Ruokasotaa ja anarkiaa osa 3

Diet Heart-hypoteesin jälkeinen ravitsemuspolitiikka hukutti kuluttajat kelvottomaan teolliseen mönjään ja väitti monityydyttämätöntä hydrattua mönjää sydänterveyttä edistäväksi rasvaksi. Kovat tyydyttyneet rasvat voivat olla mainettaan parempia.

Ruokasotaa ja anarkiaa osa 3 jatkaa ravinnosta räksytyttämistä, annettujen tosiasioiden kyseenalaistamista ja ravitsemussuositusten solvaamista. Suhtaudun ravintoon aiheellisen asenteellisesti.

Tiesitkö, että

  • Ranskassa syödään enemmän tyydyttyneitä rasvoja, kuin missään muussa Euroopan maassa, mutta ranskalaisilla esiintyy vähiten sydäntauteja Euroopassa.
  • Ranskalaisten jälkeen sveitsiläiset syövät toiseksi eniten tyydyttyneitä rasvoja. Vastaavasti sveitsiläisten sydäntautikuolleisuus on toiseksi matalin Euroopassa.
  • Euroopan maissa, joissa syödään eniten tyydyttyneitä rasvoja, sydäntautien ja sydäntautikuolleisuuden esiintyvyys on alhaisinta.
  • Vähiten tyydyttyneitä rasvoja ja eniten monityydyttämättömiä rasvoja kuluttavissa maissa, kuten Georgiassa ja Moldovassa, sydäntautikuolleisuus on yleisintä Euroopassa.

Edelliset tilastolliset tosiasiat eivät todista, että tyydyttyneet ravat olisivat terveellisiä. Tällaiset tilastot ovat ns. ekologista dataa, johon voi vaikuttaa sadat tai tuhannet tunnistetut ja tunnistamattomat muuttujat. Näistä ei saa vetää hätiköityjä johtopäätöksiä. Havainnot julkaisi British Journal of Nutrition.

Ne ovat kuitenkin tosiasioita, jotka osoittavat, että ravintosuositusten ja todellisuuden välillä on kiusallinen ristiriita.

Miksi niissä maissa, joissa syödään eniten tyydyttyneitä rasvoja, sydäntautikuolleisuus on vähäistä, kun niissä maissa, joissa syödään eniten pehmeitä ja terveellisiä monityydyttämättömiä kasvirasvoja, sydäntautikuolleisuus on Euroopan korkeinta. Se on hämmentävää.

Tällaiset tosiasiat eivät mahdu ravitsemussuosituksiin. Mikä tällaisen selittäisi?

Aikahyppy

1950-luvulla amerikkalainen tutkija, Ancel Keys päätyi hypoteesiin, jonka mukaan kolesteroli ja tyydyttyneet eläinrasvat selittävät valtimonkovettumatautia.

Ensin tieteellinen yhteisö huvittui Keysin absurdeista väitteistä, mutta seitsemän maan tutkimus sai joidenkin tutkijoiden silmät avautumaan. Entä jos Keys on oikeassa?

Sydäntautikuolleisuus oli lisääntynyt Yhdysvalloissa kiihtyvästi 1900-luvun alusta alkaen, mutta syytä ilmiölle ei tunnettu. Sydänkohtauksia oli ilmassa, kortisolia veressä ja paniikin hajua kongressin käytävillä. Jotain pitäisi kai tehdä!

Jo 1950-luvulla saatiin osviittaa siitä, että runsas sokereiden saanti assosioituu sydän- ja verisuonitautien lisäksi moniin syöpiin. Tämä havahdutti sokeriteollisuuden johtajat. Sugar Research Foundation ei piitannut tutkimuksista tai terveydestä, mutta sokeriteollisuuden voitot piti turvata ja maksimoida. Business as usual!

Poliittinen ilmasto muuttui eläinrasvojen vastaiseksi 1960- ja 1970-luvuilla. Yleiseen mielialaan vaikuttivat sokeriteollisuuden aggressiivinen lobbaus Washingtonissa ja ja tyydyttyneitä rasvoja mustamaalaava tutkimus, jonka Sugar Research Foundation rahoitti.

Ancel Keysin teoria vaikutti hyväksyttävältä ja se sai taakseen vaikutusvaltaisia tukijoita ja tutkijoita.

Keys tarjosi yksinkertaisen ratkaisun: jos eläinrasvat ja kolesteroli aiheuttavat sydän- ja verisuonitauteja, eläinrasvojen ja kolesterolin kulutuksen vähentäminen väestötasolla laskee sydän- ja verisuonitautien esiintyvyyttä väestötasolla. Ihmisiä pitäisi kehottaa välttämään rasvaa ja erityisesti kovia eläinrasvoja.

Sugar Daddy Cool

Tyydyttyneiden rasvojen haittoja korostava näkemys sopi mainiosti Mark Hegstedille, joka oli kansallisten ravitsemussuositusten laatimisen aikaan (1977) Yhdysvaltojen maatalousministeriön ravitsemusasioista vastaava johtaja.

Kymmenen vuotta aikaisemmin Hegsted toimi tutkijana Harvardissa. Hän oli yksi niistä kolmesta tutkijasta, jotka Sugar Research Foundation (Sugar Association) palkkasi nykyrahassa 49 000 dollarin korvausta vastaan kirjoittamaan sokereiden haittoja vähättelevän ja eläinrasvojen haittoja liioittelevan tutkimuksen sokeriteollisuuden kokoaman aineiston pohjalta. Maatalousministeriön kansalaisille laatimat yleiset ravitsemussuositukset olivat Hegstedin vastuulla. Lue tästä.

Suositusten läpimeno Yhdysvalloissa perustui enemmänkin aggressiiviseen lobbaukseen ja politiikkaan kuin tieteesen ja terveyteen.

Kansikuvapoika ja ravitsemustieteen supertähti

Keys oli ravitsemustieteen kansikuvapoika ja aikalaisten palvoma komea ja karismaattinen supertiedemies. Seitsemän maan tutkimuksessa seurattiin kahdenkymmenenkahden maan rasvalla lotraamista, mutta vain ne seitsemän maata, joissa lotrattiin paljon tyydyttyneillä rasvoilla ja kuoltiin riittävän usein sydäntauteihin, täyttivät Keysin vaatimukset tyydyttyneiden rasvojen vaaroista. Tällaista tutkimusmetodia kutsutaan ”kirsikoiden poimimiseksi” (cherry picking).

Keys poimi tutkimusaineistosta vain alkuperäistä hypoteesiaan tukevat tulokset (kirsikat) ja sivuutti tulokset, jotka olivat ristiriidassa hypoteesin kanssa. Näin lopullisessa tutkimuksessa tutkimusaineistosta hylättiin yli puolet. Jos koko Keysin tutkimusaineisto analysoidaan, tutkimuksen johtopäätökset muuttuvat.

Tarkemmin analysoituna Keysin aineisto osoittaa, että sydäntautien ja sokerin korrelaatio on vahvempi kuin sydäntautien ja tyydyttyneiden rasvojen korrelaatio, mutta sellainen mahdollisuus ei sopinut Keysin todellisuuteen. Se hylättiin.

Keysin alkuperäinen data sisältää mielenkiintoisia havaintoja. Tyydyttyneiden rasvojen saanti Ranskassa oli samalla tasolla tai korkeampi kuin Suomessa, mutta sydäntautikuolleisuuden esiintyvyys oli Ranskassa hyvin alhainen. Tämä ilmiö tunnetaan ranskalaisena paradoksina.

Ranska on mielenkiintoinen kuriositeetti muutenkin. Runsaasta tyydyttyneiden rasvojen kulutuksesta huolimatta simerkiksi ärtyvän suolen oireyhtymä, närästys ja sydäntaudit ovat selvästi harvinaisempia Ranskassa, kuin Suomessa ja Yhdysvalloissa.

Myös muissa pohjoismaissa tyydyttyneitä rasvoja syötiin enemmän kuin Suomessa, mutta sydäntautien esiintyvyys ja sydäntautikuolleisuus oli Suomeen verrattuna vähäistä. Kuinka se voi olla mahdollista, jos tyydyttyneet rasvat aiheuttavat sydäntauteja?

Rasvateorian kritiikki

Rasvan ja erityisesti tyydyttyneiden rasvojen saannin vähentämistä suosittava diet-heart-hypoteesi on ollut ankaran kiistelyn kohteena vuosikymmenten ajan.

Vähärasvainen ja runsaasti hiilihydraatteja sisältävä ruokavalio, jollaista Yhdysvaltojen kansalliset terveysjärjestöt (NCEP, NIH ja AHA) ovat suositelleet vuoden 1984 LCR-CPPP:n (Lipid Research Clinics-Primary Prevention Program) ja Yhdysvaltojen maatalousministeriön 1977 julkaisemien ravintosuositusten jälkeen, saattoi hyvinkin osaltaan vaikuttaa nykyisten elintapasairauksien nopeaan yleistymiseen.

Aikuistyypin diabetes, lihavuus, metabolinen oireyhtymä ja erilaiset suolistosairaudet lähtivät laukalle 1980-luvun alussa. Miksi? Voisiko liika sokerinsaanti selittää elämäntapasairauksien epidemiaa?

Sydäntautien esiintyvyys ja sydäntautikuolleisuus ovat hieman laskeneet. Lasku voidaan selittää esimerkiksi tupakoinnin ja ilmansaasteiden vähenemisellä, vähäisemmällä altistumisella terveydelle haitallisille kemikaaleille sekä paremmilla lääkkeillä ja tehokkaammilla hoitomuodoilla.

Sydäntautikuolleisuuden lasku selitetään nimenomaasn tyydyttyneiden rasvojen käytön vähenemisen seurauksena ja sillä perustellaan yhä tyydyttyneiden rasvojen välttämiseen kehottavia toimia.

Esimerkiksi Pekka Puskan mukaan Pohjois-Karjala-projekti pelasti neljännesmiljoona suomalaista. Se on roskaa, sillä sydäntaudit olivat kääntyneet laskuun jo ennen Pohjois-Karjala-projektia, ja laskivat nopeammin Länsi-Suomessa, joka ei ollut interventiotutkimuksen piirissä!

Tyydyttyneiden rasvojen ja hiilihydraatteja rajoittavien ruokavalioiden haittoja korostavaa narratiivia ruokitaan jatkuvasti uusilla absurdeilla valheilla: insuliiniresistenssi ja aikuistyypin diabetes ovat viimeisimpien mielikuvituksellisten satujen mukaan seurausta tyydyttyneistä rasvoista ja – Herra tietää – karppaamisesta.

Tyydyttyneiden rasvojen tuotanto, käyttö ja myynti ovat laskeneet tasaisesti 1980-luvulta alkaen. Samaan aikaan monityydyttämättömien kasvirasvojen ja hiilihydraattien kulutus on lisääntynyt. Vaikka runsasenergisten rasvojen saanti kääntyi 1980-luvulla laskuun, amerikkalaisten kaloreiden saanti lisääntyi huomattavasti.

Kaloreiden saannin kasvu USA:ssa

Ketogeenistä ruokavaliota noudattavia on kourallinen maailman ihmisistä, mutta diabetesta sairastaa jo lähes 10 % maailman väestöstä, ja suurin osa diabetesta sairastavista ei karpannut sairastuessaan. Väite siitä, että ketogeeninen ruokavalio lisäisi insuliiniresistenssin ja diabeteksen riskiä esiteltiin taannottain erään iltapäivälehden terveyssivuilla. Se on epätieteellistä roskaa.

Tällaisen epätieteellisen roskan mukaan kaikki karppaaminen on saatanasta.

Ketoilusta maalataan käsittämättömiä kauhukuvia. Syy voi olla se, että ketoilu uhkaa perinteisten ravitsemussuositusten legitimiteettiä. Ketoilu on anarkismia, jossa valistuneet yksilöt uskaltavat kyseenalaistaa norsunluutorneissa elävien viranomaisten antamien ohjeiden legitimiteettiä.

Maailmassa jo yli 10 000 lääkäriä hoitaa lihavuutta ja aikuistyypin diabetesta ketogeenisellä ruokavaliolla. Pelkästään Kanadassa on yli 4000 naistentautien lääkäriä, jotka suosittelevat potilailleen vähän hiilihydraatteja ja runsaasti rasvaa sisältävää ruokavaliota. Jatkuvasti kasvava evidenssi tukee tätä lähestymistapaa. Valitettavasti vakiintuneet paradigmat kumoutuvat hitaasti.

Ketogeenisen ruokavalion terveyshyötyjä osoittavia kontrolloituja satunnaistettuja tutkimuksia julkaistaan kiihtyvällä tahdilla, mutta ne tunnetaan yhä valitettavan huonosti.

Surulliset tilastot

Maailman terveysjärjestön (WHO) raportin mukaan lihavien määrä on kolminkertaistunut vuoden 1975 jälkeen. Jopa 39 % kaikista aikuisista (n.1,9 miljardia) oli ylipainoisia 2016. Ylipainoisista lihavia oli yli 650 miljoonaa. 340 miljoonaa lasta ja nuorta (5-19) ja 38 miljoonaa alle 5-vuotiasta oli ylipainoisia tai lihavia vuoden 2016 raportin mukaan.

Lihavuus tappaa enemmän ihmisiä kuin nälkä

Diabetesta sairastavien määrä on kasvanut 108 miljoonasta (1980) 422 miljoonaan (2014). Taudin esiintyvyys lähes tuplaantui 4,7 % > 8,5 %. Vuosien 2000 ja 2016 kuolleisuus diabetekseen kasvoi 5 %.

Diabetes aiheuttaa mm. sokeutta, munuaissairauksia ja sydän- ja verisuonitauteja. Vuonna 2016 diabetes oli globaalisti seitsemänneksi yleisin kuolinsyy.

Insuliiniresistenssin tunnistanut tri Joseph Kraft uskoi, että lähes kaikki sydän- ja verisuonitaudit johtuvat diagnosoidusta tai diagnosoimattomasta diabeteksesta.

Sydän- ja verisuonitaudit ovat ”terveelliseen” mönjään siirtymisestä huolimatta yhä maailmanlaajuisesti yleisin kuolinsyy.

Sydäntautikuolleisuus on hitaasti laskenut, mutta lasku voidaan selittää mm. tupakoinnin vähenemisellä, aiempaa paremmilla lääkkeillä ja hoitojen kehittymisellä.

Diabeetikoista suurin osa sairastuu ja kuolee sydän- ja verisuonitauteihin

Ehkä Kraft oli oikeassa? Aikuistyypin diabetes voi olla paljon laajempi ongelma kuin halutaan tunnustaa.

Diabetes ei ole vain kansanterveydellinen ongelma, vaikka se on todennäköisesti tärkein sydän- ja verisuonitaudeille altistava riskitekijä. Aikuistyypin diabetes on myös kansantaloudellinen ongelma, jonka kustannukset syövät leijonanosan terveydenhoitomenoista ja -resursseista.

Kraft on purkanut pitkän lääkärinuransa aikana hyperinsulinemiaa ja osoittanut kuinka jatkuvasti koholla oleva insuliini (hyperinsulinemia) altistaa sydän- ja verisuonitaudeille. Tämä ei voi olla yllätys, kun tiedetään, että diabetes vahingoittaa verisuonia ja on yleisin syy verenkiertohäiriöistä johtuville raajojen amputaatioille. Jatkuvasti korkea verensokeri ja insuliini vahingoittavat verisuonia ja elimiä.

Vähärasvaisia ravintosuosituksia ei voi perustella ohjeilla, jotka nojaavat auttamattomasti vanhentuneeseen dataan ja epäluotettaviin tutkimuksiin.

Kasvava kliininen näyttö kiistää opit tyydyttyneiden rasvojen haitoista ja monityydyttämättömien rasvojen eduista. Vahvistuva näyttö osoittaa, että paljon parjattu vähän hiilihydraatteja sisältävä ruokavalio on paljon mainettaan parempi. Se on tutkimusten valossa tehokas tapa hoitaa lihavuutta, metabolista oireyhtymää, aikuistyypin diabetesta ja verenpainetautia.

Ketogeeninen ruokavalio vähentää elimistön hiljaista tulehdusta, joka assosioituu lähes kaikkiin nykyisiin sairauksiin. Viimeaikainen näyttö viittaa siihen, että ketogeeninen ruokavalio voi hillitä Covid-19-tautiin liittyvää sytokiinimyrskyä. Lue tästä. Aihetta tutkitaan ja palaan siihen myös Ruokasodassa.

Enemmän monityydyttyneitä rasvoja, enemmän sydäntauteja

Ancel Keysin kokoaman aineiston olisi pitänyt herättää kriittisiä kysymyksiä jo viime vuosisadalla. Hypoteesin heikkouksia ei korjattu. Seitsemn maan tutkimus vahvisti mielikuvaa tyydyttyneiden rasvojen ja kolesterolin haitoista, vaikka tutkimuksesta johdetut päätelmät vuotavat kuin seula. Surullista kyllä, se on ravitsemussuositusten perusta.

Diet-heart-hypoteesi juntattiin ravitsemustieteen perustaksi kirsikoita poimimalla ja tutkimusaineistoa manipuloimalla.

Ranskalainen paradoksi on eurooppalainen paradoksi, joka ei oikeastaan ole paradoksi lainkaan, jos hyväksytään, ettei tyydyttyneet rasvat ole sydäntautien tärkein syy.

Ranskalaiset syövät paljon tyydyttyneitä rasvoja, mutta eivät sairastu tai kuole sydäntauteihin samassa suhteessa kuin vähemmän tyydyttyneitä rasvoja syövät. Kuinka se on mahdollista?

Ehkäpä ranskalaisten sydänterveyden perusta on punaviinin sisältämä resvetratoli?

Tehtyä virhettä on piiloteltu vuosikymmeniä. On helpompi keksiä erilaisia hassuja meriselityksiä ranskalaiselle paradoksille, kuin myöntää, että rasvojen suhteen tehtiin virhe, joka on vaikuttanut negatiivisesti satojen miljoonien ihmisten terveyteen.

Punaviini ehkäisee sydäntauteja ja syöpiä Ranskassa yhtä todennäköisesti kuin Koskenkorva ehkäisee alkoholismia Suomessa. Riittävä määrä kossua poistaa alkoholismin luonnollisen poistuman kautta. Ehkä meidän kaikkien pitäisi juoda enemän punaviiniä tai kossua ja sairastua maksakirroosiin ranskalaisten tapaan.

Resveratroli on tärkeä antioksidantti. Sydänterveydelle hyödylliset vaikutukset edellyttäisivät annostusta, jonka saa 400 viinilasillisesta. Kyllä minä kannatan punaviinin juomista, mutta ei se sydäntäni suojaa, paitsi sydänsuruilta.

On hyväksyttävä mahdollisuus, että tyydyttyneet rasvat eivät ole sydäntautien pääasiallinen syy. Jos sydäntauteja aiheuttaa jokin muu tekijä, silloin ranskalaisen paradoksin ongelma ratkeaa kuin itsestään.

Ongelmaksi jää se, että meitä on viety kuin pässiä narussa viimeiset viisikymmentä vuotta.

Onko ranskalainen paradoksi totta?

Ranskalainen paradoksi on totta, mutta se on eräänlainen tilastollinen illuusio. Laajoja populaatioita käsittelevistä tilastoista voi vetää jännittäviä korrelaatioita. Isojen väestöjen kohdalla vaikuttavia muuttujia on kuitenkin valtavasti. Jonkin havaitun ilmiön ja valitun muuttujan välille on helppoa vetää korrelaatio, mutta syy- ja seuraussuhteen osoittaminen onkin jo vaikeampaa.

Esimerkiksi margariinien kulutus korreloi avioerojen kanssa Mainen osavaltiossa. Suomessa jäätelön kulutus korreloi hukkumistapausten kanssa. Nämä ovat tosiasioita, mutta niiden välillä ei vallitse suoraa syy- ja seuraussuhdetta.

Euroopan maissa, joissa syödään eniten tyydyttyneitä rasvoja, sydäntaudit ja sydäntautikuolleisuus on vähäisintä. Vastaavasti on totta, että sydäntautien esiintyvyys ja sydäntautikuolleisuus on korkeinta maissa, joissa tyydyttyneitä rasvoja syödään vähiten. Kansallisia ja alueellisia muuttujia on paljon, eikä korrelaatiosta voi johtaa kausaliteettia.

Joissain vanhoissa seurantatutkimuksissa tyydyttyneiden rasvojen ja sydäntautien esiintyvyyden välillä on havaittu heikko korrelaatio

Vähemmän tyydyttyneitä rasvoja syöneet ihmiset ovat todennäköisesti noudattaneet muutenkin terveellisempiä elämäntapoja. Terveellisiä elämäntapoja noudattavan ihmisen efekti on hyvin tunnettu ilmiö.

