten hepariiniin, protamiiniin ja histoineihin.

CRP on komplementtijärjestelmän aktivoija, joka edistää vierasaineiden opsonisaatiota ja fagosytoosia. CRP osallistuu luontaiseen immuniteettiin ja vierasaineiden eliminointiin. Opsonisaatio on prosessi, jossa infektoivan patogeenin pintaan tarttuu siihen erikoistunut vasta-ainemolekyyli eli opsoniini, jonka avulla syöjäsolut (fagosyytit) tunnistavat ja tuhoavat patogeenit.

CRP:n pitoisuus veressä nousee bakteeri-infektioiden ja muiden tulehdustilojen sekä kudosvaurion yhteydessä nopeasti. CRP:n normaali viitealue on alle 10 mg/l, mutta infektion aikana CRP:n määrä voi kasvaa jopa 1000-kertaiseksi viitealueeseen verrattuna.

Ruokavalio, laihtuminen ja CRP

Lihavuus on matala-asteisen inflammaation yksi tärkeä syy. Laihtuminen voi laskea inflammaatiota mittaavaa CRP-arvoa jopa 80 %. Myös ruokavalio vaikuttaa tulehdusta mittaavaan CRP-arvoon. Terveellinen ruoka, kuten kasvikset, marjat, hedelmät ja kala voivat laskea tulehdusarvoja jopa kolmanneksella.

Wikipedia kertoo, että jo muutaman päivän vesipaasto vahvistaa kehon immuunijärjestelmää taistelussa tulehduksia vastaan. Vastaavia tuloksia on saatu kerran tai kahdesti kuussa toteutettavilla nelipäiväisillä niukan ravinnon jaksoilla.

Elimistö näyttäisi pääsevän paaston ja niukan dieetin avulla eroon immuunijärjestelmän vahingoittuneista ja vanhentuneista osista, joka johtaa immuunijärjestelmän uusiutumiseen (Kari Tyllilä: Yllättävä löytö voi tuoda apua syöpähoitoihin: Paasto uudistaa immuunijärjestelmää).

Tulehdus ja sytokiinit

Sytokiinit ovat immuunijärjestelmän säätelijöitä. Ne ohjaavat immuunijärjestelmän kaikkien solujen erilaistumista, kasvua ja toiminnallista säätelyä. Sytokiini on yleisnimitys yli sadalle pienimolekyyliselle proteiinirakenteiselle välittäjäaineelle.

Valkosolut tuottavat sytokiineihin lukeutuvia interferoneja virusinfektion aikana. Interferonien tarkoituksena on estää virusten lisääntyminen infektion alkuvaiheessa. Proinflammatoristen eli inflammaatiota lisäävien interferonien (sekä happiradikaalien) ensisijaisena tehtävänä on tappaa elimistöön päässeitä viruksia, bakteereita ja ja sieniä.

Jos immuunivasteeseen osallistuvia sytokiineja tai happiradikaaleja muodostuu elimistössä liikaa, ne vaurioittavat kudoksia ja altistavat sairastumiselle.

Beetainterferoneja käytetään MS-taudin oireita hillitsevänä lääkkeenä. Toisaalta gammainterferoni, jota naisilla muodostuu luonnostaan miehiä enemmän, assosioituu suurina pitoisuuksina MS-taudin puhkeamiseen ja pahenemiseen.

Tärkeät sytokiinit

Kuva sytokiinien merkityksestä ja hierarkkisista säätelyverkoista tarkentuu koko ajan. Sytokiineja on tunnistettu yli sata. Pelkästään interleukiiniperheeseen kuuluvia sytokiineja tunnetaan 29. Sytokiinien tutkimus tarjoaa uusia lähestymistapoja myös autoimmuunitautien ja syöpien hoitoon.

Immuunijärjestelmän kannalta keskeisiä sytokiinejä ovat interleukiinit (IL), interferonit (IFN), tuumorinekroositekijä alfa (TNF-α), ja solutyyppispesifiset kasvutekijät, kuten granulosyyttikasvutekijä (G-CSF) ja erytropoietiini (EPO).

Sytokiinien eritys lisääntyy infektion aikana, mikä vahvistaa elimistön puolustautumista taudinaiheuttajia vastaan. Immuunivasteeseen ja infektion torjuntaan osallistuvat ainakin proinflammatoriset sytokiinit, kuten IL-1, IL-6, TNF- α.

IL-17 on nopeasti kasvava sytokiiniperhe, jonka jäsenet eroavat rakenteellisesti muista sytokiineista. IL-17 on keskeinen sytokiini MS-taudin patogenesissä (Gold & Lühder, Interleukin-17 – Extended Features of a Key Player in Multiple Sclerosis).

Monet sytokiinit aiheuttavat ja ylläpitävät elimistön matala-asteista tulehdusta. Toisaalta sytokiinit voivat olla myös inflammaatiota vähentäviä eli anti-inflammatorisia, kuten mm. IL-4, IL-10 ja TGF- β.

Sytokiinien säätelyverkot

Sytokiinit muodostavat toiminnalllisia verkostoja. Yksittäinen sytokiini vaikuttaa tavallisesti useisiin solutyyppeihin, mutta sen aikaansaamat vasteet eri soluissa voivat olla täysin erilaiset.

Monissa immuunivälitteisissä tulehduksellisissa sairauksissa aktivoituu osin samanlainen sytokiiniverkosto, mutta yksittäisen sytokiinin merkitys eri sairauksien patogeneesissa voi vaihdella paljonkin. Yhtenä esimerkkinä tuumorinekroositekijä (TNF-α), joka vaikuttaa mm. nivelreuman, selkärankareuman, tulehduksellisten suolistotautien ja psoriaasin patogeneesissa.

Sytokiinit toimivat ajallisesti ja paikallisesti tarkan säätelyn alaisina hierarkkisina säätelyverkostoina. Jos säätely jostakin syystä pettää, sytokiinien ylituotanto voi toimia laukaisevana mekanismina monissa sairauksissa, kuten autoimmuunitaudeissa.

Sytokiinireseptoreiden signalointi

Sytokiinien biologiset vaikutukset välittyvät solun pinnalla sijaitsevien erityisten reseptoreiden kautta. Interferonien, useimpien interleukiinien ja solutyyppispesifisten kasvutekijöiden (EPO, TPO, GM-CSF, G-CSF) reseptorit välittävät vaikutuksensa hematopoieettiseen sytokiinireseptoriperheeseen kuuluvien reseptoreiden kautta.

Kaikkien reseptroreiden aktivaatiomekanismi on samankaltainen: sytokiinin sitoutuminen reseptorin solunulkoiseen osaan saa aikaan ketjuen pariutumisen ja johtaa reseptoriin kiinnittyneiden JAK-tyrosiinikinaasien (JAK1-3 ja TYK2) aktivaatioon ja signaalinvälitykseen erikoistuneiden proteiinien fosforylaatioon sekä muutoksiin mm. DNA-synteesissä ja transkriptiossa (Levy ja Darnell 2002, O’Shea ym. 2002).

Luettavaa sytokiineista

Kuinka elimistö reagoi tulehdukseen?

Elimistö reagoi tulehdukseen tavallisesti verisuonimuutoksilla sekä kudosnesteen ja tulehdussolujen kertymisellä tulehdusalueelle. Verisuonimuutosten seurauksena hiussuonten seinämät muuttuvat läpäisevimmiksi ja tulehdusalueelle kertyy proteiineja ja nestettä.

Tulehdusreaktio houkuttelee paikalle myös valkosoluja, kuten syöjäsoluja, joiden tehtävänä on puolustaa elimistöä ulkoisilta taudinaiheuttajilta ja siivota tulehdusaluetta vaurioituneista soluista. Tulehduksien aiheuttama ”märkä” muodostuu tulehdussoluista, taudinaiheuttajista, osin tuhoutuneesta kudoksesta ja kudosnesteestä.

Tulehduksen oireet ovat rubor, tumor, calor, dolor ja functio laesa eli punoitus, turvotus, kuumotus, kipu ja toimintakyvyn heikkeneminen.

Ravinto ja inflammaatio

Pitkään jatkuva matala-asteinen tulehdus kasvattaa sairastumisen riskiä. Tutkimusten mukaan inflammaatio on useimpien kroonisten sairauksien taustatekijä. Inflammaatio altistaa mm. autoimmuunitaudeille, sydän- ja verisuonitaudeille, syöville, tyypin 2 diabetekselle, lihavuudelle ja Alzheimerin taudille.

Rasvakudos erittää runsaasti erilaisia tulehdussytokiineja, joten lihavuus ylläpitää ja lisää inflammaatiota. Laihduttaminen voi merkittävästi vähentää elimistöä rasittavaa matala-asteista tulehdusta.

Aterianjälkeinen (postbrandiaalinen) verensokerin nousu kasvattaa oksidatiivista stressiä muodostamalla happiradikaaleja. Oksidatiivinen stressi pahentaa inflammaatiota. Mitä korkeammaksi verensokeri nousee, sitä enemmän muodostuu happiradikaaleja.

Ravinto vaikuttaa inflammaatioon monin tavoin.

Ravinto voidaan jakaa karkeasti tulehduksia aiheuttaviin, neutraaleihin ja tulehduksia hillitseviin ravintoaineisiin. Ravintoaineiden aiheuttamaan tulehdusvasteeseen vaikuttavat mm. ravinnon määrä ja muut samaan aikaan nautitut ravintoaineet.

Rasvat ovat tavallisilla annoksilla tulehduksen kannalta yleensä neutraaleja. Värikkäiden marjojen, hedelmien ja kasvisten syöminen lievittää tulehdusta. Imeytymättömät proteiinit voivat lisätä suoliston tulehduksia, mutta lihan, kanan ja äyriäisten tulehdusvaikutuksista on hyvin vähän tutkittua tietoa.

Tulehduksia vähentäviä (anti-inflammatorisia) ruokia ovat mm.

  • Rasvainen kala
  • Neitsytoliiviöljy
  • Kala
  • Mantelit ja pähkinät
  • Marjat ja hedelmät
  • Monet kasvikset
  • Appelsiinimehu
  • Granaattiomena
  • Kaakao
  • Punaviini

Inflammaation kannalta neutraaleja ruokia ovat mm.

  • Rypsiöljy
  • Margariini
  • Voi
  • Soija ja palkokasvit
  • Meijerituotteet
  • Kananmunat
  • Eräät täysjyvätuotteet
  • Monet kasvikset
  • Tumma pasta
  • Peruna
  • Leipä
  • Vihreä tee
  • Kahvi
  • Valkoviini
  • Maito ja piimä

Tulehduksia lisääviä ruokia ovat mm.

  • Kerma suurina annoksina
  • Makkarat ja lihajalosteet
  • Runsas sokeri
  • Runsas fruktoosi (fruktoosisiirappi?)