Terveelliset elämäntavat ovat yleisiä muitakin terveellisiä elämäntapojan noudattavassa ihmisryhmässä. Tähän ryhmään kuuluvat liikkuvat enemmän, ovat hoikempia, sairastavat vähemmän diabetesta, tupakoivat vähemmän, juovat vähemmän alkoholia jne.

Sydänterveyttä ylläpitää yleisesti terveellisemmät elintavat. Ihminen, joka välttää tyydyttyneitä rasvoja sen vuoksi, että viranomaiset ovat kehottaneet välttämään epäterveellisiä rasvoja, välttää usein myös muita epäterveellisiksi luokiteltuja elämäntapoja, kuten tupakointia, yletöntä alkoholilla läträämistä, ylimääräistä suolaa tai sokeria jne.

Totuus on ranskalaisen paradoksin ja seurantatutkimusten välillä. Tyydyttyneet rasvat eivät ole sydäntautien merkittävin aiheuttaja. Elämäntapojen kokonaisuus vaikuttaa sairastumisriskiin enemmän, kuin yksittäinen muuttuja, kuten tyydyttynyt rasva.

 Ruokavalion ja muiden elämäntapojen lisäksi terveyteen vaikuttaa geeneistä ja ympäristöstä alkaen suuri määrä tunnettuja ja tuntemattomia muuttujia, joiden kontrollointi tutkimuksissa on hankalaa.

Oheinen kaavio, jonka julkaisi British Journal of Nutrition, perustuu Maailman terveysjärjestön (WHO) ja YK:n elintarvike- ja maatalousjärjestön (FAO) tilastoihin tyydyttyneiden rasvojen keskimääräisestä saannista 41 Euroopan maassa vuonna 1998, sekä ikään mukautetusta riskistä kuolla sydänsairauksiin. Se kertoo sen, mitä kysyin tekstin aluksi.

  • Ranskassa syödään enemmän tyydyttyneitä rasvoja, kuin missään muussa Euroopan maassa, mutta ranskalaisilla esiintyy vähiten sydäntauteja Euroopassa.
  • Ranskalaisten jälkeen sveitsiläiset syövät toiseksi eniten tyydyttyneitä rasvoja. Vastaavasti sveitsiläisten sydäntautikuolleisuus on toiseksi matalin Euroopassa.
  • Euroopan maissa, joissa syödään eniten tyydyttyneitä rasvoja, sydäntautien ja sydäntautikuolleisuuden esiintyvyys on alhaisinta.
  • Vähiten tyydyttyneitä rasvoja ja eniten monityydyttämättömiä rasvoja kuluttavissa maissa, kuten Georgiassa ja Moldovassa, sydäntautikuolleisuus on yleisintä Euroopassa.

Vähemmän tyydyttynyttä rasvaa, enemmän sydäntauteja

Euroopassa vähiten tyydyttyneitä rasvoja ja eniten monityydyttämättömiä rasvoja kuluttavissa maissa, kuten Georgiassa ja Moldovassa, sydäntautikuolleisuus on yleisintä.

Tämä ei tietenkään todista, että tyydyttynyt rasva suojaisi sydänsairauksilta.

Tämä havainto nostaa esiin aiheellisen kysyyksen: Jos tyydyttyneiden rasvojen kulutus assosioituu suurempaan sydäntautikuolleisuuteen, kuten viranomaiset väittävät, miksi niissä maissa, joissa tyydyttyneitä rasvoja syödään eniten, sydäntautikuolleisuus on todellisuudessa harvinaisempaa, kuin maissa, jossa tyydyttyneitä rasvoja syödään vähiten?

Ovatko tyydyttyneet rasvat sittenkin haitallisia?


Paleoruokavalion johtava teoreetikko, Loren Cordain arvioi, että varhaisten metsästäjä-keräilijöiden energiansaannista 15 % oli peräisin tyydyttyneistä rasvoista. Jos se on totta, kehomme on hyvin adaptoitunut käyttämään tyydyttyneistä rasvoista saatavaa energiaa.

Ihminen voi Cordainin hypoteesin mukaan syödä yli kaksi kertaa enemmän tyydyttyneitä rasvoja, kuin mitä Yhdysvalloissa suositellaan. Ranskassa ja Sveitsissä ihmisten energiansaannista jo noin 15 % saadaan tyydyttyneistä rasvoista, mikä tukee Cordainin näkemystä.

Onko raskalaisten ja sveitsiläisten parempi sydänterveys vain ilahduttava sattuma, vai voisiko se liittyä tyydyttyneisiin rasvoihin?

Savua ja peilejä

Ravitsemustieteessä käytetään paljon savua ja peilejä. Tilastollisten silmänkääntötemppujen soveltaminen taloudellisten ja poliittisten päämäärien saavuttamiseksi on yleistä.

Joskus iltapäivälehtien ravitsemusta käsittelevät jutut ovat yhtä epätieteellisiä, kuin astrologiset väittämät, joiden mukaan ravuilla on erityinen alttius suolistotaudeille, koska kuun merkeissä syntyneet ravut stressaavat muita tähtimerkkejä enemmän.

Kritiikkiä kovista rasvoista

Rasvojen merkitystä ateroskeloosin patogeneesissä on tutkittu siitä alkaen, kun Anitschkow kidutti kaneja monilla mielikuvituksellisilla menetelmillä. Hänen tutkimuksensa osoittivat, että kolesteroli ja tyydyttyneet rasvat aiheuttavat kanien valtimoissa ateroskleroosiin viittaavia muutoksia.

Kriittinen pilkunnussija voisi kysyä: pitäisikö tämän yllättää? Tyydyttyneet eläinrasvat ja kolesteroli eivät ole kanien luontaista ravintoa. Kanin aineenvaihdunnalta puuttuu keinot hyödyntää eläinrasvoja ja kolesterolia.Ihmisen aineenvaihdunta sen sijaan osaa hyödyntää kovia eläinrasvoja ja kolesterolia.

Seerumin kohonneen kolesterolin ja sepelvaltimotaudin suhde on vuosikymmenten aikana vakiintunut tieteelliseksi paradigmaksi, mutta ruokavalion rooli sepelvaltimotaudin ehkäisyssä ja hoidossa on edelleen epäselvä ja kiistelty aihe.

Mann kirjoitti vuonna 1977: ”Vuosikymmenen jatkunut kiista ruokavalion yhteydestä sydäntauteihin on johtanut kaaokseen”. E.H. Ahrens, Jr., joka oli yksi diet-heart-hypoteesin alullepanijoista, totesi vuonna 1985, että vielä ei ole osoitettu ruokavalion muuttamisen ehkäisevän sepelvaltimotautia.

Ancel Keysin 1950-luvulla tekemät tutkimukset keskittyivät tyydyttyneitä rasvoja sisältäviin ruokavalioihin.

1960-luvulla senaattori George McGovern johti senaatin molempien puolueiden komiteaa, joka yhdessä Yhdysvaltain maatalousministeriön (USDA) kanssa päätyi suosittelemaan Ancel Keysin mallin mukaista ruokavaliota, jossa kovat rasvat korvataan monityydyttämättömillä kasvirasvoilla.

Väestötasolla ravitsemuksen ohjaaminen vähärasvaiseen, ja erityisesti vähän kovia rasvoja sisältävään suuntaan alkoi toden teolla, kun Kansallisen terveysjärjestön (NIH) rahoittamien Lipiditutkimusklinikoiden sepelvaltimotaudin ennaltaehkäisyyn tähtäävä ohjelma (LRC-CPPT) valmistui.

Silmänkääntötemppuja

LRC-CPPT osoitti, että kolestyramiini, jota annettiin koehenkilöille noin seitsemän vuoden ajan, laski seerumin kolesterolia 10% ja sepelvaltimotautikuolleisuutta 24%. Tämä oli tilastollisesti merkittävä tulos.

Absoluuttinen sepelvaltimotaudin väheneminen oli selvästi maltillisempi ja lumelääkettä saavassa ryhmässä tulokset olivat jopa hieman paremmat: sepelvaltimotaudin esiintyvyys laski 2 % lumelääkettä saaneessa, ja 1,6 % kolestyramiinia saaneessa kohortissa.

Tämän tutkimuksen perusteella LRC-CPPT-tutkijat päättelivät kuitenkin, että seerumin kolesterolin laskeminen oli merkittävä tekijä sydäntautien ehkäisyssä ja hoidossa. Tämä päätös vahvistettiin, kun statiinikokeissa seerumin kolesterolia onnistuttiin laskemaan 30% – 35%.

Tämä antoi vahvaa näyttöä siitä, että seerumin kolesterolin laskeminen vaikuttaa positiivisesti sydäntautien ennusteeseen.

Nykyään toisaalta tunnustetaan, että osa statiinien hyödyistä voi johtua mekanismeista, jotka eivät liity rasva-aineenvaihduntaan ja kolesteroliin.

LCR-CPPT oli lääketutkimus. Se ei tutkinut ruokavalion vaikutuksia terveyteen.

LRC-CPPT:n tutkijat, NIH, kansallinen kolesterolikoulutusohjelma (NCEP) ja Amerikan sydänliitto (AHA) tekivät tulosten pohjalta uskoon perustuvan hypoteesin:

Jos seerumin kolesterolin lasku lääkkeillä on tehokas tapa ehkäistä sydäntauteja, silloin ravinnosta saatavan rasvan ja kolesterolin saannin vähentäminen laskee seerumin kolesterolia ja vaikuttaa myönteisesti sydän- ja verisuoniterveyteen.

Tämä oli tutkijoiden valistunut arvaus. Vain arvaus. Päätelmä ei perustunut kliiniseen näyttöön ruokavalion sisältämien rasvojen vaikutuksista sydänterveyteen.

Päätelmää seurasi eräs Yhdysvaltojen laajimmista PR-kampanjoista. Tutkijoiden ja viranomaisten oli vakuutettava ammattilaiset, lääkärit, organisaatiot ja kansalaiset siitä, että ravinnon sisältämän rasvan vähentäminen on tehokkain tapa ehkäistä sydän- ja verisuonitauteja.

Elintarviketeollisuus liittyi terveysjärjestöjen (NIH, NCEP, AHA), maatalousministeriön (USDA) ja lukemattomien lääketieteellisten järjestöjen kanssa edistämään tätä konseptia.

Lyhyessä ajassa marketit täyttyivät sydänterveellisistä vähärasvaisista tuotteista, joissa kovat eläinrasvat oli korvattu pehmeillä monityydyttämättömillä kasvirasvoilla ja sokerilla.

Viesti oli selvä: vähärasvaisten ruokien syöminen on turvallista

Valitettavasti 1980-luvun ihminen ei ymmärtänyt, että vähärasvaisissa tuotteissa rasvat korvattiin sokereilla. Rasvojen saannin väheneminen johti hiilihydraattien saannin kasvuun.

Mozaffarianin vuoden 2010 meta-analyysin eräs avainhuomioista oli, että tyydyttyneiden rasvojen korvaaminen monityydyttämättömillä rasvoilla saattaa pitkällä aikavälillä suojata sydänterveyttä, mutta vastaavaa vaikutusta ei ole, jos tyydyttyneet rasvat korvataan hiilihydraateilla. Ja juuri näin tehtiin iloisella 1980-luvulla.

Valitettavasti tämä ei ollut ainoa ongelma. Prosessoitujen öljyjen, margariinien ja lähes kaikkien rasvaa sisältävien elintarvikkeiden mukana tuli transrasvoja, jotka ihan aikuisten oikeasti ovat helvetin haitallisia terveydelle.

”I hope that when you have read this book I shall have convinced you that sugar is really dangerous.” – John Yudkin (Pure, White and Deadly)

Lääketieteellisestä kirjallisuudesta löytyi varoituksia, mutta ne jätettiin suurelta osin huomiotta. John Yudkin kamppaili 1970-luvulla Keysin hypoteesia vastaan ja varoitti sokereiden vaaroista mm. kirjassa Pure, White and Deadly (1972). Yudkin oli oikeassa ja hänen pelkonsa toteutuivat valitettavan tarkasti. Yudkinin varoitukset kaikuivat kuitenkin kuuroille korville.

Rosenman totesi laaja-alaisessa katsauksessa, että ruokavalio ei juurikaan vaikuta seerumin kolesteroliin. Hän mainitsi myös ristiriitaiset uskomukset ruokavalion kausaalisesta roolista sydäntautien patogeneesissä.

Hu et al.wrote that replacing saturated and trans-unsaturated fats with unhydrogenated mono-unsaturated and poly-unsaturated fats was more effective in preventing CAD in women than in reducing overall fat intake. They noted that low-fat–high-carbohydrate (LF-HCarb) diets were widely recommended to reduce the risk of CAD by reducing low-density lipoprotein (LDL) by limiting dietary fat. However, because of its high-Carb content, LF-HCarb diets also decrease high-density lipoprotein (HDL) and increase triglycerides, well-established independent risk factors for coronary disease.”

Yancey et al. kirjoitti: ”Tiedot parhaasta ruokavaliosta sydäntautien ehkäisemiseksi ovat puutteellisia, epätieteellisiä ja usein ristiriitaisia.”
Elämäntapoihin liittyvät epidemiat (lihavuus, tyypin II diabetes ja metabolinen oireyhtymä) ovat vähän rasvaa ja runsaasti hiilihydraatteja sisältävän LFHC-ruokavalion väistämätön seuraus.

Yudkin varoitteli tämänkaltaisesta kehityksestä jo 1970-luvulla. Monista varoituksista, kliinisestä näytöstä ja lihavuus- yms. epidemioista piittaamatta lääketieteelliset organisaatiot ja viranomaiset jatkavat aggressiivista kampanjaa vähärasvaisen elämäntavan edistämiseksi.

Välillä minusta tuntuu siltä, kuin järkevät ihmiset olisivat itsesuggestion avulla hypnotisoineet itsensä uskomaan täysin absurdeja väitteitä.

Covid-19 pandemian rinnalla yhteiskunnan rajallisia resursseja syövät lihavuuteen, aikuistyypin diabetekseen, suolistosairauksiin ja kardiometabolisiin sairauksiin liittyvät pandemiat. Niiden taloudellista rasitetta yhteiskunnille voi vain arvailla.

Yhdysvalloissa lähestytään tilannetta, jossa kaikilla kuolevilla on diabetes. Tämä ei tarkoita, että kaikki kuolevat diabetekseen, mutta se kertoo kuinka nopeasti tauti on yleistynyt. Se kertoo, että pian kaikki amerikkalaiset sairastuvat diabetekseen. Se on aivan sairasta!

Samaan aikaan Yhdysvalloissa tiedostetaan, että lihavuuden ja diabeteksen hoitoon ei pian riitä resursseja.

Ei siis ole lainkaan yllättävää, että miljoonat lihavuuden ja kardiometabolisten sairauksien kanssa kamppailevat ihmiset ovat löytäneet avun ketogeenisistä ruokavalioista, jotka kääntävät viralliset suositukset ylösalaisin ja nurinkurin. Jatkan tätä anarkistista ruokasotaa pian. Siihen asti hyvää syksyä. Pysykää terveinä!

https://www.researchgate.net/publication/322861096_The_Diet-Heart_Hypothesis_Changing_Perspectives

https://www.sciencedirect.com/science/article/pii/S0735109703016310

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2950931/

https://www.nutritioncoalition.us/there-is-concern-about-the-dietary-guidelines

https://www.ncbi.nlm.nih.gov/books/NBK190354/

https://www.repository.cam.ac.uk/bitstream/handle/1810/247312/Chowdhury_et_al-2014-Annals_of_Internal_Medicine.pdf?sequence=1

https://pubmed.ncbi.nlm.nih.gov/28526025/




Ruokasotaa ja anarkiaa osa 1

Ravintoon liittyy väärinkäsityksiä ja myyttejä. Eräiden ravitsemusoppien tieteellinen perusta on vuosikymmenten jälkeen kyseenalainen. Tyydyttynyt rasva ei ehkä olekaan niin vaarallista kuin meille uskotellaan. Ruokasotaa ja anarkiaa kompuroi ravitsemusteorian sudenkuoppiin.

Noam Chomsky sanoo, että anarkismin pitää haastaa, kyseenalaistaa ja ravistella vallitsevien sosiaalisten rakenteiden ja normien legitimiteettiä.

Asioiden vallitsevasta tilasta ei nimittäin voi päätellä, että vallitseva asioiden tila on ainoa oikea, paras mahdollinen tai edes toivottavin tila. Chomskyn ja veljeni määritelmän mukaan minä taidan olla anarkisti.

Uskon, että maailmassa on aina korjattavaa. Monet ravitsemusohjeet vaikuttavat lähemmin tarkasteltuna pikkiriikkisen puskaabeleilta. Jätän tuon termin määrittelemättä.

Myös ravitsemusohjeita pitää aika ajoin ravistella, pureskella ja töniä, ettei ohjeita automaattisesti kuvitella muuttumattomiksi tosiasioiksi. Täysin kiistattomat tosiasiat ovat harvinaisia.

Kaikkien ravitsemusohjeiden tieteellinen perusta ei kestä kirkasta päivänvaloa

Tutkimuksissa ilmeneviä aukkoja tilkitään, mutta esimerkiksi oppi tyydyttyneeen rasvan ja kolesterolin haitoista vuotaa. Nähdäkseni ravintotieteessä soudetaan venellä, jonka toinen airo on poikki.

Ravitsemusoppeja voidaan perustella vääriin tietoihin perustuneilla päätöksillä, eettisillä, ideologisilla ja polittisilla mielipiteillä sekä tutkimustulosten tietoisella tai tiedostamattomalla vääristelyllä ja peittelyllä.

Kansanterveyden ja taloudellisen kantokyvyn vuoksi ravintoa koskeavien ohjeiden pitäisi kuitenkin perustua viimeisimpään tieteelliseen dataan. Näin ei aina tapahdu.

Vallitsevat ohjeet ovat osaltaan vaikuttaneet kardiometabolisten tautien nopean lisääntymiseen. Suolistosairaudet ovat yleistynet tyypin 2 diabeteksen ja lihavuuden rinnalla nopeasti vuoden 1980 jälkeen.

SARS-CoV-2 ei ole ainoa yhteiskunnan voimavaroja kuluttava globaali terveysuhka.

Lihavuuden yleistyminen

Lisääkö punainen liha suolistosyöpien riskiä?

Lihansyöjiä varoitettiin jälleen 17. huhtikuuta 2019 punaisen ja prosessoidun lihan syömiseen liittyvistä riskeistä. Se ei ollut ensimmäinen, eikä varmasti viimeinen kerta, jolloin kasvissyöjät korottavat ääntään. 

Terveyspommi räjähti, kun the Guardian uutisoi, että ”jopa maltillinen punaisen lihan syöminen lisää syöpäriskiä”. CNN heitti bensaa liekkeihin raportoimalla, että ”vain yksi pekoniviipale päivässä on yhteydessä suurempaan paksusuolen syövän riskiin”. The Telegraph kasvatti uhkaa varoittamalla, että ”punaisen lihan syöminen kerran päivässä lisää syöpäriskiä viidenneksellä”.

Luotettavien uutistoimistojen syöpäpeloilla leikittelevät jutut nostivat monen lihansyöjän niskakarvat pystyyn. Jeremy Braude kiinnostui syöpäpelkoja lietsovista uutisotsikoista niin paljon, että päätti hillitä lihapaniikkia avaamalla uutisten taustalla vaikuttavaa tilastotiedettä.

Tilastot ovat tehokkaita vaikuttamisvälineitä, koska ne voivat olla uskomattoman petollisia.

Alkuperäisessä tutkimuksessa, joka julkaistiin International Journal of Epidemiology -lehdessä, todettiin, että ”ihmisillä, jotka syövät punaista ja prosessoitua lihaa neljä kertaa viikossa tai useammin, on 20 % suurempi paksusuolen syövän riski verrattuna niihin, jotka yövät punaista tai prosessoitua lihaa vähemmän kuin kahdesti viikossa.”

Selvä homma! Punaisen ja prosessoidun lihan syöminen on hemmetin vaarallista

Näissä tutkimuksissa 20 % on kuitenkin suhteellinen ja tilastollinen, ei absoluuttinen arvo. On toinenkin tapa tarkastella täsmälleen samoja lukuja.