Lue lisää:

Pronutritionist: Anti-inflammatorinen eli tulehdusta vähentävä ruokavalio


Inflammaation vaikutus RRMS- ja PPMS-tautien oireisiin

Tulehdustekijät ovat havaittavissa aaltoilevasti etenevän RRMS-taudin patologiassa ja assosioituvat selkeästi taudin oireisiin. RRMS-tautimuodossa keskushermostossa ilmenevät tulehduspesäkkeet (leesiot) ovat yhteydessä taudinkuvaan liittyviin kliinisiin pahenemisvaiheisiin. Inflammaation helpottuminen ilmenee remissiona, jolloin taudin oireet paranevat joko osittain tai lähes täysin etenkin taudin varhaisvaiheessa.

Progressiivinen MS-tauti

Ensisijaisesti etenevä MS-tauti (primaarisprogressiivinen, PPMS) on MS-taudin alatyyppi, jossa oireet ja invaliditeetti lisääntyy sairauden alusta alkaen tasaisesti ilman selviä inflammaatioon assosioituvia pahenemisvaiheita, RRMS etenee toissijaisesti eteneväksi (SPMS) taudiksi yleensä noin parin vuosikymmenen aikana. SPMS ja PPMS muistuttavat hyvin läheisesti toisiaan.

”PPMS-potilailla yleisimmät taudin alkuoireet olivat motoriset-, pikkuaivo- ja tuntohäiriöt. Motorisen toiminnan häiriöt olivat yleisimmät löydökset kliinisessä neurologisessa tutkimuksessa. Kaikilla PPMS-potilailla oli virtsaustoiminnan häiriöitä, joista tihentynyt virtsaamistarve ja siihen liittyvä virtsan karkailu olivat yleisimmät oireet. Urodynaamisen tutkimuksen yleisimmät löydökset olivat virtsarakon seinämälihaksen yliaktiivisuus (detrusor hyperrefleksia) sekä seinämälihaksen ja virtsaputken sulkijalihaksen koordinoimaton supistelu (detrusor sphinkterin dyssynergia, DSD).” – Maritta Ukkonen: Primaarisprogressiivinen MS-tauti, kliininen, immunologinen ja radiologinen kuva

Tulehduksen vaikutusta ei ole poissuljettu myöskään etenevässä MS-taudissa. Inflamaation voi aiheuttaa autoimmuunitulehdus tai solujen (oligodendrosyyttien) rappeutumisen eli sytodegeneraation aiheuttama neurologinen tulehdus.

”Adheesiomolekyylien ja joidenkin sytokiinien ilmentymisen lisääntyminen viittaa siihen, että tulehduksellista aktiviteettia esiintyy pidemmälle edenneessä PPMS-taudissakin.” – Maritta Ukkonen: Primaarisprogressiivinen MS-tauti, kliininen, immunologinen ja radiologinen kuva

Tutkimukselliset löydöt

Etenevissä MS-taudeissa on havaittavissa runsaasti molekyyli- ja solutason muutoksia, jotka selittävät taudinkuvaan liittyvää neurologista rappeutumista (neurodegeneraatiota).  Tällaisia neurologiseen rappeutumiseen assosioituvia muutoksia ovat mm.

  • keskushermoston syöjäsoluina toimivien mikrogliasolujen aktivoituminen
  • kroonisen hapettumisreaktion aiheuttamat vauriot keskushermoston soluissa
  • mitokondrioihin kumuloituvat vauriot keskushermoston viejähaarakkeissa
  • ikään liittyvä atrofia
  • viejähaarakkeiden signaalinvälityksen havaittava heikkeneminen.

Tällaiset patologiset muutokset voivat johtua autoimmuunitulehduksen aiheuttamista viejähaarakkeiden eristekalvojen vaurioista (demyelinaatio), mutta syynä voi olla myös tautiin liittyvä keskushermoston solujen (neuronien ja oligodendrosyyttien) primaari rappeutuminen.

Mahdollisesti moolemmat, sekä inflammaatio että keskushermoston solujen rappeutuminen (sytodegeneraatio) vaikuttavat etenevien MS-tautimuotojen patogeneesiin.

Patologiset mekanismit, jotka ylläpitävät neurodegeneraatiota ja aiheuttavat PPMS-ja SPMS-potilaille kudosvaurioita, tunnetaan huonosti. Nämä tekijät liittyvät ilmeisesti perifeerisen immunologisen toleranssin virheelliseen toimintaan.

Taudin aiheuttamasta neurodegeneraatiosta on esitetty (ainakin) kaksi hypoteessia: inside-out-hypoteesi ja outside-in-hypoteesi.

Inside-out hypoteesin mukaan taudin alusta alkaen etenevä keskushermoston solujen rappeutuminen on kaikkien tautiin liittyvien prosessien selittävä tekijä.

Outside-in hypoteesi olettaa, että taudin varhaisvaiheessa ilmenevät inflammaatioon assosioituvat demyelinoivat prosessit laukaisevat joukon keskushermostoa rappeuttavia tapahtumaketjuja.

Osallistuuko suoliston mikrobiomi autoimmuunitaudin patogeneesiin?

Viime aikoina on saatu viitteitä siitä, että suoliston mikrobiomin hyvinvoinnilla on tärkeämpi rooli etenevän MS-taudin taudinkuvassa kuin on aiemmin oletettu.