Kaikista tutkimukseen osallistujista, jotka söivät punaista tai prosessoitua lihaa vähemmän kuin kaksi kertaa viikossa, 0,40 %:lle kehittyi paksusuolen syöpä. Ihmiset, jotka söivät punaista ja prosessoitua lihaa enemmän kuin neljä kertaa viikossa, 0,63 %:lle kehittyi paksusuolen syöpä.

Ero paksusuolen syövän kehittymisen todennäköisyydessä vähän punaista lihaa ja paljon punaista lihaa syövien väestöryhmien välillä oli vain 0,23 %. Harvempi kuin 1 % ”korkeamman riskin” ryhmästä sairastui paksusuolen syöpään.

Punaisen ja prosessoidun lihan kulutus voi tilastollisesti lisätä suolistosyövän riskiä, mutta syy-seuraussuhde ei ole selvä ja todellinen riski sairastua suolistosyöpään punaisen lihan vuoksi on hyvin pieni.

Vertailun vuoksi paksusuolen syöpää havaittiin samassa tutkimuksessa 0,48 prosentilla osallistujista, jotka käyttivät vähemmän kuin gramman alkoholia päivässä, ja 0,68 prosentilla osallistujista, jotka käyttivät yli 16 grammaa alkoholia päivässä.

Tilastollisesti oluen tai viinilasillisen juomisella joka päivä on yhtäläinen vaikutus paksusuolen syövän riskiin kuin punaisen tai prosessoidun lihan syömisellä neljä kertaa viikossa. Riski oli kuitenkin selvästi alle prosentin ja mahtuu tutkimuksen virhemarginaaliin.

Laajennetaan katsantoa

Verrataan lihan syömisen riskejä tupakoinnin riskeihin. Länsimaissa keuhkosyövän riski on 9,4 – 23,2 kertainen tupakoitsijoilla tupakoimattomiin verrattuna. Punaisen ja prosessoidun lihan syöminen neljä kertaa viikossa voi lihapaniikkia lietsovan uutisoinnin mukaan kasvattaa paksusuolen syövän riskiä noin 20 %, mutta tupakointi kasvattaa keuhkosyövän riskiä jopa 840–2220%.

Punaisen lihan syömisen riskit ovat siedettäviä tupakointiin verrattuna.

Experimental Biology and Medicine kertoo tutkimuskatsauksessaan, että havaintojen mukaan hemirauta ja heterosykliset amiinit kasvattavat paksusuolen syövän riskiä. Hemirautaa saa punaisesta lihasta. Heterosyklisiä amiineja kehittyy, kun liha valmistetaan korkeassa lämpötilassa.

Monet tutkimukset tehdään laboratorio-oloissa joko soluviljelmillä tai koe-eläimillä. Näissä tutkimuksissa käytetään lihakomponenttitasoja, jotka ylittävät selvästi ihmisten normaalin punaisen lihan kulutuksen. Tutkimukset eivät yleensä huomioi muista ravinteista saatavien biologisesti aktiivisten yhdisteiden vaikutuksia. Esimerkiksi C-vitamiini hidastaa hemiraudan imeytymistä.

Kausaalista ja mekaanista yhteyttä punaista lihaa sisältävän monipuolisen ruokavalion ja lisääntyneen suolistosyövän riskin välillä on hankala osoittaa.

Muistelen, että punaisen lihan syöpäriskiä kasvattavan ideologian lanseerasi maailman medioille ja Maailman terveysjärjestölle pelkästään vegetaristeista ja vegaaneista koostuva tieteellinen paneeli. Vaikuttiko punaisen lihan mustamaalaamiseen eettiset, ideologiset ja poliittiset syyt?

Suattaapi olla, että vaikutti, mutta suattaapi olla ettei vaikuttanut, sanoisi poliittisesti korrekti savolainen.

Kyselykaavakkeisiin perustuvat epidemiologiset väestötutkimukset eivät yleensäkään anna täsmällistä ja luotettavaa tietoa tutkittavan väestön todellisista elintavoista. Ihmiset unohtavat, liioittelevat, väheksyvät ja valehtelevat tietoisesti tai tietämättään syömistään ruoista. Tämän vuoksi epidemiologisista väestötason kyselytutkimuksista ei pitäisi johtaa muuta kuin yleisiä suuntimia ja väestötason tendenssejä.

Australialaistutkimuksessa osoitettiin, että punaisen lihan syöminen osana Välimeren ruokavaliota laskee MS-tautiin sairastumisen riskiä 38 % (1).

Okei. Minä olen multippelisklerootikko ja lihansyöjä. Minulla kävi sitten vain helvetin huono tsägä!

Vastaavat tutkimukset ovat osoittaneet, että Mainen osavaltiossa margariinien syönti korreloi avioerojen kanssa. Onko ilmiö yleistettävissä ja voisiko voihin siirtyminen vähentää avioerojen riskiä globaalisti?

Minä kokeilin, mutta ei se toiminut. Voihin siirtyminen ei pelastanut minun avioliittoani, joten syy erolle taisi olla jokin muu kuin margariini.

Vastaavasti voidaan kysyä, vähentääkö punaisesta lihasta luopuminen paksusuolen syövän riskiä yhtä paljon kuin punaisesta lihasta luopuminen lisää multippeliskleroosin riskiä? Entä lisääkö punaisesta lihasta luopuminen diabeteksen riskiä?

Nämä ovat hankalia monivalintatehtäviä: ms, diabetes vai syöpä? Siinäpä pulma.

Tyydyttynyt rasva ja rasvaisia ruokajuttuja

Kova tyydyttynyt rasvat ja kolesteroli voivat nykytiedon mukaan kasvattaa sydän- ja verisuonitautien riskiä. Kolesterolin vaarallisuutta ei epäillä juuri koskaan.

Kolesteroli tappaa yhtä varmasti kuin glyfosaatti, mutta hitaammin kuin syanidi tai arsenikki. Näyttö ja ihmisen historia ei yksiselitteisesti ja kiistattomasti tue tällaisia uskomuksia. Epäilylle jää tilaa.

Elämä tarvitsee vältämättä kolesterolia ja tyydyttynyttä rasvaa. Kaikissa ihmisen solujen rakenteissa on kolesterolia.

Kolesteroli vaikuttaa steroidihormonien, kuten sukupuolihormonien synteesiin. Hermoston ja aivojen normaali kehitys edellyttää, että imeväisikäiset vauvat saavat äidinmaidosta tärkeitä eläinrasvoja ja kolesterolia.

Rintaruokittavat vauvat noudattavat ketogeenistä ruokavaliota. Karppaus on kaikesta siihen liittyvästä pelottelusta huolimatta ihmisen ensimmäinen ruokavalio.

Jos tyydyttynyt rasva ja kolesteroli olisivat yhtä haitallisia, kuin uskotaan, evoluutio olisi miljoonien vuosien kehityshistorian aikana muuttanut rintamaidon rasvakoostumusta terveellisempään suuntaan. Ei pelkästään ihmisellä, vaan kaikilla muillakin nisäkkäillä.

Miksi nisäkkäät tuottavat kolesterolia kolesterolisynteesissä, jos se on kovin haitallista?

Kolesterolia tuotetaan asetyylikoentsyymi-A:sta nelivaiheisessa synteesissä. Ensimmäisessä vaiheessa kolme asetyyli-KoA:ta yhdistetään mevalonaatiksi.

Mevalonaatista syntyy kaksi fosfaattiryhmillä aktivoitua isopreenimolekyyliä. Kuusi tällaista isopreenimolekyyliä polymerisoituu ketjuksi, jossa on useita kaksoissidoksia. Nämä kaksoissidokset muutetaan hiiliatomien välisiksi sidoksiksi, jolloin syntyy nelirenkainen rakenne, joka on kaikkien sterolien perusrakenne.

Suurin osa maksasolun tuottamasta kolesterolista kuljetetaan ulos solusta esimerkiksi sappihappoina tai kolesteryyliesterinä. Kolesteryyliesteri on kolesterolia hydrofobisempi molekyyli, joka kuljetetaan maksasta muualle elimistöön lipoproteiinipartikkeleissa, erityisesti LDL-partikkeleissa

Lisämunuaisessa kolesterolista valmistetaan steroidihormoneja, kuten lisämunuaiskuoren mineralokortikoideja ja glukokortikoideja, jotka säätelevät munuaisten ionien imeytymistä ja glukoneogeneesiä. Sukupuolihormoneja, kuten androgeenejä, estrogeenejä ja progesteronia, tuotetaan sukupuolirauhasissa ja istukassa.

Pahaa kolesterolia ei ole – on vain kolesterolia, joka on elimistön välttämättä tarvitsema aine

”Kolesteroli on ihmisen ja muiden eläinten kudoksissa, etenkin maksassa, tuotettu steroideihin kuuluva tyydyttymätön, rengasrakenteinen, veteen liukenematon kiteinen alkoholi.

Kolesteroli on ihmisen kaikkien kudosten toiminnalle välttämätön aine, jota esiintyy runsaasti varsinkin äidinmaidossa, rasvakudoksessa, aivoissa, hermoissa, maksassa ja munuaisissa. Usein puhutaan kansanomaisesti ”hyvästä” ja ”pahasta” kolesterolista, mutta kaikki kolesteroli on silti kemialliselta rakenteeltaan täysin samanlaista.” – Wikipedia/Kolesteroli

LDL ja HDL ovat rasvaa, rasvaliukoisia vitamiineja ja kolesterolia kuljettavia lipoproteiineja. Lyhenteet viittaavat Low Density Lipoprotein- ja High Density Lipoprotein -kuljetusmolekyyleihin.

Keho tarvitsee pieniä määriä omega6-rasvoja, kuten linolihappoa. Mutta käynnissä oleva tutkimus viittaa siihen, että linolihapon runsas saanti voi ylläpitää kehon hiljaista tulehdusta (inflammaatiota) ja altistaa monille sairauksille. Omega3- ja omega6 rasvahappojen tasapainoinen saanti lienee terveyden kannalta tärkeämpää kuin kiista kovista tyydyttyneistä ja pehmeistä tyydyttämättömistä rasvahapoista.

Ihminen, läski ja kolesteroli – miksi?

Ihmisen suolisto ja ruoansulatus käyttää vähemmän energiaa kuin useinpien muiden eläinten suolisto. Mikään muu laji ei toisaalta käytä niin paljan ravinnosta saatua energiaa aivojen toiminnan ylläpitoon kuin ihminen.

Tyydyttynyt rasva on erinomainen ja runsaasti energiaa sisältävä ravintoaine. Rasvan sisältämä energia, 9 kcal/g, piti varhaiset metsästäjä-keräilijät hengissä ennen maanviljelyn ja säilöntämenetelmien kehittymistä.

On selvää, että puolukoiden kerääminen talvihangilla ei taannut pohjoisten ihmisten selviytymistä. Minä uskon, että eläinrasvan sisältämä energia joudutti ihmisaivojen kehittymistä ja auttoi ihmislajin selvitymään.

Rasva on syntyvän ihmisen ensimmäistä ravintoa, joten ihmisen aineenvaihdunta virittyy rasvaan ravinnonlähteenä jo hyvin varhain.

Rintaruokinnassa olevat vauvat ovat ketoosissa. Vauvat karppaavat.

Tyydyttynyt rasva on ollut osa ihmisten ruokavaliota koko ihmislajin kehityshistorian ajan. Ihmisen aivot eivät ehkä olisi koskaan kehittyneet nykyihimisen suuriksi ja runsaasti energiaa kuluttaviksi ihmisaivoiksi, jos kaukaiset esivanhempamme eivät olisi saaneet riittävästi energiaa eläinrasvoista. 

Maanviljely kehittyi noin 10 000 vuotta sitten. Ennen maanviljelyn kehittymistä eläneet varhaiset metsästäjä-keräilijät saivat suuren osan ravinteista ja energiasta eläinproteiineista ja eläinrasvoista lähes 200 000 vuoden ajan.

Tyydyttyneistä rasvoista varoittelevat ravitsemussuositukset julkaistiin Yhdysvalloissa alle 50 vuotta sitten. Onko ihmisen aineenvaihdunta ratkaisevasti muuttunut viimeisen vuosisadan kuluessa?

Syömämme ravinto on muuttunut enemmän kuin aineenvaihduntamme. Monityydyttämättömiä siemenöljyjä on hyödynnetty ravinnossa vain noin sata vuotta.

Ravinto on osatekijänä monissa nopeasti yleistyvissä sairauksissa. Lihavuus, metabolinen oireyhtymä, aikuistyypin diabetes, suolistosairaudet, sydän- ja verisuonitaudit ja monet syövät voidaan tietyin varauksin palauttaa syötyyn ravintoon, ja aivan erityisesti sellaiseen prosessoituun ruokaan, jonka käyttöön aineenvaihduntamme ei ole ehtinyt adaptoitua.

60– ja 70-luvuilla rasvojen terveysvaikutuksista tehtiin kiinnostavia kontrolloituja satunnaistettuja tutkimuksia (CRT). Nämä tutkimukset eivät kuitenkaan mahtuneet vallitsevaan hypoteesiin kovien rasvojen haitallisuudesta, joten ne niiden annettiin unohtua.

Minnesota Coronary Experiment

Hiljattain pölyisestä kellarista löydetty vuosikymmeniä vanha tutkimus herättää kysymyksiä vallitsevista ravitsemusohjeista.

Minnesota Coronary Experiment, oli kontrolloitu satunnaistettu tutkimus (CRT), joka toteutettiin vuosina 1968 – 1973.

Valtion mielisairaaloissa ja vanhainkodeissa tutkittiin yli 9000 ihmisen avulla ruokavalion sisältämien rasvojen vaikutuksia terveyteen, kolesterolitasoihin sekä sydäntautien ja sydänkuolemien riskiin.

Kansallisen sydän-, keuhko- ja veri-instituutin (National Heart, Lung and Blood Institute) rahoittamaa tutkimusta johti Minnesotan yliopiston lääketieteellisen koulun tohtori Ivan Frantz Jr.

Institutionalisoituneiden tutkimushenkilöiden ruokavalion sisältämiä rasvoja kontrolloitiin. Puolet koehenkilöistä sai ravintoa, jossa oli runsaasti maidon, juuston ja naudanlihan sisältämiä tyydyttyneitä rasvoja (SFA – saturated fatty acids).

Vertailuryhmän ruokavaliosta tyydyttyneet rasvat poistettiin lähes täysin ja korvattiin monityydyttämättömillä kasvirasvoilla (PUFA – poly unsaturated fatty acids).

Tutkimuksen tavoitteena oli todistaa, että tyydyttyneiden eläinrasvojen korvaaminen kasviöljyistä saatavilla tyydyttymättömillä rasvoilla laskee sydäntautien ja -kuolleisuuden riskiä.

Tietoja ei koskaan analysoitu täysin, vaikka Minnesota Coronary Experiment oli eräs laajimmista kontrolloiduista satunnaistetuista ruokavaliotutkimuksista, joita koskaan on tehty.

Joitain vuosia sitten Kansallisen terveysinstituutin (National Health Institute) lääketutkija Christopher E. Ramsden kuuli unohdetusta tutkimuksesta. Hän kiinnostui aiheesta ja otti yhteyttä Minnesotan yliopistoon tutustuakseen julkaisemattoman tutkimuksen aineistoon.

Vuonna 2009 kuollut tohtori Frantz oli elinaikanaan tyydyttyneiden rasvojen terveysvaikutuksiin perehtynyt tutkija Minnesotan yliopistossa. Eräs Frantzin läheisistä kollegoistaan oli vaikutusvaltainen ravitsemustutkija Ancel Keys.

Ancel Keysin alkuperäistä dataa 7 maan tutkimuksesta. Maita oli 22, mutta tutkimukseen Keys hyväksyi vain ne 7 maata, joiden data tuki hänen ennakkohypoteesiaan. Esimerkiksi Ranskassa tyydyttyneiden rasvojen kulutus on runsasta, mutta sydätaudit ja -kuolemat harvinaisia. Tämä tunnetaan ranskalaisena paradoksina.

Keys uskoi kolesterolin ja tyydyttyneiden rasvojen lisäävän sydäntautien riskiä. Häntä voi pitää nykyisten ravitsemussuositusten isänä.

Tohtori Frantz uskoi Keysin tavoin tyydyttyneiden rasvojen haitallisuuteen, kertoi tutkijan poika, sydänlääkäri tohtori Robert Frantz, joka löysi Minnesotan pölyttyneen tutkimusraportin vanhempiensa kellarista.

Minnesota Coronary Experiment oli yllättävä. Koehenkilöillä, joiden ravinto sisälsi vain vähän tyydyttyneitä eläinrasvoja, kolesteroli laski keskimäärin 14 prosenttia. Vertailuryhmässä muutos kolesterolitasoissa oli vain prosentin luokkaa.

Vähän tyydyttyneitä rasvoja sisältävä ruokavalio ei kuitenkaan laskenut sydänkuolleisuutta. Päinvastoin. Tutkimuksen havainnot osoittivat, että mitä enemmän kolesteroli laski, sitä korkeammaksi sydäntautikuoleman riski kasvoi. Toisin sanoen kolesterolin laskeminen lisäsi kuolleisuutta.

Framingham Heart Study oli tehnyt samankaltaisen havainnon 1960-luvulla, mutta sekin jäi muiden Framinghamin tutkimusten varjoon.

Tulokset ovat ristiriidassa tyydyttyneiden rasvojen välttämiseen ohjaavien neuvojen kanssa. Kellarista löydetty tutkimus aiheutti melkoisen pöhinän ja pienimuotoisen skandaalin tutkijapiireissä. Pian ravitsemuspiireissä alkoi kiivas selittely ja tutkimuksen vähättely.

Huoli: institutionalisoidut opit vaarassa?

Analyysi, joka julkaistiin BMJ-lehdessä, nostatti ravitsemustutkijoiden keskuudessa kiivaita vastalauseita. Kritiikin mukaan Minnesotan tutkimus oli puutteellinen.

Walter Willett, Harvardin yliopiston ravitsemusosaston puheenjohtaja, väitti tutkimusta merkityksettömäksi. Willett tunnetaan mm. siitä, että hän laati monissa nykyisissä epidemiologisissa ravitsemustutkimuksissa käytettävät kyselykaavakkeet, joiden tutkimuksellista arvoa pidetään epäluotettavana.

Vuoden 2015 kansallisten ravintosuositusten päivittämiseen osallistunut ravitsemusasiantuntija Frank Hu väitti puolestaan, että Minnesotan tutkimus ei ollut tarpeeksi pitkäkestoinen osoittamaan monityydyttämättömien kasviöljyjen sydän- ja verisuonitautien riskiä alentavaa vaikutusta, koska koehenkilöitä seurattiin keskimäärin vain noin 15 kuukautta. Ehkäpä Hu on oikeassa, tai sitten ei ole.

Mozaffarianista Chowdhuryyn ja Zamoraan

Frank Hu viittasi Mozaffarianin vuoden 2010 metaanalyysiin, jonka mukaan ihmisillä oli 10 % vähemmän sydänkohtauksia, kun he korvasivat 5 % päivittäisistä tyydyttyneistä rasvoista monityydyttymättömillä rasvoilla vähintään neljän vuoden ajan.

Mozaffarianin tutkimuksessa oli kiinnostava havainto: jos tyydyttyneiden rasvojen saanti korvattiin hiilihydraateilla, hyötyä ei saavutettu.

Mozaffarian ja Skeaff/Miller (2009) suosittavat meta-analyysiensa perusteella tyydyttyneiden rasvojen korvaamista monityydyttämättömillä kasvirasvoilla. Siri-Tarino (2010), ja Chowdury (2014) saivat meta-analyyseissaan tuloksia, jotka eivät tue nykyisiä ravitsemussuosituksia ja väitteitä tyydyttyneiden rasvojen haitoista.

Tohtori Zamora ja hänen kollegansa puolestaan analysoivat neljä vastaavaa ravitsemuskoetta, joissa tutkittiin tyydyttyneen rasvan korvaamista kasviöljyillä ja rasvatyypin vaihdon terveysvaikutuksia.

Zamoran ryhmän analysoimat kontrolloidut satunnaistetut tutkimukset eivät tukeneet vallitsevia ravitsemussuosituksia tai väitettä, että monityydyttämättömät rasvat vähentävät sydänsairauksiin kuolleisuutta.

Vallitseva näkemys on, että matalat kolesterolitasot ovat yhteydessä pienempään sydäntautien riskiin ja sydäntautikuolleisuuteen.

Minnesota Coronary Experiment havaitsi kuitenkin täysin päinvastaisen yhteyden. Tutkimus osoitti, että kolesterolin lasku lisää kuolleisuutta.

Minnesotan tutkimuksessa interventio-ryhmän seerumin kolesteroli laski merkittävästi verrattuna kontrolliryhmään.

Jokainen 0,78 mmol / l seerumin kolesterolipitoisuuden lasku kasvatti sydäntautikuoleman riskiä 22%.

Interventioryhmässä ei saatu näyttöä monityydyttämättömien rasvahappojen ateroskleroosilta ja sydäninfarkteilta suojaavasta vaikutuksesta. Systeemisessä katsauksessa huomioitiin viisi satunnaistettua kontrolloitua tutkimusta. Meta-analyyseissä nämä kolesterolia laskevat interventiot eivät osoittaneet sepelvaltimotautikuolleisuuden tai kokonaiskuolleisuuden laskua.

Satunnaistettujen kontrolloitujen tutkimusten käytettävissä olevat todisteet osoittavat, että ruokavalion tyydyttyneiden rasvojen korvaaminen linolihapolla alentaa tehokkaasti seerumin kolesterolia, mutta ei tue hypoteesia, jonka mukaan kolesterolin lasku vähentäisi sepelvaltimotaudin, sydäninfarktien tai kaikkien syiden aiheuttamaa kuoleman riskiä.

Minnesota Coronary Study on osa kasvavaa näyttöä siitä, että monityydyttämättömien kasviöljyjen ja tyydyttyneiden rasvojen vaikutuksia sydänterveydelle on liioiteltu.

Tyydyttyneiden rasvojen vaihtaminen monityydyttämättömiksi kasvirasvoiksi voi tutkimuksesta riippuen olla jopa sydänterveydelle haitallista.


Eräs selitys yllättävälle havainnolle voi olla omega6-rasvahapot, joita on korkeina pitoisuuksina maissi-, soija-, puuvillansiemen- ja auringonkukkaöljyissä.

Johtavat ravitsemusasiantuntijat korostavat, että ruoanlaitto kasviöljyillä laskee kolesterolia ja estää sydänsairauksia.

Mutta on sellaistakin tutkimusnäyttöä, että runsas omega6-rasvojen saanti voi ylläpitää hiljaista tulehdusta (inflammaatiota) ja siten lisätä sairastumisalttiutta ja kuolleisuutta.

Inflammaatioon kytkeytyvät terveysriskit voivat olla suurempia kuin kolesterolin alentamiseen liittyvät edut.

Ramsden ja Sydney Diet Heart Study

Vuonna 2013 tohtori Ramsden kollegoineen julkaisi hämmennystä herättäneen selvityksen Australiassa 1960-luvulla toteutetusta kliinisestä tutkimuksesta. Tämän tutkimuksen tuloksia ei koskaan julkaistu tai analysoitu.

Australialaisessa tutkimuksessa havaittiin, että miehillä, jotka korvasivat tyydyttyneet rasvat monityydyttämättömillä omega6-rasvoilla, kolesteroli laski, mutta sydänkuolleisuus vastaavasti kasvoi enemmän kuin tyydyttyneitä rasvoja syövällä kontrolliryhmällä. Tulos on nykyisten suositusten vastainen.

Ramsden korosti, että havaintoja tulee tulkita varovaisesti. Tutkimus ei osoittanut, että tyydyttyneet rasvat olisivat terveellisempiä kuin monityydyttämättömät rasvat, hän sanoi. Mutta ehkä ne eivät ole niin haitallisia kuin yleisesti uskotaan.

Ravintorasvojen taustalla oleva tiede on monimutkaisempaa kuin ravitsemussuositukset antavat ymmärtää. Rasvojen ja kolesterolin vaikutukset eivät ole yksinkertaisia ja mustavalkoisia. Syöty ravinto on aina monista ravintoaineista muodostuva kokonaisuus.

Sata vuotta sitten amerikkalaisten päivittäisestä energiasta vain 2 prosenttia tuli linolihaposta. Nykyään amerikkalaiset saavat linolihaposta keskimäärin yli kolminkertaisen määrän energiaa.


Suuri osa omega6-rasvoista saadaan prosessoiduista ruoista, kuten makeisista, pizzasta, ranskalaisista, välipaloista, perunalastuista, kekseistä ja salaattikastikkeista.

Luonnollisemmat rasvalähteet, kuten oliiviöljy, voi ja munankeltuaiset, sisältävät myös linolihappoa, mutta vähemmän kuin monet kasviöljyt ja margariinit.

Alkuperäisen jutun lähde: New York Times

Sydney Diet Heart Study

Linolihappoa (omega6) saaneessa interventioryhmässä oli korkeampi kuolleisuus sydäntauteihin ja kaikkiin syihin kuin verrokkiryhmässä.

Suositukset tyydyttyneiden rasvojen korvaamisesta tyydyttämättömillä kasvirasvoilla ovat keskeinen osa kansainvälisiä ravitsemusohjeita. Ohjeiden tavoite on laskea sepelvaltimotaudin ja muiden sydänsairauksien riskiä.

Sydneyn tutkimuksessa ei havaittu linolihapon (omega6) kliinisiä etuja sydänterveydelle.

Tässä kohortissa tyydyttyneiden rasvojen korvaaminen linolihapolla itse asiassa lisäsi kuolleisuutta sepelvaltimotautiin, sydän- ja verisuonisairauksiin ja kaikkiin syihin.

Linolihappojen terveydellisten vaikutusten interventiotutkimuksen päivitetty meta-analyysi ei löytänyt näyttöä, joka tukisi nykykäsitystä monityydyttämättömien rasvojen eduista sydän- ja verisuoniterveydelle.

Muita tutkimuksia tyydyttyneiden ja tyydyttymättömien rasvojen vaikutuksista terveyteen

Suomalainen mielisairaalatutkimus

Kellokosken ja Nikkilän mielisairaaloissa tehtiin 1959-71 kontrolloitu interventiotutkimus, jonka tarkoituksena oli selvittää, voiko sepelvaltimotaudin (CHD) ilmaantuvuutta laskea seerumin kolesterolia alentavalla ruokavaliolla.
Suomalainen mielisairaalatutkimus on eräs vahvimmista Keysin Diet-Heart-hypoteesia tukeva tutkimus.

Koehenkilöt olivat sairaalahoidossa olevia naisia ja miehiä. Osa koehenkilöistä sai kolesterolia laskevaa ravintoa. Ruokavalio sisälsi vain vähän tyydyttyneitä rasvoja ja kolesterolia sekä runsaasti tyydyttymättömiä rasvoja.

Toinen potilasryhmä sai normaalia sairaalaruokaa. Kuusi vuotta myöhemmin koehenkilöiden ruokavaliot vaihdettiin ja tutkimusta jatkettiin vielä kuusi vuotta.

Vähän tyydyttyneitä rasvoja sisältävä ruokavalio laski koehenkilöiden kolesterolia huomattavasti. Sepelvaltimotauti ja sepelvaltimotautikuolemat laskivat noin puoleen normaalia sairaalaruokaa syövään kontrolliryhmään nähden.

Johtopäätöksenä oli, että seerumin kolesterolia alentavan ruokavaliolla oli huomattava ehkäisevä vaikutus sepelvaltimotaudin esiintymiseen.

Suomalaisessa mielisairaalatkimuksessa maitorasvan vaihtaminen soijaöljyyn laski tyydyttyneen rasvan saantia 27 grammaan päivässä, jolloin veren kokonaiskolesteroli laski n. 13 % naisilla ja 16 % miehillä.

Sepelvaltimotautitapahtumat lähtökohtaisesti sydänterveillä vähenivät seuraavasti:

Miehillä 44 % (p=0,008)
Naisilla 37 % (p=0,04)

Lisäksi yhteisanalyysinä erikseen julkaistussa tutkimuksessa sydänperäinen kuolleisuus laski miehillä 53 % mutta naisilla ei.

Siri-Tarino 2010

Oletusarvoisesti ruokavalion tyydyttyneiden rasvojen vähentämisen uskotaan parantavan sydän- ja verisuoniterveyttä.

Siri-Tarinon meta-analyysin tavoitteena oli koota yhteenveto epidemiologisten tutkimusten näytöstä, jonka mukaan ruokavalion sisältämät tyydyttyneet rasvat lisäävät sepelvaltimotaudin (CHD), aivohalvauksien ja sydän- ja verisuonisairauksien riskiä. Analyysiin koottiin 24 tutkimusta MEDLINE- ja EMBASE-tietokannoista

5–23 vuoden aikana seurattiin 347 747 henkilöä, joista 11 006:lle kehittyi sepelvaltimotauti tai aivohalvaus.

Tyydyttyneen rasvan saanti ei liittynyt lisääntyneeseen sairastumisriskiin.

Prospektiivisten epidemiologisten tutkimusten meta-analyysin näyttö ei tue oletusta, jonka mukaan tyydyttyneet rasvat kasvattavat sydän- ja verisuonitautien riskiä

Mozaffarian 2010

Sydäntautien riskejä kartoittavien satunnaistetujen kontrolloitujen tutkimusten, suurten kohorttien taudin päätetapahtumien ja kontrolloitujen satunnaistettujen tutkimusten tulokset viittaavat siihen, että tyydyttyneiden rasvojen merkitys sydäntautien selittäjänä on puutteellinen.

Merkittävät todisteet osoittavat, että tyydyttyneiden rasvojen vähentämisen terveysvaikutukset vaihtelevat korvaavasta ravintoaineesta riippuen.

Ihmistutkimuksista saatujen parhaiden todisteiden perusteella tydyttyneiden rasvojen korvaaminen monityydyttämättömillä rasvahapoilla (esim. margariinit, kasviöljyt) vähentää sydän- ja verisuonitautien riskiä, kun taas tyydyttyneiden rasvojen korvaaminen hiilihydraateilla ei tuo minkäänlaisia terveysetuja.

Mozaffarianin meta-analyysin mukaan merkittävät todisteet osoittavat, että tyydyttyneiden rasvahappojen (SFA) vähentämisen terveysvaikutukset vaihtelevat korvaavien ravintoaineiden mukaan.

Seurantatutkimusten perusteella tyydyttyneiden rasvojen korvaaminen monityydyttämättömillä rasvahapoilla (PUFA) vähentää sydäntautien riskiä, mutta tyydyttyneiden rasvojen korvaaminen hiilihydraateilla (CHO) ei tuottanut mitään terveysvaikutuksia.

Tyydyttyneiden rasvojen korvaaminen kertatyydyttämättömillä rasvoilla antoi tutkimuksissa epävarmoja tuloksia.

Tyydyttyneiden rasvojen korvaaminen hiilihydraateilla, kuten tavallisesti tehdään, ei vaikuta sydäntautiriskiä alentavasti. Mozzaffarianin tutkimuksen mukaan ei ole perusteltua nostaa hiilihydraattien saantisuosituksia ja laskea tyydyttyneen rasvan saantisuosituksia.

Tyydyttyneiden rasvojen korvaaminen monityydyttämättömillä rasvoilla vaikuttaa Mozaffarianin tutkimusaineiston ja muuttujien huomioimisen jälkeen laskevan sydäntautien riskiä 10 %, kun tyydyttyneiden rasvojen saantia vähennetään 5 % päivittäisestä kokonaisenergiansaannista. Yhdysvalloissa kansanterveydellisen hyödyn toteutuminen edellyttäisi, että väestötasolla ltyydyttyneiden rasvojen saanti putoiaisi 11,5 %:sta 6,5 %:iin.

Suositukset tyydyttyneiden rasvojen korvaamisesta tyydyttämättömillä rasvoilla voi tuntua tarkoituksenmukaiselta, mutta sydäntautiriskin kannalta tyydyttyneiden rasvojen kulutusta merkittävämpiä tekijöitä ovat matalat omega3-tasot, hedelmien ja vihannesten vähäinen saanti, transrasvojen saanti, sokeri ja runsas suolan kulutus.

Lopuksi haluan todeta, että ravitsemussuositukset eivät ole aivan niin ristiriidattomia ja kiistattomia kuin monet haluavat uskoa.




Likaista biologiaa & muutama vesiperä

Biologia on likaista. Paperilla matematiikka on puhdasta ja kaunista, mutta jos ihmisen aineenvaihdunnan toiminta määritellään termodynamiikan ensimmäisellä pääsäännöllä muuttujista piittaamatta, johtopäätökset ovat väistämättä harhaanjohtavia. Likaista biologiaa & muutama vesiperä tutustuu painonhallintaan ja terveyteen vaikuttaviin tekijöihin hieman toisesta vinkkelistä.

Olen aiemmissa kirjoituksissani arvioinut, että LCHF-ruokavaliota noudattavia ja suosittelevia lääkäreitä on muutamista kymmenistä satoihin. Olin väärässä. Pelkästään Kanadassa on lähes 4000 naistentautien lääkäriä, jotka suosittelevat potilailleen LCHF-ruokavaliota osana hoitosuosituksia.

Gary Taubesin mukaan koko maailmassa voi olla jo yli 10 000 lääkäriä, jotka toimivat institutionalisoituja lääketieteen dogmeja vastaan suosittelemalla LCHF-ruokavaliota osana lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoitosuunnitelmaa.

Andreas Eenfeldtin Diet Doctor on maailman johtava lääketieteen ammattilaisten ylläpitämä ketogeeniseen ruokavalioon keskittynyt riippumaton verkkosivusto. Monet pidempään ketoilleet tunnistavat Diet Doctorin suunnannäyttäjien joukosta useita henkilöitä. Tämä henkilögalleria esimerkkinä siitä, että maailmalla yhä useammat lääketieteen ammattilaiset ja ravintoterapeutit luottavat tieteeseen ja tutkimukseen enemmän kuin pölyttyneisiin dogmeihin.

Diet Doctor Team

Tieteellinen tieto ei perustu muuttumattomiin dogmeihin

Koska tieteellinen metodologia on itseään korjaava järjestelmä, oletus on, että paremmin ilmiöitä kuvaava havaintojen ja evidenssin tukema malli korvaa huonommin ilmiöitä selittävän mallin. Perinteinen diet-heart hypoteesi on aikansa elänyt. Se on aika kuopata. Myös kaloriteoria kaipaa kipeästi päivittämistä.

Conclusions: Available evidence from randomized controlled trials shows that replacement of saturated fat in the diet with linoleic acid effectively lowers serum cholesterol but does not support the hypothesis that this translates to a lower risk of death from coronary heart disease or all causes. Findings from the Minnesota Coronary Experiment add to growing evidence that incomplete publication has contributed to overestimation of the benefits of replacing saturated fat with vegetable oils rich in linoleic acid.”

Uudet utkimukset eivät tue Ancel Keysin vuosikymmeniä vanhaa hypoteesiä, jonka mukaan tyydyttyneet rasvat ja kolesteroli aiheuttavat ateroskleroosia ja lisäävät kuolleisuutta.

On totta, että tyydyttyneet rasvat lisäävät ja monityydyttämättömät rasvat vähentävät lipoproteiinien määrää veressä. Tutkimusten mukaan kuolleisuus lisääntyy matalilla kolesterolitasoilla.

Robert Atkins

Palataan historiassa hieman taaksepäin. Robert Atkins ei ollut ensimmäinen ketoilija. Aihetta on käsitelty länsimaisessa lääketietellisessä kirjallisuudessa jo 1700-luvulta lähtien. Paaston ja hiilihydraattien rajoittamisen hyödyt on tunnettu Kiinassa pari vuosituhatta.

Robert Atkins (1930-2003) oli yhdysvaltalainen lääketieteen tohtori, fysiologi ja sydänlääkäri. Perinteisiä ruokavaliosuosituksia noudattanut Atkins kärsi ylipainosta ja masennuksesta. Hän aloitti 33-vuotiaana Alfred W. Penningtonin kehittämän ruokavalion noudattamisen rajoittamalla sokerin ja tärkkelyksen saantia. Vain kuudessa viikossa hänen painonsa putosi 12 kg.

Laihtumisen rohkaisemana hän ryhtyi hoitamaan ylipainoisia potilaitaan samanlaisella ruokavaliolla. Myös potilaiden paino laski ja terveys koheni. Vuonna 1972 Robert Atkins julkaisi maineikkaan laihdutusoppaan: Dr. Atkins’ Diet Revolution: The High Calorie Way to Stay Thin Forever. Vuonna 1992 hän julkaisi toisen kirjansa: Dr. Atkins’ New Diet Revolution, joka toimi lähtölaukauksena vuosituhannen vaihteen jälkeiselle vähähiilihydraattiselle buumille.

On selvää, etteivät terveysviranomaiset ja terveysjärjestöt katsoneet hyvällä Atkinsin oppeja. Hiilihydraattien rajoittamista vastustavat muistavat aina mainita, että Atkins kuoli 125 kiloisena läskinä sydänkohtaukseen, ja että hänellä oli pitkä historia sydänkohtauksia. Tällä urbaanilla legendalla halutaan alleviivata ketogeenisen Atkinsin ruokavalion oletettuja sydänriskejä. tarina on myytti.

Robert Atkins kaatui ja loukkasi päänsä. Sairaalassa hänet punnittiin. Robert Atkins painoi sairaalaan tullessaan 88,5 kiloa. Atkins vaipui sairaalassa koomaan ja sai nesteytystä yhdeksän päivää kestäneen kooman ajan. Sairaalassa Atkinsin paino nousi noin 28 kiloa. Hän siis painoi kuollessaan enemmän kuin sairaalaan saapuessaan. Robert Atkins sairasti kardiomyopatiaa (sydännlihaksen sairaus), jonka todennäköisin aiheuttaja oli infektio. Robert Atkins kuoli kaatumisen aiheuttamaan aivovammaan. Tämä on virallinen lääketieteellinen totuus.

Tutkimusten mukaan Atkinsin dieetti on turvallinen ja tehokas

Vuoden 2000 jälkeen tehdyt tutkimukset ovat osoittaneet, että Atkinsin dieetti on tehokas ruokavalio painonpudotuksessa ja hyödyllinen sydänterveyden riskitekijöiden kannalta. Tutkimukset eivät ole kuitenkaan vakuuttaneet läheskään kaikkia.

Kun sata lääkäriä julkaisi taannoin ketogeenisen ruokavalion terveyshyötyjä painottavan julkilausuman Huffington Postissa, vain muutama viikko myöhemmin ketogeeninen ruokavalio ja Atkinsin dieetti teilattiin mediassa täysin. Kamppailu on ankaraa. Paradigmat kaatuvat väistämättä, mutta väärien tietojen kumoaminen on hidasta.

Miksi ihminen lihoo?

Nykyihminen kehittyi noin 200 000 vuotta sitten. Ravitsemussuositukset otettiin käyttöön Yhdysvalloissa vuonna 1977. Ihmiskunta selvisi ja kehittyi 200 000 vuotta ilman virallisia ohjeita. Kuinka se on mahdollista? Miksi ihminen lihoo, vaikka meillä on vimpan päälle ohjeet oikein syömiseen?

Ihminen kehittyi sekasyöjäksi,koska se oli ainoa tapa selvitä. Ravinto kerättiin luonnosta silloin kun jotain ravintoa oli kerättävissä. Eläimiä saalistettiin ravinnoksi aina kuin se oli mahdollista tai tarpeen. Talvisin saaliseläimet olivat käytännössä varhaisten ihmisten ainoa ravinnonlähde. Tähän kehityshistoriaan nojaa paleodieetin perusta. Ruokaa syötiin silloin, kun sitä oli. Ylimääräisen energian elimistö varastoi rasvasoluihin.

Ihminen lihoo siksi, että evoluutio on mahdollistanut energian varastoimisen rasvasoluihin pahan päivän varalle. Ihminen selviää erinomaisesti ilman ravintoa pitkiäkin aikoja. Miten ihminen lihoo, on kokonaan toinen kysymys, joka liittyy energiansaannin ja kulutuksen tasapainoon sekä noin kymmeneen muuhun muuttujaan.

Luontokappaleet joko varastoivat energiaa tai vaihtolämpöisinä säästävät energian kulutuksessa. Varastoiminen tarkoittaa rasvan keräämistä, koska ravinnon saanti ei aina ollut itsestään selvää.

Lähes kaikki eläimet varastoivat energiaa rasvasoluihin. Lihominen on siis luonnollinen tapa varautua siihen, että ravintoa ei olekaan saatavilla. Rasvasoluihin varastoituu myös rasvaliukoisia vitamiineja.

Kun ihminen ei saa energiaa ravinnosta, elimistössä aktivoituu aineenvaihduntaprosessi, joka purkaa rasvasoluihin varastoituneita triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi verenkiertoon. Vapaiden rasvahappojen karboksyyliryhmät hapetetaan solujen beetaoksidaatiossa asetyylikoentsyymi-A:ksi, jota mitokondriot voivat sitruunahappokierrossa hapettaa energiaksi. Osa asetyylikoentsyymi-A:sta voidaan edelleen muuttaa solujen energiaksi kelpaaviksi ketoaineiksi. Maksa muuttaa ketogeneesissä vapaita rasvahappoja ketoaineiksi, kuten betahydroksibutyraatiksi.