Tieto mikrobiomista ja sen merkityksestä isäntäorganismille täsmentyy koko ajan. Vagus-hermo välittää tietoa ruoansulatuselimistön tapahtumista aivoille. Se toimii suorana välittäjänä mikrobiomin ja keskushermoston välillä.

Mikrobiomi vaikuttaa keskushermostoon muokkaamalla signaalireittejä aivo-suolisto-akselilla. Tämä kaksisuuntainen kommunikaatioverkko hermoston ja suoliston välillä aktivoi hermoston makrofageja ja vaikuttaa neurologisiin tapahtumiin säätelemällä hermoston immuuniaktiivisuutta.

Mikrobiomin merkitys

BBC kirjoittaa, että kehon solujen kokonaismäärästä 43 % on ihmisen omia soluja. Suurin osa kehossamme elävistä soluista kuuluu kuitenkin mikrobiomin bakteereille, arkeille, viruksille ja sienille.

Ihmisen DNA:ssa on noin 23 000 proteiineja koodaavaa geeniä. Geenit säätelevät solujemme, kudostemme ja elimistömme rakennetta. Geenien väliset alueet ohjaavat geenien toimintaa. Oman genomin lisäksi kehossamme on mikrobiomin geneettistä materiaalia, joka koostuu 2-20 miljoonasta geenistä.

DNA, mutaatiot ja yhden emäksen variaatiot

Ihmisen DNA on noin 3 miljardia emästä pitkä kaksoisjuoste. DNA:n rakenteessa toistuu neljä emästä, joita kuvataan kirjaimilla A (adeniini), T (tymiini, C (sytosiini) ja G (guaniini). A ja T sekä C ja G muodostavat DNA:n kaksoisjuosteessa emäspareja.

Geenit eli perintötekijät muodostuvat eri mittaisista DNA-jaksoista

Solun jakautuminen edellyttää DNA:n kahdentumista. Prosessi on hyvin täsmällinen, mutta aika ajoin siinä tapahtuu virheitä ja DNA-juosteen alkuperäinen emäsjärjestys muuttuu. Tällaiset virheet aiheuttavat geenimutaatioita.

Geenimuutosten kolme lähdettä ovat vanhemmilta saatu perimä, elintapojen ja ympäristön tuoma altistus (myrkyt, patogeenit, ravinto jne.) sekä sattumanvaraiset DNA:n kopioitumisvirheet. Kopioitumisvirheitä tapahtuu jatkuvasti. Aina, kun solu jakaantuu, aiheutuu DNA:han keskimäärin kolme virhettä. Tällaiset geenimutaatiot voivat käynnistää syövän.

Pistemutaatiot eli yhden emäksen variaatiot (Single Nucleotide Polymorphism), joissa esimerkiksi DNA:n emäsjuosteen jonkin geenin emäsparissa adeniini muuttuu sytosiiniksi, ovat hyvin yleisiä. Yleensä nämä ovat neutraaleja, mutta jotkin yhden nukleotidin polymorfismit assosioituvat lisääntyneeseen sairastumisriskiin.

Toinen genomi

Professori Sarkis Mazmanian (Caltech) kertoi BBC:lle, että periaatteessa meillä on kaksi toisiinsa vuorovaikuttavaa genomia. Ne ”kommunikoivat” keskenään kemiallisten signaalien välityksellä. Tällaisia mikrobiomin tuottamia hermostoon vaikuttavia välittäjäaineita ova esimerkiksi eräät mikrobien aineenvaihduntatuotteet, kuten dopamiini, serotoniini ja GABA.

Mikrobiomin tuottamat kemialliset signaalit voivat vaikuttaa myös epigeneettisesti ihmisen omaan genomiin. Tämä tapahtuu esimerkiksi siten, että johonkin geenin emäksistä kiinnittyy ympäristötekijöiden säätelemänä geenin transkriptioon vaikuttava metyyliryhmä.

Mikrobiomiin vaikuttavat ympäristötekijät voivat olla viruksia, bakteereita, sieniä, tietyn kemiallisen koostumuksen omaavia ravintoaineita sekä toksisia tai inflammatorisia kemikaaleja. Nämä voivat heikentää immuunijärjestelmän säätelyä ja edesauttaa epigeneettisten muutosten, pistemutaatioiden ja geenimutaatioiden kehittymistä DNA:han.

Yhden nukleotidin polymorfismit (single nucletide polymorphism, SNP) assosioituvat moniin sairauksiin, kuten syöpiinn ja autoimmuunitauteihin. Esimerkiksi tyypin 1 diabeteksessa ja MS-taudissa tällaisia tautiin assosioituvia yhden nukleotidin polymorfismeja on tunnistettu muun muassa geenin CYP27B1 eri lokuksissa.

Geenit eivät ole täysin muuttumattomia. Ympäristötekijät vaikuttavat geenien toimintaan.

Myös epigeneettinen muutos, jossa geenin yhden tai useamman emäksen päälle on kiinnittynyt metyyliryhmä vaikuttaa geenin ekspressioon ja transkriptioon.

Kuinka mikrobiomi vaikuttaa elimistöön?

Suoliston mikro-organismit estävät vieraiden ja mahdollisesti haitallisten mikrobien pesiytymisen suolistoon ja pääsyn suoliston kautta verenkiertoon.

Mikrobiomi vaikuttaa myös ruoansulatukseen, aineenvaihduntaan, immuunijärjestelmän säätelyyn sekä eräiden vitamiinien ja muiden tärkeiden yhdisteiden, kuten dobamiinin, GABAn ja serotoniinin synteesiin ja edelleen keskushermoston toimintaan mm. vagus-hermon välityksellä.