Vapaita aminohappoja, sitruunahappokierron välituotteita, ketoaineita, vettä ja glyserolia voidaan muuttaa glukoosiksi glukoneogeneesissä. Veren punasolut tarvitsevat välttämättä glukoosia, jonka keho osaa itse valmistaa. Aiempien oletusten mukaan aivojen solut eivät ole riippuvaisia glukoosin saannista.

Evoluutio on varmistanut näin sen, että me emme kuole nälkään, jos emme saa heti ruokaa. Terve ihminen voi paastota pelkällä vedellä jopa 30 vuorokautta ja pysyä terveenä ja toimintakykyisenä.

Maailman pisimpään paastosi skotlantilainen Angus Barbieri, joka paastosi veden ja vitamiinipillereiden avulla kokonaista 382 vuorokautta. Paaston aikana hänen painonsa putosi 125 kiloa. Tapaus on hyvin dokumentoitu ja mainitaan mm. Guinnesin ennätysten kirjassa.

Angus Barbieri
Lähde: Wikipedia

Lämpöopin ensimmäinen pääsääntö

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Ongelma on se, että monimutkaiset asiat halutaan yksinkertaistaa. Lihomisen selittäminen energian säilymisellä tarkoittaa sitä, että viivat vedetään suoriksi ja kaikki häiritsevät taustavaikuttajat pyyhitään yhtälöstä.

Tutkiva journalismi on lähestulkoon haudattu. Uutiset julkaistaan sen tarkemmin asioihin paneutumaatta. Monet journalistit käytännössä vain kääntävät uutistoimistojen uutisia ymmärtämättä uutisen aiheesta juuri mitään. Se on valitettavaa, mutta totta.

Kalorioppi toimii periaatteessa hyvin paperilla. Ikävä tieteellinen fakta on, että rumat tosiasiat pilaavat kauniit teoriat. Biologia on likaista. En tarkoita saastaista, vaan tarkoitan, että kaikkien yhtälöön vaikuttavien tekijöiden laskeminen ja mallintaminen jokaiseen ihmiseen päteväksi universaaliksi lainalaisuudeksi on mahdotonta.

Biologia on likaista, koska aineenvaihdunnasta ei voi vetää universaaleja lakeja. Se sisältää liikaa rumia tosiasioita, jotka pilaavat kauniin teorian.

Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biokemiallinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan mekanismeja.

Kalorioppi

Kalori on vanha energian mittayksikkö. Se tarkoittaa lämpömäärää, joka kasvattaa yhden 14,5 asteisen vesigramman lämpötilaa assteella normaalipaineessa. Ravinnosta puhuttaessa pitäisi puhua kilokaloreista.

Tohtorit Newburg ja Johnston esittivät vuonna 1930 hypoteesin, jonka mukaan lihavuus johtuu kalorein mitattuna liian rusaasta ravinnosta, eikä aineenvaihdunnan häiriöstä. Tutkimusaineisto oli niukka, mutta kaloriteoria otettiin vastaan kumoamattomana tieteellisenä faktana.

Montignacin kritiikki kaloriteoriaa vastaan

Ranskalaisen Michel Montignacin periaate on seuraava: ”Lihominen ei johdu liiasta syömisestä vaan huonosta syömisestä.”

Montignacin mukaan kalorien vähentämiseen perustuva laihdutusteoria on 20. vuosisadan suurin ”tieteellinen ankka”. ”Se on ansa, huiputus, hölmö ja vaarallinen olettamus, jolla ei ole mitään tieteellistä perustaa. Ja kuitenkin se on ohjannut ravitsemuskäyttäymistämme yli puolen vuosisadan ajan.”

Montignac selvittää painon kertymisen logiikan seuraavasti: Olettakaamme, että yksilön päivittäinen tarve on 2500 kcal ja hänen saamansa kalorimäärä on pitkän ajan vastannut tätä tarvetta. Mikäli päivittäinen kaloriannos putoaa äkkiä 2000 kcal:iin, seurauksena on todellakin vastaavan vararasvamäärän käyttö ja toteamme painon pudonneen.

Jos päivittäinen kalorimäärä sen sijaan vakiintuu 2000:ksi aiemman 2500:n sijasta, elimistön eloonjäämisvaisto mukauttaa energiatarpeen nopeasti uudelle tasolle. Koska ihmiselle annetaan vain 2000 kcal, hän kuluttaa vain 2000 kcal. Painonmenetys keskeytyy nopeasti. Mutta elimistö ei jää tähän. Itsesäilytysvaisto houkuttelee sen entistä suurempaan varovaisuuteen. Ja tämä varovaisuus johtaa uusien varastojen muodostamiseen. Mikäpä siinä, jos sille annetaan vain 2000 kcal, se vähentää energiantarvettaan entisestään ja kuluttaa esimerkiksi vain 1700 kcal ja tallettaa ylimääräiset 300 kcal vararasvoiksi.

Montignacin mukaan vararasvojen muodostuminen tai muodostumatta jääminen on suoraan riippuvainen insuliinin erityksestä. Insuliinin eritys käynnistyy aina silloin kun veren sokeripitoisuus on nousemassa liian korkeaksi. Sen tehtävänä on auttaa veren glukoosin imeytymistä elimistön kudoksiin. Tarjolla oleva glukoosi käytetään joko tyydyttämään kehon välitöntä energiantarvetta tai, mikäli sitä esiintyy runsaasti, vararasvojen muodostamiseen. (1)
Ajatus, että jokaisen ihmisen biokemiallinen kone noudattaa täsmälleen samalla tavalla termodynamiikan ensimmäistä pääsääntöä, on yhtä hölmö, kuin väite, että kaikkien autojen bensiininkulutus on täsmälleen sama.

Termodynamiikan ensimmäinen pääsääntö:

  • Energiaa ei voida hävittää, se vain muuttaa muotoaan.
  • Termodynaamiseen systeemiin voidaan tuoda energiaa kahdessa eri muodossa työnä W ja lämpönä Q.
  • Tuotu energia muuttuu systeemin sisäenergiaksi U.
  • Sisäenergian muutos on siis systeemiin tuodun energian määrä:

ΔU=Q+W

  • Sisäenergian muutos ilmenee muutoksena systeemin lämpötilassa, paineessa, tilavuudessa tai olomuodossa.
  • Systeemistä voi myös lähteä energiaa. Tällöin systeemi, joko luovuttaa lämpömäärän -Q tai tekee ympäristölle työn -W. Huomaa miinus merkki energian lähtiessä systeemistä.

Syötyjen ja kulutettujen kaloreiden laskeminen on käytännössä mahdotonta. Erilaiset laskurit ja laskentakaavat helpottavat seurantaa, mutta nekin antavat epätäsmällisiä osatotuuksia.

Tietenkin ihminen laihtuu, jos syödyn energian määrä on vähäisempi kuin kulutetun energian määrä, mutta jos aineenvaihdunta toimii normaalisti, se purkaa energianpuutteessa mm. lihasten proteiineja polttoaineeksi. Äärimmäisellä rasvoja rajoittavalla ruokavaliolla ihminen voi ”syödä” omat lihaksensa. (1)

Kaikki laihduttajat tietävät, että laihduttaminen on vaikeampaa kuin lihominen. Meidät on ehdollistettu syömään 4-6 kertaa päivässä (mukaanlukien välipalat), että verensokerimme pysyy tasaisena.

Koska ravintomme koostuu pääasiassa sokereista, verensokerin ja insuliinipitoisuuden vaihtelut aiheuttavat energiapiikkejä ja energiatason nopeita laskuja. Tämä pitää meidät nälkäisinä ympäri vuorokauden. Jatkuvaa nälkää kompensoidaan välipalapatukoilla, pullakahveilla, välipaloilla, snackseillä, virvoitusjuomilla jne.

Tämä aiheuttaa toisaalta kokonaisenergian huomaamattoman kasvun, mutta tärkeämpää on se, kuinka ruoka vaikuttaa verensokeriin ja insuliiniin.

Miksi insuliini on tärkeää?

Kuvaparissa tyypin 1 diabetesta sairastava potilas ennen ja jälkeen insuliinihoidon. Kun haima lopettaa insuliinintuotannon, aineenvaihdunta ei voi käyttää syötyä ravintoa polttoaineena, joten se turvaa välttämättömien elintoimintojen jatkuvuuden purkamalla lihaksiin, maksaan ja rasvakudokseen varastoitua energiaa solujen polttoaineeksi.

Ennen insuliinilääkitystä tyypin 1 diabeetikot nääntyivät nälkään riippumatta siitä, kuinka paljon he söivät.

Haiman beetasolut erittävät vereen insuliinia kahdella mekanismilla.

  1. Ensinnäkin syöminen signaloi aivoille, että elimistö saa ravintoa. Tällöin hypotalamus signaloi haimalle, että ruokaa olisi pian tulossa, joten eritäpä sitä insuliinia vereen.Syöminen vaikuttaa insuliinin eritykseen makuaisti-hypotalamas-haima reitillä. Hypotalamuksen säätelemään insuliinin eritykseen vaikuttaa ainakin makuaisti. (1, 2).
  2. Veren glukoosipitoisuuden kasvu vaikuttaa haiman insuliinin eritykseen suoraan. Haiman Langerhansin saarekkeiden beetasolut aistivat verensokerin muutoksia ja pystyvät autonomisesti säätelemään verensokeria.Verensokerin noustessa haiman beetasolut erittävät vereen insuliinia, joka siivoaa glukoosin (ja muut ravinteet) verestä soluihin. Verensokerin laskiessa haiman alfasolut erittävät vereen glukagonia, joka aktivoi lihaksiin ja maksaan varastoitujen glykogeenien purkamisen glukoosimolekyyleiksi.

Insuliinin merkitystä painonhallinnalle ja terveydelle ei voi vähätellä.

  1. Insuliini on elintärkeä hormoni, jota ilman me kuolisimme.
  2. Insuliini vaikuttaa glukoosin ja muiden ravintoaineiden soluunottoon, glykolyysiin, glykogeenien synteesiin, proteiinien synteesiin sekä elektroninsiirtoketjun toimintaan.
  3. Insuliini estää glukoosia tuottavan glukoneogeneesin käynnistymisen, maksan ja lihasten sokerivarastoja purkavan glykogenolyysin, rasvahappoja purkavan lipolyysin, proteolyysin ja ketogeneesin.

Insuliinin toiminta

Insuliini on energia-aineenvaihdunnan tarvitsema elintärkeä hormoni. Se toimii kuin liikennevalvoja, joka ohjaa solujen energia-aineenvaihduntaa ja energian varastointia.

Solujen energiakylläisyyden perusteella solujen insuliinireseptoreihin kiinnittyneet insuliinimolekyylit päästävät ravintoaineita soluihin, jotka tarvitsevat energiaa ja/tai soluihin, joissa on tilaa varastoida energiaa.

Soluun kiinnittynyt insuliinimolekyyli näyttää glukoosi- ja rasvamolekyyleille vihreää valoa; tänne mahtuu.

Insuliini on porttivahti, joka avaa solut vain yhteen suuntaan: sisälle. Glukagoni insuliinin vastavaikuttajana puolestaan toimii solusta ulos periaatteella ja purkaa mm. glykogeeneihin varastoituneita sokereita verenkiertoon.

Veressä on aina insuliinia, mutta, kun insuliinipitoisuus laskee riittävästi, haima erittää glukagonia,joka purkaa energiavarastoja. Kun maksan ja lihasten sokerivarastot on kulutettu, verenkiertoon erittyy lipolyyttisiä hormoneja (adrenaliini, noradrenaliini, kortikotropiini ja glukagoni), jotka käynnistävät rasvasolujen purkamisen. Insuliini estää rasvasolujen purkamista, eli lipolyysiä. Jos verensokeri on jatkuvasti korkea ja veressä on paljon insuliinia, rasvasolujen purkaminen energiakäyttöön estyy.

Insuliiniresistenssi ja hyperinsulinemia

Jos haiman kyky tuottaa insuliinia loppuu, kuten tyypin 1 diabeteksessa tapahtuu, ravintoaineet eivät pääse verestä soluihin. Insuliinin puutteessa energian tuotanto loppuu ja ihminen nääntyy nälkään, vaikka söisi koko ajan. Tyypin 2 diabeteksessa haima tuottaa alkuun jopa normaalia enemmän insuliinia, mutta solujen insuliiniherkkyyden heikentyminen johtaa siihen, että veressä on liikaa insuliinia (hyperinsulinemia).

Insuliiniresistenssi ja hyperinsulinemia assosioituvat kaikkiin yleisimpiin kroonisiin sairauksiin. Tätä ei vielä tiedetty viime vuosisadan puolivälissä, mutta tieto lisääntyy ja se korjaa vanhoja käsityksiä.

Useimpien sairauksien taustalla on aineenvaihdunnan toimintahäiriö ja tämän aiheuttamat komplikaatiot. Lihavuus on lähes aina oire siitä, että aineenvaihdunnan toiminta on häiriintynyt. Nykyisin on tapana syyllistää ja leimata lihavia, mutta se on väärin. Lihavuus on oire, ei syy.

Hyperinsulinemiaan assosioituvat mm. Alzheimerin ja Parkinsonin taudit, tyypin 2 diabetes, alkoholista riippumaton rasvamaksa, haavainen paksusuolentulehdus, krooninen inflammaatio, lihavuus, ateroskleroosi, kardiomyopatia, sydänhalvaukset ja verenpaine. Edelliset kuvankaappaukset Catherine Kroftsin videolta.

Insuliini rakentaa lihas- ja rasvakudosta

Insuliini vaikuttaa myös anabolisiin aineenvaihduntatapahtumiin, kuten energian varastoimiseen lihasten ja maksan glykogeeneihin ja rasvasoluihin sekä esimerkiksi lihaskudosta rakentavaan proteiinisynteesiin. Tämä on äärimmäisen tärkeää.

Kun verenkierrossa on liikaa energiaravinteita (glukoosia ja rasvaa), ravintoaineet ohjataan ensin soluihin, jotka tarvitsevat energiaa. Ylimääräinen glukoosi varastoidaan ensimmäiseksi maksan ja lihasten sokerivarastoihin (glykogeenit), johon mahtuu keskimäärin 250-500 grammaa sokeria ihmisen lihaskunnosta riippuen.

Glukoosi, joka ei mahdu glykogeeneihin, varastoidaan rasvasoluihin. Myös ylimääräinen rasva ohjataan rasvasoluihin. Insuliinilla on keskeinen rooli energiaravinteiden ohjaamisessa soluihin. Solut käyttävät energian lähteenä joko rasvaa tai glukoosia. Solu ei voi samanaikaisesti sekä polttaa, että varastoida energiaa. Niin ei vain tapahdu. Tämä on periaatteessa perinteisen kaloriopin mukainen mekanismi.

Kiinnostavaksi tilanne muuttuu, kun likainen biologia kumoaa perinteisen mallin. Jos ja kun veressä on liikaa sokeria (hyperglykemia) ja insuliinia (hyperinsulinemia), sokeri voidaan varastoida vain rasvasoluihin, jossa glukoosi muutetaan lipogeneesissä triglyserideiksi. Jatkuvasti koholla oleva insuliini johtaa solujen insuliiniresistenssiin, minkä seurauksena insuliinin kyky siivota verestä ravintoaineet soluihin heikkenee. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, joten insuliini ohjaa yhä enemmän ravintoa verenkierrosta rasvasoluihin samalla, kun insuliiniresistenttien lihassolujen energiansaanti vähenee. Tämän seurauksena ihminen alkaa lihoa.

Insuliiniresistentti varastoi enemmän energiaa rasvasoluihn

Mitä tämä käytännössä tarkoittaa? Se tarkoittaa sitä, että samasta syödystä energiamäärästä insuliini varastoi suhteessa suuremman osan rasvakudokseen, koska ravintoa energiaksi polttavien lihassolujen kyky vastaanottaa energiaa on heikentynyt. Insuliiniresistentin ihmisen lihominen voi alkaa, vaikka kilokalorimääräisesti energiansaanti pysyisi aiemmalla tasolla. Insuliiniresistenssi vaikuttaa lihomiseen satunnaista ylensyöntiä enemmän.

Veressä on aina hieman insuliinia. Proteiinit ja rasvat lisäävät insuliinin eritystä, koska energia-aineenvaihdunta loppuu ja ihminen nääntyy nälkään, jos insuliinia ei ole saatavilla. Glukoosi kohottaa insuliinitasoja tuplasti enemmän kuin proteiini ja moninkertaisesti enemmän kuin rasva. Liikaa hiilihydraatteja sisältävä ravinto pitää verensokerin liian korkealla, jolloin insuliinin eritys lisääntyy ja vähitellen jatkuvasti koholla olevat verensokeri ja insuliini alkavat vaikuttaa negatiivisesti aineenvaihdunnan toimintaan. Tämä ennakoi insuliiniresistenssia, joka on useimpien kardiometabolisten sairauksien tärkein aiheuttaja.

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biologinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan jänniä mekanismeja.

Se, että eräät konservatiiviset ja institutionalisoituneet tieteestä piittaamattomat ravitsemusneuvojat väittävät, ettei hormoneilla, kuten insuliinilla ole suurtakaan merkitystä painon kannalta, on raivostuttavaa paskapuhetta.

Yksinkertaisesti: keho ei voi varastoida sokereita tai läskiä ilman insuliinin välittävää vaikutusta.

Etanolin aineenvaihdunta

Entä, jos laitamme energian tilalle alkoholin? Termodynamiikan ensimmäisen pääsäännön mukaan juodun alkoholin pitäisi poistua kehosta, koska muuten ylimääräinen alkohli varastoituisi elimistöön alkoholina tai läskinä.

Aineenvaihdunta polttaa juotua alkoholia muiksi aineiksi. Myös ravinnon sisältämä energia muuttuu aineenvaihdunnassa. Ravinto ei ole pelkkää energiaa.

Lämpöoppi toimii, mutta siinä on huomioitava myös yhtälöön vaikuttavat lukemattomat muuttujat, koska muuten siihen ei voi luottaa.
Etanoli on luonnosta ja alkoholijuomista löytyvä alkoholi, joka metaboloituu monimutkaisella katabolisella aineenvaihduntareitillä. Useat entsyymit osallistuvat etanolin prosessointiin ensin asetaldehydiksi ja edelleen etikkahapoksi ja asetyylikoentsyymi-A:ksi.

Kun asetyylikoentsyymi-A on muodostunut, siitä tulee sitruunahappokierron substraatti, joka hapetetaan solujen mitokondrioissa energiaksi. Sitruunahappokierron jäännöstuotteina on vettä ja hiilidioksidia.

Entsyymien esiintymisessä ja saatavuudessa olevien erojen vuoksi eri ikäiset ihmiset käsittelevät etanolia eri aineenvaihduntareiteillä. Maksa on tärkein etanolin aineenvaihduntaan osallistuva elin, koska maksassa esiintyy korkeina pitoisuuksina etanolin aineenvaihdunnan tarvitsemia entsyymeitä.

Ruoansulatusjärjestelmä tuottaa noin 3 g etanolia päivässä fermentoimalla ravintoa. Etanolin katabolinen hajoaminen on välttämätöntä paitsi ihmisten, myös kaikkien tunnettujen organismien, elämälle.

Eräät etanolin aineenvaihduntaan liittyvien entsyymien aminohapposekvenssit eivät ole muuttuneet 3,5 miljardiin vuoteen. Kaikki organismit tuottavat alkoholia pieninä määrinä useilla aineenvaihduntareiteillä.

Etanolia syntyy pääasiassa rasvahappojen synteesin, glyserolipidimetabolian, ja sappihapon biosynteesireittien kautta. Jos keholla ei olisi mekanismia alkoholien katabolisoimiseksi, alkoholit kumuloituisivat elimistöön ja muuttuisivat myrkyllisiksi.

Ehkä tämän vuoksi evoluutio on kehittänyt keinon katabolisoida etanolia myös sulfotransferaasin avulla. Sulfotransferaasit sulfonoivat serebrosideja sulfatideiksi. Serebrosidit ovat sfingolipideihin kuuluvia glykolipidejä, jotka vaikuttavat mm. hermokudoksessa.