Onko antibiooteilla ja rokotuksilla vaikutuksia mikrobiomiin?

Antibiootit ja rokotukset ovat pelastaneet kymmeniä tai satoja miljoonia ihmishenkiä viimeisen vuosisadan aikana, mutta joidenkin tutkijoiden mukaan mikrobiomin lajikirjo on pienentynyt infektioilta suojaavan taistelun seurauksena ja tämä on heikentänyt mikrobiomin vaikutusta immuunijärjestelmän säätelyyn.

Hypoteesin mukaan mikrobiomin lajikirjon pienentyminen vaikuttaa immuunijärjestelmän säätelyn kautta sairastumissalttiuden lisääntymiseen. Erityisesti sairastumisalttiuden lisääntyminen vaikuttaa allergioihin ja autoimmuunitauteihin.

Professori Ruth Ley (Max Planck Institute) totesi BBC:lle, että vaikka olemmme taistelleet menestyksekkäästi infektioita vastaan, autoimmuunitautien ja allergioiden määrä on kääntynyt selvään kasvuun.

Tulkitsen tämän niin, että koska mikrobiomi yleensä periytyy äidiltä lapselle, voivat pienet mikrobiomin lajikirjon muutokset kumuloitua sukupolvien aikana ja heikentää pitkällä aikajänteellä immuunijärjestelmän säätelyä. Se voisi selittää väestötasolla eräiden tautien yleistymisen.

Rokotukset ja antibiootit eivät kausaalisesti aiheuta autoimmuunitauteja, mutta ovat voineet useiden sukupolvien aikana vaikuttaa autoimmuunitautien kehittymisen kannalta otollisemman immunologisen ympäristön rakentumiseen. Tällainen spekulaatio kuulostaa ihan järkeenkäyvältä.

Näkökulma: Rokotteiden sisältämät viruksen proteiinit toimivat autoimmuunitaudin laukaisijoina minimaalisen pienellä todennäköisyydellä, mutta näin kävi surullisessa narkolepsiaepidemiassa. Yleisesti ottaen rokotteet ovat hyvin turvallisia. Virus, jolta rokote suojaa voi laukaista autoimuunitaudin myös rokottamattomilla.

Rokottaminen voi laukaista vakavan allergisen reaktion tai sairauden, mutta todennäköisyys sellaiselle on häviävän pieni. Myös rokotteen sisältämien tehoste- ja säilöntäaineiden pelko on aiheeton; hengittämällä elimistöön kulkeutuu taajama-alueilla jo yhdessä päivässä rokotteisiin verrattuna moninkertainen määrä teollisuudesta ja liikenteestä peräisin olevia haitallisia mikropartikkeleita. Hengitysilman pienhiukkaset kulkeutuvat keuhkoista verenkiertoon ja vaikuttavat siten terveyteen.

Maailmanlaajuisesti ilmansaasteet tappavat vuosittain miljoonia ihmisiä. Suurin ongelma on Aasiassa ja Afrikassa. Tämä on rokotteita todellisempi ja akuutimpi uhkakuva myös Euroopassa.

Teollinen ruoka yksipuolisti mikrobiomia

Mikrobiomin heikentymiseen on vaikuttanut myös viime vuosisadalla alkanut ravinnon teollistuminen. Teollisesti valmistetut vähemmän ravinteita ja enemmän energiaa sisältävät ruoat ja rasvat sekä runsas sokereiden käyttö ovat syrjäyttäneet luonnnollisemmat ravinnonlähteet.

Lihan ja sokereiden määrä ravinnossa on lisääntynyt samaan aikaan, kun hapatettujen ruokien ja kasvisten saanti on vähentynyt. Punainen liha, lihajalosteet, transrasvat ja sokerit assosioituvat tutkimuksissa heikentyneen suolistoterveyden ja suoliston tulehdusten kanssa; nämä heikentävät immuunijärjestelmää ja sen säätelyä.

Punainen liha ja suoliston terveys

Runsaan proteiinien saannin kohdalla ongelmia aiheuttaa se, että vaikka proteiinit pilkotaan tärkeiksi aminohapoiksi ja peptideiksi ohutsuolessa, osa proteiineista ei imeydy ohutsuolesta elimistön hyödynnettäväksi, vaan päätyy paksusuoleen, jossa ne ravitsevat mikrobiomin huonoja bakteereita.

Imeytymättömän proteiinin vaikutuksesta paksusuoleen syntyy imeytymätöntä rautaa, ammoniakkia, amiineja, sulfideja ja haaraketjuisia rasvahappoja (BCFA).

Erityisesti lihan paistamisen yhteydessä Mailard-reaktiossa (ruskistumisessa) syntyy sokeroituneita proteiineja, jotka eivät imeydy ohutsuolessa, vaan kulkeutuvat paksusuolen bakteerien fermentoitavaksi (Tuohy et al. 2006). Lähde: Pronutritionist

Ravitsemuksessa tapahtunut muutos ei tietenkään ole yksiselitteisesti huono asia. Ravintoa on enemmän ja monipuolisemmin tarjolla kuin koskaan aiemmin historiassa. Samaan aikaan pikaruoka- ja herkuttelukulttuurilla on kuitenkin hintansa: immuunijärjestelmän toiminnan säätelyyn osallistuvan mikrobiomin heikentyminen on ehkä mahdollistanut aiemmin harvinaisten tautien ja oireyhtymien yleistymisen.