Serebrosidien rakenne koostuu sfingosiinistä, rasvahappo-osasta ja glukoosista tai galaktoosista. Galaktooseja sisältäviä serebrosideja esiintyy erityisesti myeliinistä. No niin. Pitikö se viina vetää tähänkin juttuun? Ohessa etanolin aineenvaihduntareitti

Kuvankaappaus: Wikipedia

Kuinka etanolin aineenvaihdunta liittyy termodynamiikan ensimmäiseen pääsääntöön?Aineenvaihdunta muuttaa etanolin energiaksi, mutta ei varastoi etanolia soluihin alkoholina. Itse asiassa aineenvaihdunta ei edes osaa muuttaa etanolia läskiksi.

Lihottaako alkoholi ja miten se lihottaa?

Alkoholi sisältää noin 7 kcal/g energiaa. Puhtaassa etanolissa on enemmän energiaa kuin sokerissa ja melkein saman verran kuin rasvassa.

Alkoholi voi vaikuttaa lihomiseen ja rasvoittaa maksaa, mutta ei sen vuoksi, että laskennallisesti etanolissa on paljon energiaa. Lihomiseen ja maksan rasvoittumiseen vaikuttavat ne muuttujat, jotka sotkevat puhtaan termodynamiikan ensimmäisen pääsäännön kauniin yhtälön likaisella biologialla.

Mitä alkoholille tapahtuu? Kun ihminen juo alkoholia, maksa paiskii ylitöitä. Entsyymi nimeltä Alkoholidehydrogenaasi (ADH) hapettaa alkoholin asetaldehydiksi. Alkoholia palaa noin 0,1 g/painokilo/h, eli 70-kiloinen henkilö polttaa 7 grammaa alkoholia tunnissa.

Aldehydidehydrogenaasi metaboloi asetaldehydistä edelleen asetaattia. Asyyli-CoA syntaasi (ACSS2) ja asetyyli-CoA syntaasi (ACSS1) syntetisoivat asetaatista asetyylikoentsyymi-A:ta. Kun asetyylikoentsyymi-A on muodostunut, se siirtyy mitokondrioiden sitruunahappokiertoon, jossa siitä hapetetaan energiaa ja jäännöstuotteena on vettä ja hiilidioksidia. Kaikki energiaa tuottavat ravinteet muuttuvat aineenvaihdunnassa asetyylikoentsyymi-A:ksi, joka poltetaan vedeksi ja hiilidioksidiksi.

Alkoholin sisältämät sokerit lihottavat, alkoholi hidastaa rasvan palamista ja kasvattaa ruokahalua. Jos alkoholin yhteydessä syö energiatiheää ruokaa, alkoholi lisää ravinnon sisältämän rasvan ja hiilihydraattien varastoimista mm. maksaan. Puhdas alkoholi ei muutu elimistössä läskiksi. Se on sitä likaista biologiaa, joka ei sovi yhteen termodynamiikan ensimmäisen pääsäännön kanssa. Eräs alkoliin liittyvä kiinnostava huomio on se, että alkoholi itse asiassa parantaa solujen insuliinisensitiivisyyttä.

Runsaan alkoholin nauttimisen seurauksena veren alkoholipitoisuus pysyy korkeana kunnes maksa on prosessoinut kaiken alkoholin asetaldehydiksi, astetaatiksi ja asetyylikoentsyymi-A:ksi, joka hapetetaan sitruunahappokierrossa energiaksi. Jo tämä itsessään todistaa, että keho ei osaa muuttaa alkoholia läskiksi. Elimistö metabolisoi alkoholin ennen muita ravinteita. Jos ihminen syö, kun veressä on alkoholia, syöty ravinto muutetaan energiaksi tai varastoidaan vasta alkoholin palamisen jälkeen. Tämä voi lihottaa.

Aineenvaihdunta on siitä merkillinen biokemiallinen järjestelmä, että rasvat eivät aina varastoidu läskinä, mutta hiilihydraatit joudutaan joskus muuttamaan läskiksi.

Energiaravinteet: rasvat, hiilihydraatit ja proteiinit seuraavat kukin omia kemiallisia aineenvaihduntareittejään. Niillä on elimistössä muitakin tehtäviä kuin energian tuottaminen.

Alkoholiesimerkin takoituksena oli havainnollistaa, että aineenvaihdunnan kannalta tapahtumat eivät ole yksinkertaisesti sisään-ulos-tapahtumia, vaan paljon paljon monimutkaisempia reaktioketjuja, joihin vaikuttavat mm. geenit, sukupuoli, ikä ja hormonit.

Me tiesimme tämän aina, mutta emme ymmärtäneet. Alkoholin aiheuttama humalatila jatkuu, kunnes maksa on polttanut kaiken alkoholin verestä. Alkoholin sisältämä energia (kalorit) palaa, mutta ei varastoidu.

Lihava ihminen – Homo Corpulentus

Lihomiseen vaikuttaa ravinnon sisältämän energian lisäksi mm. ympäristö, geenit, hormonit, sukupuoli,ikä, suolistoflooran koostumus, stressi, unen määrä ja laatu, sekä ruumiinrakenne, eli kehon rasva- ja lihaskudoksen suhde. Näillä kaikilla on huomattava merkitys siihen, kuinka elimistö käyttää ravinnosta saatuja kaloreita, ja kuinka ihminen lihoo. Lihomiseen vaikuttavia tekijöitä kutsutaan obesogeneettiseksi potentiaaliksi.

Yleisesti ottaen aineenvaihdunta varastoi energiaa silloin kun energiansaanti ylittää kulutuksen. Tämä on selvää, mutta tutkimuksista tiedetään, että samaa ruokaa saman verran syövien ihmisten aineenvaihdunnan tapa käsitellä ravinnosta saatua energiaa poikkeaa toisistaan.

Tämä on osoitettu mm. identtisillä kaksosilla, jotka ovat syöneet laskennallisesti saman verran energiaa, mutta toinen on pysynyt hoikkana ja toinen lihonut. Kuinka se on mahdollista? Identtisillä kaksosilla on havaittu suoliston mikrobiomin vaikutus energia-aineenvaihduntaan. Lajistoltaan runsaampi mikrobiomi on yhteydessä tehokkaamaan aineenvaihduntaan ja energian kulutukseen, kun lajistoltaan köyhempi mikrobiomi assosioituu lihomiseen.

Ravinnolla on lihomisen kannalta merkittävä rooli, mutta jopa 70 % kehonpainoon vaikuttavista muuttujista johtuu geneettisistä tekijöistä, kertoi Professori Alfredo Martinez (Center of Nutrition Research at the University of Navarra, Pamplona, Espanja) Nature Reviews Disease Primers-lehdelle.

Melanokortiini 4 reseptori -geenimuutos näyttää liittyvän lihavilla ihmisillä selvästi ahmimishäiriöön. Sveitsiläistutkijat totesivat, että kaikki tätä geenimuutosta kantavat erittäin lihavat potilaat kärsivät ahmimishäiriöstä. Melanokortiini 4 reseptorin geenimuutosta on kahden tuoreen tutkimuksen mukaan runsaalla viidellä prosentilla lihavista ihmisistä. Geenimuunnos vaikuttaa ruokahalun sääntelyyn aivojen hypotalamuksessa.”Duodecim

Lihomisalttiuteen vaikuttavia geenimuutoksia on löydetty 118. Yksittäinen muutos ei kasvata lihomisen riskiä merkittävästi, mutta ihmisillä, joilla on useita lihomisalttiuteen vaikuttavia geenimuutoksia, on vahva taipumus lihomiseen kaloreista ja liikunnan määrästä riippumatta. Esimerkiksi ankyrin-B geenin muutokset lisäävät glukoosin kulkua rasvasoluihin.

Myös äidin paino vaikuttaa raskauden ja imetyksen aikana lapsen kehitykseen. Professori Martinezin mukaan raskaudenaikainen lihominen ensimmäisten 20 raskausviikon aikana lisää syntyvän lapsen ylipainoisuuden riskiä. Ilmiö palautuu sikiöaikaiseen aineenvaihduntaan, joka vaikuttaa pysyvästi lapsen geeneihin.

Toisaalta äidin imetyksen aikainen ravinto voi aiheuttaa vastaavanlaisia epigeneettisiä muutoksia lapsen insuliininsäätelyä ohjaavissa geeneissä ja altistaa lapsen myöhemmin elämässä insuliiniherkkyyden alenemiselle ja insuliiniresistenssille, kertoo professori Mark H. Vickers (Liggins Institute at the University of Auckland, New Zealand) Frontiers in Endocinology-lehdessä.

Kolesteroli

Yritän kirjoittaa kolesterolista oman tutkielman, koska aihe on äärimmäisen laaja ja monimutkainen.

Ei ole olemassa hyvää tai pahaa kolesterolia. On vain kolesterolia. Jos kolesterolimolekyyliä muutetaan yhdelläkin atomilla puoleen tai toiseen, se ei enää ole kolesterolia.

LDL, HDL ja kylomikronit (yms.) ovat rasvaa, kolesterolia ja vitamiineja kuljettavia lipoproteiineja. Sellaisina ne ovat aivan välttämättömiä rasva-aineenvaihdunnan normaalille toiminnalle. Se, että lipoproteiineja kutsutaan kolesteroliksi on hyvin harhaanjohtavaa.

Kolesterolisynteesi tuottaa kolesterolia, joka on mm. steroidihormonien, kuten estrogeenin, testosteronin ja D-vitamiinin synteesin välttämätön lähtöaine. Ruoansulatusnesteet tarvitsevat kolesterolia, aivot tarvitsevat kolesterolia, hermoratoja suojaavissa myeliinikalvoissa on kolesterolia ja solut tarvitsevat kolesterolia solukalvoihin. Joka päivä uusiutuu noin 200 grammaa soluja, joiden solukalvojen yksi rakennusaine on kolesteroli. Ihmisen kolesterolista 25 % on aivoissa, ja ravinto ei lisää kokonaiskolesterolia juuri lainkaan. Elimistö tuottaa sen verran kolesterolia kuin se tarvitsee.

Esimerkiksi suomalaisen väitöstutkimuksen mukaan naisten kuolleisuus lähtee kasvuun, jos kokonaiskolesteroli laskee neljään tai sen alle. Mutta tutustutaan kolesteroliin toisessa artikkelissa.

Inspiraation ja tiedon lähteitä

Gary Taubes

Robert Lustig

Paul Mason

Catherine Crofts

Nina Teicholz

Andreas Eenfeldt

Jason Fung

Georgia Erde

Benjamin Bikaman

Stephen Phinney

Darius Mozaffarian
Tim Noakes

David Unwin

Jeffry Gerber

Ted Naiman

Ivor Cummins

Dave Feldman




Makeuttajat: sukraloosi ja aspartaami

Sukraloosin ja hiilihydraattien yhdistäminen voi heikentää insuliiniherkkyyttä ja altistaa aineenvaihdunnan häiriöille, kuten lihomiselle ja insuliiniresistenssille.

Ei ole helppoa, jos makeanhimo yllättää. Lisätyn sokerin riskit tunnetaan vanhastaan hyvin. Medical News Today uutisoi Yalen yliopiston tutkimuksesta, jonka mukaan sukraloosin (keinotekoinen makeutusaine) syöminen yhdessä hiilihydraattien kanssa muuttaa ihmisen makean aistimusta ja heikentää solujen insuliiniherkkyyttä. Tämä voi kasvattaa insuliiniresistenssin ja siihen assosioituvien sairauksien riskiä.

Onko sukraloosilla tai aspartaamilla makeutettu Cokis, burgeri ja ranskalaiset pikatie diabetekseen?

Makuaisti ja makean maistaminen kiihdyttävät insuliinin eritystä. Insuliini ohjaa energia-aineenvaihduntaa. Solujen insuliiniherkkyyden häiriöt voivat aiheuttaa insuliiniresistenssia.

Yalen yliopiston tutkijat tekivät yllättävän havainnon

Cell Metabolism julkaisi Yalen yliopiston tutkijoiden tutkimuspaperin, jonka tulokset viittaavat siihen, että keinotekoisten makeutusaineiden syöminen samaan aikaan hiilihydraattien kanssa heikentää terveiden aikuisten insuliiniherkkyyttä.



Sukraloosi ja hiilihydraatit: huono yhdistelmä?

Pienimuotoiseen tutkimukseen rekrytoitiin 45 tervettä 20-45 vuotiasta aikuista, jotka eivät normaalisti käyttäneet keinotekoisia makeutusaineita.

Tutkimukseen osallistuneilta ei edellytetty erityisiä ruokavalion muutoksia. Heille tarjottiin tutkimuksen yhteydessä seitsemän hedelmänmakuista virvoitusjuomaa. Osa juomista oli makeutettu sokerilla ja osa sukraloosilla, eli keinotekoisella makeutusaineella.

Sukraloosi

Sukraloosi on 600-650 kertaa tavallista sokeria makeampi keinotekoinen makeutusaine. Sukraloosia käytetään runsaasti elintarvikkeissa, kuten juomissa ja leivonnaisissa, sillä sen maku muistuttaa tavallista sokeria.

Sukraloosin etuna aspartaamiin verrattuna on hyvä lämpökestävyys ja säilyvyys. Sukraloosi valmistetaan sakkaroosia klooraamalla, jolloin sakkaroosin kolme hydroksyyliryhmää korvataan klooriatomeilla.

Sukraloosi keksittiin vuonna 1976 uuden hyönteismyrkyn kehittämisen yhteydessä Tate & Lyle Corporationin ja Queen Elizabeth College University of Londonin yhteistyönä. Tämä tapahtui sattumalta, kun kiinalainen opiskelija ymmärsi ohjeet väärin ja testaamisen (test) sijaan maistoi kemikaalia (taste).

Sukraloosia on tutkittu useilla eläin- ja ihmiskokeilla. Ihmiskokeissa havaittiin, että 11–27 % sukraloosista imeytyy, mutta 70–80 % poistuu kuitenkin muuttumattomana virtsaan. Noin 5 % sukraloosista hajoaa elimistössä kahdeksi monosakkaridiksi.

Ihmiskokeissa sukraloosilla ei havaittu kielteisiä terveysvaikutuksia, ja muun muassa Euroopan komission tieteellinen komitea on katsonut aineen turvalliseksi. Eräissä eläinkokeissa erittäin suurten annosten (2000 mg/kg) havaittiin aiheuttavan DNA-vaurioita hiirissä. Vielä suurempien annosten (3000 mg/kg) on havaittu kutistavan rottien kateenkorvaa. Sukraloosin on myös havaittu joissakin tapauksissa laukaisevan migreeniä.

Tutkimus

Osa koehenkilöistä sai sukraloosilla makeutettua juomaa, johon oli lisätty maltodekstriiniä (hiilihydraatti). Tähän turvauduttiin, koska näin oli helppo säädellä juoman kaloripitoisuutta tekemättä juomasta yhtään makeampaa. Koe kesti kaksi viikkoa.

Tutkittaville tehtiin erilaisia mittauksia, kuten MRI (aivojen magneettikuvaus) ennen koetta, kokeen aikana ja kokeen jälkeen.

Mittausten avulla tutkijat pystyivät arvioimaan erilaisten makuärsykkeiden aiheuttamat muutokset aivojen toiminnassa. Tutkittavien aivojen vastetta makeaan, happamaan ja suolaiseen, ja makuaistin sekä insuliiniherkkyyden tapahtumia seurattiin.

Analysoidessaan tutkimuksessa koottua aineistoa tutkijat löysivät kerätystä datasta yllättäviä poikkeamia. Havainnot koskivat sukraloosia ja maltodekstriiniä saanutta kontrolliryhmää. Tässä ryhmässä havaittiin aivojen muuttuneita vasteita makeaan, insuliiniherkkyyden heikentymistä ja muutoksia glukoosin metaboliassa.

Havaintojen paikkansapitävyyden varmistamiseksi tutkijat jatkoivat koetta siten, että uudelle ryhmälle annettiin joko sukraloosilla tai maltodekstriinillä makeutettuja juomia seitsemän päivän ajan. Näin varmistettiin, että sukraloosi tai maltodekstriini ei yksin selittänyt kokeessa havaittuja muutoksia.

Mitä tapahtui?

Miksi sukraloosi-hiilihydraatti-yhdistelmä muutti kokeeseen osallistuneiden makeuden aistimista ja insuliiniherkkyyttä? Tähän ei osata varmasti vielä vastata, mutta tutkijoilla on joitain ideoita syystä.

Vaikutus johtui mahdollisesti siitä, että ravinnon sisältämä energia tulkittiin väärin, jolloin aivojen saama kemiallinen viesti saadun energian määrästä oli virheellinen. Solut ovat herkkiä sukraloosille ja maltodekstriinille. Makuaisti tulkitsee makean ravinnoksi, joka sisältää energiaa. Aivoille välittyy sukraloosin ja maltodekstriinin yhteisvaikutuksesta kemiallinen signaali, että elimistö on saanut energiaa.

Maltodekstriini sisältää energiaa, mutta sukraloosi ei. Näiden yhteisvaikutuksen elimistö tulkitsee siten, että käytettävissä olisi todelliseen energianmäärään nähden kaksinkertainen määrä energiaa. Ajan mittaan keho oppii, että näin ei ole, ja metabolinen vaste makeaan muuttuu.

Aiemmat havainnot

Tutkimuksessa viitataan myös aikaisemmin jyrsijöillä tehtyihin tutkimuksiin, jotka antoivat samankaltaisia tuloksia. Näissä kokeissa rotille syötettiin makeuttamatonta jogurttia tai keinotekoisilla makeutusaineilla makeutettua jogurttia. Tulokset olivat verrannollisia Yalen yliopiston tutkimuksen tulosten kanssa.

Aikaisemmat tutkimukset rotilla osoittivat, että muutokset makean aistimisessa ohjaavat aineenvaihduntaa virheelliseen suuntaan, mikä voi altistaa aineenvaihduntahäiriöille ja lihomiselle.

Keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmä tulkitaan elimistössä virheellisesti suuremmaksi energiakuormaksi kuin se on.

Tutkimuksen tulosten perusteella dieetti-Colan juominen satunnaisesti on ihan okei, mutta runsaasti hiilihydraatteja sisältävän ruoan, kuten ranskalaisten perunoiden kanssa on parempi valita normaali Cola tai jokin muu juoma, kuten vesi.

Makeutusaineilla makeutetut virvokkeet ja runsashiilihydraattiset ruoat eivät tutkimusten perusteella sovi yhteen. Tutkijat suunnittelevat tutkimukselle jatkoa, jossa selvitetään, onko muiden keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmillä vastaavia insuliinisensitiivisyyttä heikentäviä vaikutuksia. Tarkoituksena on lisäksi tehdä vertaileva tutkimus stevian ja hiilihydraattien yhteisvaikutuksesta.


Onko aspartaamilla sivuvaikutuksia?

Aspartaami on sukraloosin ohella tunnetuin keinotekoinen ja vähäkalorinen makeutusaine. Aspartaami on eräs suosituimmista sokerin korvikkeista vähäkalorisissa ruoissa ja juomissa, sekä monissa lääkkeissä.

Yhdysvalloissa aspartaamia myydään tuotenimillä Nutrasweet ja Equal. Laajasta käytöstä ja suosiosta huolimatta aspartaami herättää yhä ristiriitoja ja kiistoja mm. terveysvaikutuksista. Useissa tutkimuksissa väitetään, että makeutusaineella on haitallisia sivuvaikutuksia.

Onko aspartaami turvallista?

Yhdysvalloissa FDA (Food and Drug Administration) hyväksyi aspartaamin elintarvikekäyttöön vuonna 1981. Aspartaamin käyttö elintarvikkeissa on hyväksytty EU:ssa, Kanadassa ja monissa muissa valtioissa. Seuraavat kansainväliset järjestöt hyväksyvät aspartaamin elintarvikekäytön:

  • World Health Organization
  • United Nations Food and Agriculture Organization
  • American Heart Association
  • American Dietetic Association

Vuonna 2013 Euroopan ruokaturvallisuudesta vastaava virasto (EFSA) analysoi satoja aspartaamia käsitteleviä tutkimuksia.

Analyysin perusteella EFSA arvioi, että aspartaamin käyttö ravinnossa on turvallista. EFSA asetti päivittäisen saannin ylärajaksi suosituksen 40 milligrammaa / painokilo.

EFSAn turvallisena saantina pidetty määrä on 10 mg vähemmän kuin FDA:n turvallisena pitämä määrä. Tällä ei sinänsä ole merkitystä, koska ylärajat ovat molemmissa tapauksissa normaalin käytön kannalta hyvin korkealla. Esimerkiksi normaali virvoitusjuoma sisältää noin 190 mg aspartaamia. Päivittäisen ylärajan saavuttamiseksi pitäisi juoda 19-20 aspartaamilla makeutettua virvoitusjuomaa.