Autoimmuunitautien, allergioiden ja autismin lisääntyminen voisi siis selittyä väestötasolla tapahtuneilla mikrobiomin pitkän aikavälin muutoksilla. Tämä on mielenkiintoinen ajatus.

Ymäristömuuttujat ja terveys

Evoluutio on tehnyt meistä ympäristön muutoksiin hyvin sopeutuvan lajin. Ympäristön muuttuminen mm. ravinnon ja erilaisten kemikaalien osalta on nykyään kuitenkin niin nopeaa, ettei ihmisen aineenvaihdunta ja immuunijärjestelmä ehdi sopeutua muutoksiin.

Kun ihmiset aiemmin sairastuivat ja kuolivat infektioihin, nyt infektioita suurempia uhkia ainakin kehittyneissä maissa ovat elintapoihin assosioituvat kardiometaboliset oireyhtymät, sydän- ja verisuonitaudit, diabetes, syövät jne.

Ravintoaineiden puutokset ja ympäristön myrkyt altistavat sairastumiselle

Välttämättömien ravintoaineiden puutos ei välittömsti johda sairastumiseen, sillä keho varastoi jonkin verran välttämättömiä vitamiineja ja mineraaleja. Elimistössä on simerkiksi B12-vitamiinia yleensä riittävästi kattamaan muutaman vuoden tarpeen, vaikka sitä ei ravinnosta saisikaan. Vakavien puutosoireiden kehittyminen edellyttää pidempiaikaista vitamiinien tai mineraalien puutosta.

Elimistöllä on myös monia aineenvaihduntamekanismeja elintoimintoja ylläpitävien elinten energiansaannin turvaamiseksi. Solut saavat energiaa hiilihydraateista, rasvoista ja proteiineista.

Kun ravintoa ei ole saatavilla, elimistö muuttaa varastorasvoja ketoaineiksi ja glukoneogeneesissä ketoaineita edelleen glukoosiksi tai soluissa energiaksi. Kun elimistön glykogeenit ja rasvavarastot loppuvat, elimistö alkaa tuottaa ketoaineita vapaista proteiineista ja rasvahapoista. Ravinnon jatkuva puutos saa aineenvaihdunnan pilkkomaan lihaksia aminohapoiksi, joita voi käyttää ketoaineina. Näiden selviytymismekanismien ansiosta terve ihminen voi elää jopa kuukauden pelkällä vedellä.

Toksisten aineiden kumuloituminen elimistöön ja välttämättömien ravinteiden puutokset altistavat kuitenkin pitkään jatkuessaan sairastumiselle.

Ravinto ja suolisto

Yksipuolinen ravinto, liiallinen hygienia, runsas alkoholi, tupakointi sekä eräät lääkkeet voivat heikentää suoliston mikrobiomia. Tälla on vaikutuksia terveyteen, koska suoliston mikribiomia tarvitaan mm. suojaamaan suolistoa ulkoisilta taudinaiheuttajilta, vähentämään suolistotulehdusten vaaraa, ehkäisemään suolistosyöpää ja pilkkomaan ravinnon sulamattomia kuituja.

Monista hedelmistä, kasveista, marjoista, tummasta suklaasta ja kahvista saatavilla polyfenoleilla on suoliston mikrobiomille ja painonhallinnalle ilmeisen myönteisiä vaikutuksia. Ne tukevat suoliston terveyttä ylläpitävien bifidobakteerien kasvua. Punaisesta lihasta saatava hemirauta voi pahentaa suoliston tulehduksia, mutta samaan aikaan saatava resistentti tärkkelys vähentää inflammaatiota.

RRSM ja PPMS

MS-taudin kaksi yleisintä mutoa ovat taudinkuvaltaan ja patologisilta mekanismeiltaan hyvin erilaisia tauteja. On ehkä aiheellista harkita sellaista vaihtoehtoa, että RRMS ja PPMS ovat kaksi erillistä sairautta tai monitekijäistä oireyhtymää.

Ne muistuttavat monin tavoin toisiaan, mutta näiden kahden MS-taudin patogeneesi poikkeaa toisistaan merkittävällä tavalla. RRMS on tulehduksellinen autoimmuunitauti, jossa keskushermoston tulehdukset laukaisevat MS-tudille ominaisen demyelinoivan autoimmuunireaktion. PPMS on sairauden alusta alkaen neurodegeneratiivinen, hermoston soluja rappeuttava sairaus, jossa oligodendrosyyttien tuhoutumista ja atrofiaa tapahtuu tasaisesti ilman inflmaatioon assosioituvia pahenemisvaiheita.

Tällaista hypoteesia tukee kliinisten löydösten ohella myös se, että anti-inflammatoriset ja immunosupressiiviset lääkkeet eivät toimi toivotulla tavalla etenevissä MS-taudeissa, vaikka nillä saadaan hyviä hoitotuloksia aaltoilevaa tautimuotoa sairastavilla.

Myöskään kantasoluhoidosta ei löydy apua etenevään MS-tautiin. Kantasoluhoidossa potilaalta kerätään kantasoluja, joita kasvatetaan petri-maljoissa. Kantasolujen keräämisen jälkeen potilaan virheellisesti toimiva immuunijärjestelmä tuhotaan voimakkaalla kemoterapialla. Viimeisessä vaiheessa kantasoluista istutetaan potilaalle uusi immuunijärjestelmä.

Kaiken kaikkiaan kantasoluhoito kestää noin kuukauden ja sillä on saatu hyviä hoitotuloksia RRMS-potilailla. PPMS- ja SPMS-potilaille kantasoluhoito ei ainakaan nykyisellään sovellu.