Aspartaamin vaikutus painoon

Aspartaamissa on energiaa 4 kcal grammassa samoin kuin sokerissa, mutta aspartaami on 200 kertaa makeampaa kuin sokeri. 1:200 osa aspartaamia ajaa saman asian kuin gramma sokeria. Vähäkalorisilla makeutusaineilla makeutettuja elintarvikkeita suositaan lähinnä painonhallinnan vuoksi.

Tutkimuskatsaus viimeisimmistä tutkimuksista (2017 review) ei löytänyt todisteita siitä, että vähäkaloriset makeutusaineet, kuten aspartaami, sukraloosi ja steviosidi auttaisivat painon hallinnassa.

Eräät katsauksen tutkimuksista seurasivat tutkittavien elämäntapoja useiden vuosien ajan. Keinotekoisten makeutusaineiden säännöllinen käyttö assosioitui tutkimuksissa ylipainoon, lihavuuteen ja suurempaan vyötärönympärykseen.

Huolestuttavinta makeutusaineiden säännöllisessä saannissa on se, että vuoden 2017 tutkimuskatsaus havaitsi yhteyden säännöllisen makeutusaineiden saannin, sydäntautien, diabeteksen ja halvausten välillä.

Aspartaamin aikutukset ruokahaluun

Havaintojen perusteella keinotekoiset makeutusaineet lisäävät ruokahalua. Lisääntyneen ruokahalun arvellaan selittävän sitä, että kalorittomat ja vähäkaloriset makeutusaineet ovat yhteydessä lihomiseen.

Vuonna 2013 Trends in Endocrinology and Metabolism julkaisi tutkimuskatsauksen (2013 review), joka viittaa useisiin eläimillä tehtyihin tutkimuksiin. Säännöllinen kalorittomien tai vähän kaloreita sisältävän makeutusaineen saanti lisäsi näiden tutkimusraporttien mukaan eläinten ruokahalua ja painoa.

Katsauksessa arvellaan, että keinotekoiset makeutusaineet häiritsevät kehon ja aivojen välistä normaalia viestintää, jonka pitäisi kertoa aivoille, kun elimistö on saanut riittävästi runsasenergistä ravintoa. Elimistö viestii nälästä greliinin, ja kylläisyydestä leptiinin välityksellä. Näiden hormonien toiminnan sekoittaminen johtaa helposti lihomiseen.

Makean aistiminen signaloi suolistolle, että suolistoon on tulossa ravintoa. Keho odottaa saavansa energiaa ja valmistautuu siihen. Makuaisti tunnistaa myös makeutusaineiden makeuden, jolloin elimistö valmistautuu vastaanottamaan runsaasti ihania ja ravitsevia sokereita. Niitä ei kuitenkaan ole luvassa, sillä makeutusaineet eivät sisällä energiaa.

Hypoteesin mukaan säännöllinen keinotekoisten makeutusaineiden syöminen sekoittaa kehon nälästä ja kylläisyydestä kertovaa viestintää. Kun elimistö tottuu tähän, se ei enää reagoi oikeasti korkeakalorisiin ruokiin oikealla tavalla. Tämä voi vaikuttaa kylläisyyshormoni (leptiinin) toimintaan vaikuttamalla esimerkiksi leptiiniresistenssin kehittymiseen, jolloin ihminen ei koe tulevansa kylläiseksi, vaikka söisi riittävästi.

Vaikutukset aineenvaihduntaan

Sama prosessi, joka häiritsee elimistön energiatilasta kertovaa hormonaalista viestintää, voi lisätä insuliiniresistenssin ja tyypin 2 diabeteksen riskiä.

Keho oppii vähitellen, että makea ei tarkoita energiansaantia. Jos ihminen sitten syö sokeripitoista ravintoa, suolisto ja aineenvaihdunta ei reagoi enää sokeriin toivotulla tavalla.

Vuoden 2016 tutkimuskatsauksessa havaittiin, että keinotekoiset makeutusaineet ovat myrkkyä suoliston mikrobiomille. Keinotekoiset makeutusaineet järkyttävät suolistoflooran tasapainoa ja vähentävät mikrobiomin monimuotoisuutta.

Suolistoflooran lajikirjon heikkeneminen on myös yhteydessä lihomiseen. Esimerkiksi identtisillä kaksosilla, jotka syövät lähes identtisesti, toinen voi olla lihava ja toinen hoikka. Tämä selittyy suoliston mikrobiomin hyvinvoinnilla. Terve ja lajistoltaan runsaampi mikrobiomi vaikuttaa immuunijärjestelmän ohella myös aineenvaihduntaa tehostavasti. Mikrobilajistoltaan köyhempi suolistofloora assosioituu lihomiseen.

Eläinkokeissa on osoitettu, että tällaiset energia-aineenvaihdunnan häiriöt voivat johtaa glukoosi-intoleranssiin, joka on tyypin 2 diabeteksen riskitekijä.Vuodesta 2016 tehdyssä tutkimuksessa tutkittiin tiettyjen sokereiden ja makeutusaineiden vaikutuksia ihmisten sokerin sietokykyyn.

Lihavilla havaittiin yhteys aspartaamin saannin ja glukoosi-intoleranssin välillä. Mikään testatuista sokereista ja makeutusaineista ei kuitenkaan vaikuttanut kielteisesti normaalipainoisen ihmisen terveyteen.

Tutkimusten perusteella voidaan todeta, että säännöllinen aspartaamin saanti voi kasvattaa glukoosi-intoleranssin riskiä etenkin lihavilla.


Liittyykö aspartaamiin muita riskejä?

Viimeisten vuosikymmenten aikana aspartaamin on väitetty aiheuttavan ainakin:

  • Päänsärkyä
  • Huimausta
  • Kohtauksia
  • Masennusta
  • ADHD:ta
  • Alzheimerin tautia
  • Multippeliskleroosia (MS)
  • Syöpää
  • Lupusta
  • synnynnäisiä epämuodostumia

Ttutkimusaineistoa tai todisteita aspartaamin yhteydestä ylläoleviin sairauksiin ei ole olemassa. Nuo ovat enemmänkin urbaaneja legendoja.

Minä sairastan multippeliskleroosia, mutta en ole syönyt tai juonut juuri lainkaan aspartaamilla makeutettuja ruokia tai juomia. En usko aspartaamin aiheuttavan MS-tautia.Päänsärkyä paitsi aspartaamin yhteys ylläoleviin sairauksiin tuntuu epäuskottavalta.

Yhteenveto

Aspartaamin ympärillä kiehuu jatkuvasti, vaikka tutkimukset eivät anna aihetta ylettömälle paniikille.

Tuoreimpin tutkimusten mukaan aspartaamin pitkäaikainen säännöllinen käyttö voi aiheuttaa lihomista. On vain hyvin hataraa näyttöä siitä, että aspartaamista olisi haittaa terveille ja normaalipainoisille. Ylipainoisten ja lihavien kohdalla aspartaamin korrelaatio metaboliseen oireyhtymään ja tyypin 2 diabetekseen on osoitettu.




Ketogeeninen ruokavalio ja terveys

Korkea verenpaine on huonojen ravitsemustottumusten jälkeen toiseksi yleisin sairastumisen riskiä lisäävä tekijä, kertoo David J. Unwin (lue tutkimus tästä). Unwin on vuoden 2012 jälkeen hoitanut lihavia, korkeaa verenpainetta ja aikuistyypin diabetesta sairastavia potilaita ketogeenisellä ruokavaliolla. Tulokset ovat olleet hyviä.  Ketogeeninen ruokavalio ja terveys on laaja katsaus ketoilun positiivisiin terveysvaikutuksiin.

Kymmenet lääkärit ympäri maailman suosittelevat ketogeenistä ruokavaliota laihduttamiseen ja kardiometabolisten sairauksien hoitoon.

Uuden ravitsemusmallin omaksumisen vaikeus on siinä, että kasvavasta tutkimusnäytöstä ja parantuneista potilaista huolimatta ketogeeninen ruokavalio ei sovi nykyisiin ravitsemusmalleihin. Se haastaa vuosikymmeniä vallalla olleet ravitsemusopit ja lääketieteen paradigmat.

Ketogeeninen ruokavalio olettaa, että tyydyttyneisiin rasvoihin perustuva energiansaanti laihduttaa ja pitää kehon terveenä. Se sotii kaikkea oppimaamme vastaan.

Tieteen itseään korjaava periaate sopii huonosti ravitsemustieteen institutionalisoituihin dogmeihin. Jos tutkimukset antavat tuloksia, jotka eivät tue vallalla olevia käsityksiä, vanhoja oppeja pitää korjata vastaamaan uusia havaintoja.

Onko ketoilu vaarallista, koska siinä syödään paljon rasvaa?

Oppi rasvojen terveyshaitoista on rakennettu tieteellisesti hataralle perustalle. Rasvojen yhteys sydän- ja verisuonitauteihin on tieteellisesti kyseenalaistettu, mutta tämän paradigman asema ravitsemustieteessä on horjumaton.

Laajan kohorttitutkimusten meta-analyysin mukaan tyydyttyneet rasvat eivät lisää sydän- ja verisuonitautien riskiä.

” This current meta-analysis of cohort studies suggested that total fat, SFA, MUFA, and PUFA intake were not associated with the risk of cardiovascular disease. However, we found that higher TFA intake is associated with greater risk of CVDs in a dose-response fashion. Furthermore, the subgroup analysis found a cardio-protective effect of PUFA in studies followed up for more than 10 years.” Lue meta-analyysi tästä!

Olen laihtunut ketogeenisellä ruokavaliolla kolmessa kuukaudessa 9-10 kiloa. Ruokavalioni perusravinne on rasva, jota syön valtavasti virallisiin saantisuosituksiin nähden.  Verensokerini on hyvä 4,5-5,5. Verenpaineet ovat keskimäärin 135/85/80 -tasolla, mutta vaihteluväli on +/-10 suuntaansa.

Laihtuminen on ollut käsittämättömän helppoa, ja oloni on säilynyt koko ajan energisenä. Tältä osin uskallan suositella ruokavaliota muillekin. Tässä esiin tulevat lääketieteelliset havainnot ja väitteet perustuvat useisiin lähteisiin, joihin viittaan tekstissä ja tekstin jälkeen.

Kardiometabolinen syndrooma (CMS)

Kardiometaboliseen syndroomaan (CMS) sisältyy joukko aineenvaihduntaan, verenkiertoon ja munuaisiin assosioituvia häiriöitä. Yhteisiä nimittäjiä kardiometabolisille sairauksille ovat viskeraalinen rasva, keskivartalolihavuus ja insuliiniresistenssi.

Keskivartalolihavuuteen liittyy usein insuliinin heikompi vaikutus ääreiskudoksissa ja/tai seerumin korkea insuliinipitoisuus.

CMS:n oireisiin kuuluvat mm. korkea verenpaine, poikkeavuudet verenpaineen ja sykkeen vuorokausivaihtelussa, diabetekseen viittaavat rasva- ja sokeriaineenvaihdunnan muutokset, aikuistyypin diabetes, alkoholista riippumaton rasvamaksa, lisääntynyt verenhyytymistaipumus, kihti sekä sydän- ja verenkiertoelinten lisääntynyt tulehdusriski.

Epidemiologisissa tutkimuksissa on havaittu, että kardiometabolinen oireyhtymä kasvattaa sepelvaltimotauti-, aivohalvaus-, sydän- ja verisuonitautikuolleisuus- ja kokonaiskuolleisuus-riskejä.

Rohkeimpien lääkäreiden ja ketogeenisen ruokavalion puolestapuhujien, kuten Joseph R. Kraftin ja Ted Naimanin mukaan useimmat sydän- ja verisuonitaudit assosioituvat diagnosoituun tai diagnosoimattomaan diabetekseen. Tämä näkemys sopii hyvin havaintoon, että diabeetikoiden sydän- ja verisuonitautikuolleisuus on hyvin korkea.

Diabeteksen laboratoriodiagnoosin kehitykseen 1970-luvulla osallistuneen tri Joseph R. Kraftin mukaan hyperinsulinemia liittyy vahvasti verenpainetaudin, lihavuuden, ateroskleroosin, neurodegeneratiivisten sairauksien (Parkinsonin tauti, Alzheimerin tauti), eräiden syöpien ja verisuonitautien kehittymiseen.

Kardiometabolinen oireyhtymä ja kardiometaboliset sairaudet yleistyvät vauhdilla. Kraft varoitti diabetesepidemiasta ja hyperinsulinemiaan assosioituvista sairauksista jo 1970-luvulla.

Yhteinen nimittäjä kardiometabolisille sairauksille on samanaikainen insuliiniresistenssin aiheuttama hyperinsulinemia. Paikallinen insuliiniresistenssi ei yksistään yleensä aiheuta sairauksia, sillä aineenvaihdunta turvautuu siihen joskus tarkoituksella. Insuliiniresistenssi ja korkeat insuliinitasot yhdessä ovat vakava uhka terveydelle.

Lihavien prosentuaalinen osuus väestöstä Euroopassa

Synkkiä lukuja

Monet sairastuvat, vaikka he liikkuvat ja noudattavat yleisiä ravitsemussuosituksia. Länsimaissa on maailman paras sairaanhoitojärjestelmä, mutta samanaikaisesti todella sairas väestö.

Ylipainoisten ja lihavien määrä on Maailman terveysjärjestön (WHO) mukaan kolminkertaistunut vuoden 1975 jälkeen.

Kiinassa lihavia on 5-6 prosenttia väestöstä, mutta suurissa kiinalaiskaupungeissa, joissa syödään eniten pikaruokaa, lihavien osuus on lyhyessä ajassa kasvanut yli 20 prosenttiin; ylipainoisten ja lihavien kiinalaisten määrä on vain 10 viime vuoden aikana kolminkertaistunut. Keskivartalolihavien kiinalaisten määrä on samana aikana lisääntynyt 50 prosenttia.

Amerikkalaisista 35,4 prosenttia on lihavia, 61,5 % vyötärölihavia. Noin 100 miljoonaa amerikkalaista sairastaa tyypin 2 diabetesta tai esidiabetesta. Euroopan unionin alueella 30-70 % ihmisistä on jo ylipainoisia ja 10-30 % lihavia. EU:ssa lähes 30 miljoonaa ihmistä sairastaa diabetesta. Koko Euroopan (56 valtiota) alueella diabetesta sairastaa noin 60 miljoonaa ihmistä.

Diabetes

Aikuistyypin diabetesta sairastavien määrä on kasvanut noin 108 miljoonasta (1980) 422 miljoonaan (2014). Prosentuaalisesti maailman väestössä diabeteksen esiintyvyys on kasvanut 4,3 prosentista 8,8 prosenttiin neljässä vuosikymmenessä. Kasvun uskotaan jatkuvan. Nykyisen trendin perusteella vuonna 2045 joka kymmenes maailman ihminen sairastaa diabetesta.

Diabetesta sairastavien lisäksi jopa 352 miljoonan ihmisen glukoosin sieto on heikentynyt ja he sairastavat esidiabetesta. Mikä tällaisen selittää ja pitääkö tästä huolestua?

Minun mielestäni pitää huolestua. Diabetes yleistyy nopeimmin pieni- ja keskituloisten parissa, mutta se yleistyy myös muissa sosioekonomisissa väestöryhmissä. Diabetes on tärkein sokeutta, munuaisvaurioita, sydänkohtauksia ja alaraajojen amputaatioita aiheuttava sairaus.

Vuonna 2016 1,6 miljoonaa ihmistä menehtyi diabeteksen seurauksena ja näiden lisäksi 2,2 miljoonaa kuolemantapausta assosioitui vahvasti korkeaan verensokeriin (WHO).

IDF:n tilastojen mukaan diabetes ja siihen liittyvät komplikaatiot tappavat vuosittain noin 4 miljoonaa ihmistä. Tilastollisesti yksi ihminen kuolee diabeteksen seurauksena seitsemän sekunnin välein. Inhimillisen kärsimyksen lisäksi tyypin 2 diabetes tulee yhteiskunnille mahdottoman kalliiksi.

”The figures given in the IDF Atlas fit well with the estimates of an international consortium reporting worldwide trends in diabetes since 1980 based on a pooled analysis of 751 population-based studies with 4·4 million participants. According to this group global age-standardised diabetes prevalence increased from 4.3% (95% CI 2.4-7.0) in 1980 to 9.0% (7.2-11.1) in 2014 in men, and from 5.0% (2.9-7.9) to 7.9% (6.4-9.7) in women.”

Syitä diabetesepidemialle voidaan etsiä esimerkiksi vähentyneestä arkiliikunnasta, väestön lisääntymisestä ja ihmisten odotettavissa olevan elinajan kasvusta. Nämä eivät kuitenkaan selitä nykyistä diabetesepidemiaa riittävän hyvin, sillä miljoonat raskasta fyysistä työtä tekevät ja ravintosuosituksia noudattavat lihovat ja sairastuvat diabetekseen.

Eräs tärkeimmistä diabeteksen kasvua selittävistä tekijöistä on keskivartalolihavuuden nopea lisääntyminen lähes kaikissa sosioekonomisissa ryhmissä ympäri maailman.

Mistä tiedän, onko minulla diabetes?

Terveellä ihmisellä paaston jälkeinen plasman sokeri on 6 mmol/l tai vähemmän. Kahden tunnin sokerirasituksessa terveen ihmisen verensokeri pysyy alle 7,8 mmol/l.

Kun paastoverinäytteestä mitataan sokeria 6,1–6,9 mmol/l, kyseessä on kohonnut paastoplasman sokeri eli heikentynyt paastosokeri (IFG, impaired fasting glucose).

Heikentynyt sokerinsieto (IGT, impaired glucose tolerance) todetaan, kun verensokeripitoisuus on 7,8–11 mmol/l sokerirasituskokeessa 2 tunnin kohdalla tai 2 tuntia aterian jälkeen.

Tutkimuksessa ketogeeninen ruokavalio oli perinteistä vähärasvaista diabetesruokavaliota parempi:

”Individuals with type 2 diabetes improved their glycemic control and lost more weight after being randomized to a very low-carbohydrate ketogenic diet and lifestyle online program rather than a conventional, low-fat diabetes diet online program. Thus, the online delivery of these very low-carbohydrate ketogenic diet and lifestyle recommendations may allow them to have a wider reach in the successful self-management of type 2 diabetes.”

Hyvä uutinen on se, että tyypin 2 diabetes ei ole krooninen sairaus. Se on voitettavissa! Tyypin 2 diabetes voidaan hoitaa esimerkiksi vähäkalorisella tai ketogeenisellä ruokavaliolla. Näistä jälkimmäinen on tutkimusten perusteella parempi.

”A literature search was performed, and a total of 99 original articles containing information pertaining to diabetes reversal or remission were included. Results: Evidence exists that T2D reversal is achievable using bariatric surgery, low-calorie diets (LCD), or carbohydrate restriction (LC).” Lue tästä!

Lihavien määrän kasvu eri väestöissä

Pitääkö klassinen ruokapyramidi kaataa?

Perinteiset lautasmallit ja ravintopyramidit eivät selvästikään suojele meitä lihomiselta ja sairastumiselta. Sairaudet yleistyvät, vaikka ihmiset noudattavat suosituksia, liikkuvat ja lääketiede kehittyy. Missä vika?

Eräs perinteisen ravintopyramidin kaatajista on professori Tim Noakes, joka on elämänsä aikana juossut kymmeniä maratoneja ja ultramaratoneja. Noakes kirjoitti uransa alussa vähärasvaiseen ja runsaasti hiilihydraatteja sisältävään ruokavalioon kannustavia kirjoja.

Noakes käänsi oman ravitsemuksensa ylösalaisin sairastuttuaan aikuistyypin diabetekseen. Hän sairastui, vaikka vältteli rasvoja, liikkui hyvin aktiivisesti ja söi virallisten suositusten mukaisesti. Vallalla olevan mallin mukaan maailman ”timnoakesien” ei pitäisi lihoa tai sairastua aikuistyypin diabetekseen, mutta monet maailman ”timnoakesit” sairastuvat.

Tohtori David Unwin kertoo, että vuonna 1986 hänen vastaanotollaan kävi 57 aikuistyypin diabetesta sairastavaa. Tauti oli tuohon aikaan vielä melko harvinainen ja siihen sairastuivat lähinnä iäkkäät ihmiset. Vuonna 2012 samalla vastaanotolla tyypin 2 diabeetikkoja oli jo 472.