Immuunijärjestelmää hillitsevillä lääkkeillä ja kantasoluhoidolla ei ole toivottua vaikutusta etenevässä MS-taudissa, koska immuunijärjestelmän virheellinen toiminta ei ole oireiden ensisijainen syy. Etenevä MS-tauti ei myöskään ole ensisijaisesti tulehduksellinen sairaus, koska tulehduksia vähnetävillä lääkkeillä ei saada toivottua vastetta.

Tästä hypoteesista ei vallitse tietellistä konsensusta, mutta etenevien MS-tautien tutkimus on lisääntynyt ja viime aikoina on saatu selkeitä viitteitä siitä, että PPMS on osin virheellisesti ymmärretty sairaus; sen sekoittaminen relapsoivaan-remittoivaan MS-tautiin vain pahentaa tilannetta ja hidastaa tutkimustyötä.

Niin tai näin, molemmissa MS-taudin muodoissa ravinto ja elintavat vaikuttavat taudin etenemiseen, mutta erilaisten patologisten prosessien ja aineenvaihduntakanavien kautta.   

Ehkäpä MS-taudin yksilölliset oireet ja taudinkulku eri potilailla selittyy sillä, että kahteen yleisimpään MS-taudin muotoon vaikuttavat erilaiset geenivariaatiot, geenien alleelit, yhden nukleotidin polymorfismit ja epigeneettiset muutokset.

MS-tautiin assosioituvia geenejä on tunnistettu noin 200, mutta yksikään potilaista ei varmasti kanna kaikkia mahdollisia MS-tautiin liittyviä geenimuutoksia. Tämä monimuotoisuus selittää sen, miksi MS-tautiin on äärimmäisen vaikeaa löytä parantavaa ja kaikille potilaille soveltuvaa hoitoa.

Oksidatiiviseen ainnenvaihduntaan vaikuttavia tekijöitä: PPAR, sirtuiinit ja AMPK

Palataan hapetusreaktioihin, sillä ne vaikuttavat solujen aineenvaihduntaan mm. ravintoaineiden kautta. Oksidatiivinen stressi ja matala-asteinen tulehdus heikentävät elimistön terveyttä ja altistavat kroonisille sairauksille. Immuunivälitteisissä tulehduksellisissa sairauksissa oksidatiivinen stressi ja inflammaatio ylläpitävät ja pahentavat taudin oireita.

Happiradikaalit kaappaavat elektroneja muilta molekyyleiltä

Oksidatiivisella stressillä tarkoitetaan solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Kun hapettavia tekijöitä on liikaa suhteessa pelkistäviin tekijöihin, oksidatiivinen stressi välittyy reaktiivisten happi- ja typpiradikaalien kautta muihin molekyyleihin.

Reaktiivinen happiradikaali (ROS) on hapesta muodostunut yhdiste, joka sisältää parittoman elektronin. Se pyrkii parilliseen elektronimäärään reagoimalla läheisyydessään olevien muiden yhdisteiden kanssa. Tämä johtaa eräänlaiseen dominoefektiin, jossa happiradikaali vaurioittaa kohtaamansa molekyylin rakennetta ja/tai toimintaa.

Oksidatiivisen metabolismin vaikutusta tehostaa kaksi entsyymiä ja tumareseptori. Entsyymit ovat AMP-aktivoidut proteiinikinaasit: AMPK (Steinberg and Kemp, 2009) sekä sirtuiinit (SIRT), jotka ovat joukko NAD+ -vaikutuksesta aktivoituvia histonideasetylaaseja (Zhang et al., 2011; Rice et al., 2012). Vaikuttava tumareseptori on PPAR-isotyyppi (peroxisome proliferator-activated receptors) Desvergne and Wahli, 1999; Burns and VandenHeuvel, 2007).

Rasvojen energiantuotanto

Keho säilyttää energiaa rasvahappoina, koska rasvahapoissa on hiilihydraatteihin nähden yli kaksinkertainen määrä energiaa painoyksikköä kohden. Rasvahappoja muutetaan energiaksi mitokondrioissa tapahtuvassa beeta-oksidaatiossa:

  • Aluksi rasvat hajotetaan rasvahapoiksi ja glyseroliksi. Esimerkiksi triglyseridissä on kolme rasvahappoketjua, jotka ovat kiinnittyneenä glyseroliosaan.
  • Glyseroli hapetetaan solulimassa glyseraldehydi-3-fosfaatiksi, joka voidaan käyttää energiantuotantoon (n. 5 % triglyserideistä saatavasta energiasta) tai glukoosin tuottamiseen glukoneogeneesissä. Glukoneogeneesi käyttää glukoosimolekyylin tuottamiseen enemmän energiaa kuin syntyvästä glukoosimolekyylistä vapautuu glykolyysissä ja soluhengityksessä.
  • Rasvahapot hapetetaan mitokondrioissa tapahtuvassa beeta-oksidaatiossa (β–oksidaatiossa).
    Rasvahapot aktivoidaan edelleen mitokondrion ulkokalvolla kiinnittämällä rasvahapon karboksyyliryhmään koentsyymi A. Näin muodostunut asyyli-KoA kulkee mitokondrion sisäkalvon läpi aktiivisella kuljetuksella. Soluliman asyyli-KoA:lla ja mitokondrion asyyli KoA:lla on eri tehtävät: solulimassa ”rakentava” anabolia ja mitokondriossa ”hajottava” katabolia.
  • Mitokondrion matriksissa rasvahappo hajotetaan kaksihiilisiksi pätkiksi (asetyyli-KoA).
  • Asetyyli KoA (asetyylikoentsyymi A) hapetetaan edelleen sitruunahappokierrossa.
  • Elimistön energiantuotannon lopputuotteena syntyy vettä ja hiilidioksidia, jotka poistuvat kehosta mm. hengityksen ja hikoilun kautta.

Mitokondrioissa ja peroksisomeissa tapahtuvaa rasvahappojen beetaoksidaatiota tehostavat PPAR-isotyypit. Beetaoksidaatiossa ravinnon tai kehon varastoimia rasvahappoja käytetään energianlähteenä.  PPAR-isotyypit säätelevät beetaoksidaatioon liittyvien geenien transkriptiota ja muodostavat AMPK-sirtuiinipolkuja.

Vähäenerginen ravinto ja liikunta aktivoi AMPK-sirtuiini-PPAR-polun aineenvaihduntaa

AMPK-sirtuiini-PPAR-polku aktivoituu vähäenergisen ravinnon ja fyysisen harjoittelun seurauksena. Aktivaatiota tehostavat kasvisten ja hedelmien sisältämät polyfenolit ja pitkäketjuiset monityydyttämättömät rasvahapot (omega-3). Ligandin aktivoimat PPAR-isotyypit muodostavat kahdesta erilaisesta osasta koostuvia (heterodimeerisiä) komplekseja RXR-reseptorin kanssa.

Käytännössä: Vähäenerginen, omega-3-rasvahappoja ja polyfenoleita sisältävä ravinto tehostaa aineenvaihduntaprosessia, jossa rasvahappoja muutetaan energiaksi beeta-oksidaatiossa.

Vastaavasti runsasenerginen ravinto tehostaa anabolista aineenvaihduntaa ja lipogeneesiä, jossa verenkierrossa olevia sokereita muutetaan varastorasvoiksi. Energiatiheät ravintoaineet edistävät solujen kasvua aktivoimalla SREBP-1c ja SREBP-2 proteiineja (sterol regulatory element-binding proteins), Xu et al., 2013, ja ChREBP (carbohydrate responsive element-binding protein), Xu et al., 2013.

LXR tumareseptorit kontrolloivat SREBP-1c ja SREBP-2-proteiineja, Mitro et al., 2007; Nelissen et al., 2012. Oksysterolit ja glukoosi puolestaan aktivoivat SREBP-1c- ja SREBP-2-proteiineja, jotka osallistuvat lipidien, triglyseridien ja kolesterolin synteesiin.

MS ja inflammaatio: NF-kB ja AP-1)

Ravinnon, inflammaation ja MS-taudin yhteyden kannalta merkityksellisiä ovat kaksi transkriptiotekijää, jotka osallistuvat inflammaatioon ja autoimmuunireaktioihin. Nämä ovat tuman transkriptiotekijä-kB (NF-kB) ja aktivaattoriproteiini (AP-1; Yan and Greer, 2008).

MS-taudissa sekä NF-kB ja AP-1 aktivoituvat vaikuttaen useiden proinflammatoristen geenien ekspressioon ja proinflammatoristen molekyylien tuotantoon. Aktivoitumisen mekanismia ei täysin tunneta, mutta on todennäköistä, että aktivaatioon vaikuttaa virusten, sytokiinien ja oksidatiivisen stressin lisäksi eräät ravintoaineet, kuten tyydyttyneet rasvat, transrasvat.

Tumareseptoreiden aktivaatio

Kaikkien tumareseptoreiden (PPAR, LXR ja VDR) on aktivoiduttava erityisten ligandien avulla. Nämä ligandit voivat olla spesifejä ravintotekijöitä, mikä osoittaa, kuinka solut reagoivat ravintoaineisiin ja säätelevät energian homeostaasia. Samalla tämä mekanismi on kuin molekylaarinen avain, joka auttaa ymmärtämään kuinka ravintoaineet vaikuttavat tulehduksellisten sairauksien etenemiseen (Heneka et al., 2007; Zhang-Gandhi and Drew, 2007; Krishnan and Feldman, 2010; Cui et al., 2011; Schnegg and Robbins, 2011; Gray et al., 2012).

”Therefore, each of the three nuclear receptors—PPAR, LXR, and VDR—competes for the binding to RA-RXR and forms hetero-complexes that can inhibit NF-kB and exert a tight control over the expression of inflammatory genes, thus integrating metabolic and inflammatory signaling. It is clear that there is competition between the three receptors PPAR, LXR, and VDR-D, for the binding with RA-RXR, but this competition should have an influence only on metabolism and not on inflammation, because it is not yet known which of the three heterodimers is more effective in inhibiting NF-kB.”

Proinflammatoristen molekyylien tuotanto MS-taudin pahenemisvaiheen aikana on biosynteettinen prosessi, jota ylläpitää ja pahentaa runsasenerginen ruokavalio. Toisaalta inflammaatioon assosioituvan relapsin oireita ja kestoa voi helpottaa vähäenergisellä ruokavaliolla.

”In principle, what favors anabolism will promote the inflammatory processes, while what favors catabolism will contrast them.”

Kuvan lähde:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4342365/figure/fig4-1759091414568185/

Tästä artikkelisarjasta on tullut sellainen iisakin kirkko, joka ei näytä koskaan valmistuvan. Aihe on älyttömän kiinnostava.