Insuliini on anabolinen hormoni

Verenpainetauti, lihavuus, dyslipidemia ja glukoosi-intoleranssi assosioituvat hyperinsulinemiaan. Oirekirjo tunnetaan metabolisena oireyhtymänä. Hyperinsulinemia vaikuttaa verenpaineeseen lisäämällä munuaisten natriumretentiota (natriumin säilytystä).

Insuliini on aminohapoista muodostuva hormoni. Hormonit ovat elimistön valmistamia endogeenisiä viestinvälittäjämolekyylejä, jotka kulkevat erittymispaikasta kohdesoluihin pääosin verenkierron välityksellä. Hormoni voi vaikuttaa pieninäkin määrinä soluun, jossa on hormonille spesifisiä reseptoreja.

Eri puolilla elimistöä sijaitsevat umpirauhaset erittävät hormoneja aivolisäkkeen ja hypotalamuksen säätelemänä. Insuliinin eritystä ohjaa veren sokeripitoisuus. Glukoosi aiheuttaa piikin insuliinin erityksessä. Proteiinit ja rasvat vaikuttavat insuliinin eritykseen paljon sokereita maltillisemmin.


Mitä hormonit ovat?

Hormonit, jotka voivat olla joko vesiliukoisia (katekoliamiinit, glukagoni ja insuliini) tai rasvaliukoisia (D-vitamiini, steroidit ja kilpirauhashormonit) säätelevät lähes kaikkia elimistön aineenvaihduntaprosesseja. Ne ovat aminohappo-, rasvahappo-, proteiini- ja peptidihormoneja tai steroideja.

Aminohappoyhdisteistä muodostuneet hormonit muodostuvat tyrosiinista ja tryptofaanista. näihin hormoneihin kuuluvat kilpirauhasen erittämät kilpirauhashormonit ja lisämunuaisytimen erittämät katekoliamiinit.

Solukalvojen fosfolipidi arakidonihappo toimii rasvahappoyhdisteisten hormonien lähtöaineena. Tällaisia ovat mm. eikosanoidit (esimerkiksi postglandiinit, tromoksiaanit ja leukotrieenit).

Proteiini- ja peptidihormonit ovat muodostuneet muutamista tai jopa sadoista aminohapoista. Tällaisia ovat esimerkiksi vasopressiini ja tyreoliberiini.

Proteiinihormoneja ovat mm. insuliini ja kasvuhormoni. Proteiinihormoneja, joihin on liittyneenä hiilihydraattiryhmä, kutsutaan glykoproteiineiksi. Glykoproteiineja ovat esimerkiksi follikkelia stimuloiva hormoni ja luteinisoiva hormoni. Steroidihormonien lähtöaineena toimii kolesteroli.

Insuliini ja insuliiniresistenssi

Terve aineenvaihdunta reagoi ruokailun kohottamaan verensokeriin erittämällä insuliinia haiman Langerhansin saarekkeiden β-soluista. Insuliinimolekyylit kulkeutuvat verenkierron mukana soluihin ja kiinnittyvät kudosten insuliiniherkkien solujen insuliinireseptoreihin.

Insuliinireseptoriin kiinnittynyt insuliinimolekyyli ”kutsuu” solukalvon läpäisevän kanavan, jota pitkin glukoosimolekyyli pääsee sujahtamaan solun sytoplasmaan.

Insuliini vaikuttaa insuliiniherkkiin kudoksiin, kuten lihas- ja rasvasoluihin sekä maksan soluihin. Sillä on merkittävä tehtävä kehon energiataloudessa ja erityisesti sokeriaineenvaihdunnassa, koska insuliini lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa. Insuliiniresistenssi vaikuttaa ensimmäiseksi lihassoluihin, joten rasvasolujen energian varastoiminen lisääntyy.

Normaalisti insuliinin eritys vähenee verensokerin laskiessa. Terveillä verensokeri pysyy noin 5 mmol /l (90 mg /dl) -tuntumassa. Esidiabeteksessa sokeritasot kohoavat lähelle 7 mmol /l -tasoa. Diabetekseen sairastuneilla yön yli paaston jälkeen mitattu verensokeri on toistuvasti 7,0 mmol/l tai sitä korkeampi. Normaalin verensokerin yläraja on 6,0 mmol/l.

Insuliini on kehon energiatalouden kapellimestari. Se ohjaa ravinteiden käyttöä energian tuotantoon tai varastoimiseen solujen kylläisyysasteen mukaisesti.

Insuliinipitoisuuden laskiessa glukagoni purkaa insuliinin rakentamia energiavarastoja maksan ja lihasten glykogeeneistä. Näiden hormonien pitoisuus veressä vaihtelee jatkuvasti. Välillä glukoosia puretaan glukagonin aktivoimana glykogeeneistä ja välillä glykogeeni- ja rasvavarastoja kootaan insuliinin avulla.

Insuliiniresistentillä henkilöllä insuliini ei laske verensokeria halutulla tavalla. Rasva- ja lihassolut, tarvitsevat insuliinia glukoosin sisäänottoon. Kun nämä solut eivät reagoi insuliiniin, verensokeri nousee.

Pitkään jatkuvalla korkealla verensokerilla on monia haitallisia terveysvaikutuksia: se mm. heikentää verisuonia.  Aterioiden välillä insuliinitasot laskevat. Insuliinin laskun vaikutuksesta haiman alfasolut erittävät vereen glukagonia. Tämä insuliinin vastavaikuttaja aktivoi sokerivarastojen purkamisen maksasta vereen ja lihaksista lihasten omaan käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.

Rasvasolujen insuliiniresistenssissä verenkierrossa olevien lipidien imeytyminen heikkenee ja varastoituneiden triglyseridien hydrolyysi kiihtyy. Tämä lisää vapaiden rasvahappojen määrää veriplasmassa ja voi edelleen pahentaa insuliiniresistenssiä.

Hyperinsulinemia


Lisääntynyt viskeraalinen rasva erittää tulehdusta aiheuttavia sytokiinejä vereen, ja nämä vaikuttavat insuliinireseptorien toimintaa heikentävästi.

Hyperinsulinemia

Insuliiniresistenssi voi johtaa hyperinsulinemiaan, eli tilaan, jossa veressä on aivan liikaa insuliinia. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, minkä vuoksi veren glukoosia varastoidaan rasvasoluihin.

Insuliiniresistenssin vaikutuksesta lihasten toiminta heikkenee, sillä lihassolujen glukoosinsaanti vähenee. Samalla insuliinin vaikutuksesta rasvakudoksen rakentaminen tehostuu ja ihminen lihoo.

Koska insuliini on ensisijainen hormonaalinen signaali energian varastoimiselle insuliiniherkkiin rasvasoluihin, se stimuloi uuden rasvakudoksen muodostumista ja kiihdyttää painonnousua.

Insuliiniresistenssi lisää haiman beetasolujen insuliinin tuotantoa. Tämä nostaa veren insuliinitasoja (hyperinsulinemia) korkean verensokerin kompensoimiseksi.

Kompensoidun insuliiniresistenssivaiheen aikana insuliinitasot kasvavat, mutta verenkierron lisääntynyt insuliini ei kuitenkaan laske verensokeria.

Jos lisääntynyttä verensokeria kompensoiva insuliinieritys epäonnistuu laskemaan verensokeria, paastoglukoosi ja aterianjälkeinen glukoosi näkyvät mittauksissa kohonneina glukoosipitoisuuksina. Normaali glukoosipitoisuus pysyy aina 5 mml/l tuntumassa. Esidiabeteksessa verensokeritasot ovat 6,0-6,9 mml/l ja diabeteksessa yli 7 mml/l. Heikentynyt insuliinisensitiivisyys eli insuliiniresistenssi vaikuttaa näin tyypin 2 diabeteksen kehittymiseen.

Insuliiniherkät rasvasolut maksassa ja haimassa säilyttävät insuliinisensitiivisyyden lihassoluja pidempään. Tämän vuoksi insuliini kompensoi kohonnutta verensokeria ohjaamalla glukoosia rasvasoluihin, jossa glukoosi de novo lipogeneesissä muutetaan triglyserideiksi.

Tämä lisää myös maksan ja haiman rasvoittumista. Maksan rasvoittuminen lisää alkoholista riippumattoman rasvamaksan riskiä, mutta sitä suurempi ongelma insuliiniresistenssin ja aikuistyypin diabeteksen kannalta on haiman rasvoittuminen, sillä se heikentää entisestään insuliinintuotantoa, kunnes lopulta beetasolujen toiminta lakkaa kokonaan.

Insuliiniresistenssi assosioituu vahvasti ihmisiin, joilla on runsaasti viskeraalista keskivartaloläskiä, verenpainetauti, hyperglykemia, dyslipidemia, kohonneet triglyseriditasot, kohonnut hyvin pienten matalan tiheyden lipoproteiinien (sdLDL) tasot ja pienentyneet HDL-tasot.

Viskeraalinen keskivartalorasva assosioituu tutkimusten perusteella vahvasti insuliiniresistenssiin kahdella tavalla:

Ensinnäkin toisin kuin ihonalainen rasvakudos, viskeraalinen rasva tuottaa tulehduksellisia sytokiinejä, kuten tuumorinekroositekijä-alfa (TNF-a), interleukiini-1 ja interleukiini-6. Monissa kokeissa on osoitettu, että nämä proinflammatoriset, eli tulehdusta edistävät sytokiinit, hajottavat insuliinia tai estävät insuliinin normaalia toimintaa. Suuri osa tulehduksellisten sytokiinien tuotannosta on keskittynyt IKK-beeta / NF-kappa-B-reitille, proteiiniverkolle, joka tehostaa insuliiniresistenssiä vaikuttamalla tulehduksellisten markkerien ja välittäjien transkriptioon.

Toisaalta viskeraalinen rasva vaikuttaa myös rasvan kerääntymiseen maksaan, mikä aiheuttaa alkoholista riippumattoman rasvamaksan kehittymistä (NAFLD). Tämän seurauksena verenkiertoon vapautuu liikaa vapaita rasvahappoja lisääntyneen lipolyysin seurauksena. Edelleen NAFLD:n seurauksena maksan glykogenolyysi (glykogeenien pilkkominen glukoosiksi) ja maksan glukoosin tuotanto kiihtyvät, mikä pahentaa perifeeristä insuliiniresistenssiä ja kasvattaa tyypin 2 diabeteksen riskiä.

Insuliiniresistenssiin liittyy usein myös hyperkoaguloituva tila (heikentynyt fibrinolyysi) ja lisääntyneet tulehdukselliset sytokiinitasot.

Molekyylitasolla

Molekyylitasolla solu havaitsee insuliinin insuliinireseptoreiden välityksellä signaalin kulkiessa signalointikaskadin läpi. Tämä tunnetaan nimellä PI3K / Akt / mTOR signalointireitti.

Tuoreet tutkimukset viittaavat siihen, että tämä signalointireitti voi toimia fysiologisista olosuhteista riippuvaisena kaksisuuntaisena eli bistabiilina kytkimenä tietyntyyppisille soluille, jossa insuliinivaste voi olla kynnysilmiö.

Tämän signalointireitin herkkyys insuliinille voi heikentyä monien tekijöiden, kuten vapaiden rasvahappojen aiheuttaman insuliiniresistenssin seurauksena. Laajemmasta näkökulmasta herkkyyden virittäminen (tai herkkyyden vähentäminen) on organismin normaali tapa sopeutua muuttuvan ympäristön tai aineenvaihdunnan olosuhteisiin. Eli insuliiniresistenssi voi joissain tilanteissa olla elimistön kannalta toivottava tila.

Esimerkiksi raskaus muuttaa odottavan äidin aineenvaihduntaa. Odottavan äidin elimistön on vähennettävä lihaksiensa insuliiniherkkyyttä varatakseen enemmän glukoosia aivan erityisesti sikiön aivojen kehitykselle. Tämä voidaan saavuttaa siirtämällä insuliinin vastekynnystä, eli herkkyyttä erittämällä vereen istukan kasvutekijää, joka estää insuliinireseptorisubstraatin (IRS) ja PI3K:n vuorovaikutusta. Tämä on ns. säädettävän kynnyshypoteesin ydin.

Insuliiniresistenssi superoksidaasidismutaasi

Insuliiniresistenssi voi olla lisääntyneen ravinnonsaannin aiheuttama solutason reaktio. Ylimääräinen energiansaanti vaikuttaa solujen mitokondrioissa superoksidaasidismutaasin toimintaan.

Superoksidisdaasimutaasi on yksi tärkeimmistä antioksidanteista. Tällaisesta molekyylitason vaikutuksesta on viitteitä erilaisissa insuliiniresistenssistä tehdyissä havainnoissa. Kokeissa on havaittu myös, että insuliiniresistenssi voidaan kääntää nopeasti altistamalla solut esimerkiksi elektronin kuljetusketjun estäjille tai mitokondrioiden superoksididismutaasia jäljitteleville aineille.

Superoksidaasidismutaasi

Insuliiniresistenssi on yhteydessä verenpaineeseen. Nakamura tutkijakollegoineen. osoitti insuliiniresistenteillä jyrsijöillä ja ihmisillä, että vaikka insuliinin stimuloiva vaikutus adiposyyttien glukoosin imeytymisen insuliinireseptorisubstraatin 1 (IRS1) välityksellä heikentyi voimakkaasti, IRS2 välittämä vaikutus suolan imeytymiseen munuaisten proksimaaliseen tubulukseen, säilyi.

Kompensoiva hyperinsulinemia yksilöillä, joilla on insuliiniresistenssi, voi lisätä natriumin kerääntymistä proksimaaliseen tubulukseen, mikä johtaa natriumin ylikuormitukseen ja verenpaineen kohoamiseen.

Superoksidaasidismutaasi (SOD3) on useimmissa kudoksissa esiintyvä antioksidanttientsyymi, joka muuttaa haitallista superoksidia vähemmän haitalliseksi vetyperoksidiksi. Sekin on reaktiivinen happiyhdiste, mutta se toimii myös solujen viestinnässä viestinvälitysmolekyylinä. SOD3 saattaa siis osallistua solujen viestintään.

FM, PhD Lilja Laatikainen selvitti väitöstutkimuksessaan, kuinka solunulkoinen superoksididismutaasi-entsyymi suojaa kudoksia tulehdusreaktion aiheuttamilta vaurioilta. Tutkimus osoitti, että kudokseen virusvektorin avulla siirretty SOD3 estää tulehdussolujen, erityisesti makrofagien, kulkeutumisen vaurioituneeseen kohtaan.

Mekanismi on Laatikaisen tutkimuksen perusteella tulehdussolujen tarvitsemien tarttumismolekyylien ja tulehdusta edistävien sytokiinien tuoton vähentäminen estämällä keskeisen NF-kappa-B-molekyylin toimintaa. Tämän lisäksi SOD3 voimisti viestien välitystä Erk- ja Akt-signalointireiteillä, jotka edistävät solujen eloonjääntiä stressitilanteissa, ja vastaavasti vähensi solukuolemaan johtavien tekijöiden ilmentymistä, vähensi kudosvaurion laajuutta ja nopeutti kudoksen paranemista.

Insuliiniresistenssi tai heikentynyt insuliiniherkkyys on olennainen piirre aineenvaihdunnan oireyhtymässä, johon assosioituvat liikalihavuus, heikentynyt glukoosin sieto, dyslipidemia ja verenpaine. Dyslipidemialla tarkoitetaan rasva-aineenvaihdunnan häiriötä, jossa jokin veren rasva-arvoista (LDL, HDL, triglyseridit) ei vastaa suosituksia. Dyslipidemiasta puhutaan, jos seerumin LDL on yli 3 mmol litrassa, triglyseridipitoisuus yli 2 mmol/l tai HDL-pitoisuus alle 1mmol/l.

Insuliinin toiminta

Heikentynyt insuliiniherkkyys johtaa kompensoivaan hyperinsulinemiaan normaalin verensokerin ylläpitämiseksi. Insuliiniresistenssi voi olla toissijainen vaste insuliinireseptorin (IR) ja telakointiproteiinien, kuten insuliinireseptorisubstraattien (IRS) vaimennussäätelyä tai inaktivaatiota ohjaavalle signaloinnille.

Insuliinilla on tärkeä tehtävä verensokerin säätelyssä, sillä se stimuloi glukoosin kuljetusta rasvasolujen ja luurankolihasten kudosten läpi insuliinireseptorisubstraattien aktivaation jälkeen.

Insuliini stimuloi glukoosin kuljettajien (GLUT) siirtämistä solunsisäisistä kalvo-osastoista plasmakalvoon lisäämällä sokerin imeytymistä. Rasva- ja luurankolihaskudoksissa vaikuttaa useita glukoosin kuljetusmolekyylejä, mutta havaintojen perusteella GLUT4 on glukoosin solukalvojen läpi kuljettamisen kannalta tärkein kuljetusmolekyyli.

Insuliini sitoutuu ja aktivoi insuliinireseptori-tyrosiinikinaasia (IR), mikä johtaa IRS1:n, IRS2:n, IRS3:n ja IRS4:n fosforylaatioon. Sitoutumalla signalointipartnereiden, kuten fosfoinositidi-3-kinaasin (PI3K) kanssa insuliini aktivoi Akt/proteiinikinaasi B- ja proteiinikinaasi C-ζ -kaskadit, joilla on tärkeä tehtävä insuliinin toiminnassa.

IRS-alatyypit jakautuvat kudosspesifisesti, ja niillä on selkeät signalointikanavat. IRS1 välittää insuliinin vaikutusta glukoosin imeytymiseen rasvasoluissa ja luurankolihaksissa. IRS2 toimii ensisijaisesti välittäen insuliinin vaikutusta munuaistiehyihin.

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssin ja verenpaineen välinen yhteys on joko kahden itsenäisen prosessin yhteys, joka ei ole ainakaan suoraan yhteydessä verenpaineeseen, tai syy-seuraussuhde, jossa insuliiniresistenssi aiheuttaa kohonneen verenpaineen.

Jos insuliiniresistenssi ei aiheuta kohonnutta verenpainetta, insuliiniresistenssi ja kohonnut verenpaine voivat olla saman soluhäiriön toisiinsa liittymättömiä seurauksia. Eli kyse voi olla solunsisäisen vapaan kalsiumin määrän lisääntymisestä, mikä johtaa verisuonten supistumiseen ja insuliinin heikentyneeseen toimintaan.

Insuliiniresistenssi on toisaalta myös moniin verenpaineen kohoamista aiheuttaviin aineenvaihdunnan poikkeamiin assosioituva molekyylimarkkeri.

Toinen vaihtoehto on, että hyperinsulinemia vaikuttaa verenpainetaudin syntyyn, lisäämällä natriumin imeytymistä munuaisiin, aktivoimalla sympaattista hermostoa ja muuttamalla verisuonten resistenssiä.

Kudoksen heikentynyt insuliiniherkkyys on yhteinen nimittäjä useille sairauksille, kuten metabolinen oireyhtymä, keskivartalolihavuus, hyperglykemia, dyslipidemia, hypertensio ja insuliiniresistenssi. Vaikka insuliiniresistenssin osuutta hyperglykemian ja dyslipidemian osalta on tutkittu, insuliiniresistenssin merkityksestä verenpainetaudin patogeneesissä tiedetään vähemmän kuin insuliiniresistenssin merkityksestä metabolisen oireyhtymän ja tyypin 2 diabeteksen sekä lihavuuden synnyssä.

Miten Suomessa?

Diabetesliiton mukaan Suomessa vajaat puoli miljoonaa ihmistä sairastaa aikuistyypin diabetesta. Arviolta 100 000 sairastaa diabetesta tietämättään. Joka vuosi yli 20 000 suomalaista sairastuu tyypin 2 diabetekseen.

Diabetes on suurin yksittäinen valtimotautien, aivoverenkiertohäiriöiden ja alaraaja-amputaatioiden syy. Se lisää myös munuais- ja silmäsairauksia. Suomessa diabeteksen hoitokustannuksiin kuluu ihan helvetisti rahaa. Diabeteksen hoitoon käytetään 15 % terveydenhuollon menoista.

FinTerveys 2017 -tutkimuksen mukaan yli 30-vuotiaista miehistä 72 % ja naisista 63 % oli vähintään ylipainoisia. Miehistä 26 % ja naisista 28 % oli lihavia. Melkein puolet suomalaisista on vyötärölihavia.

Jo noin puoli miljoonaa ihmistä käyttää verenpainelääkkeitä. Tuhansilla verenpaineet ovat jatkuvasti riskirajoilla.  

Ketogeeninen ruokavalio toimii painonhallinnassa, pitää verensokerin tasaisena ympäri vuorokauden ja laskee tutkitusti verenpainetta. Voisiko ketogeeninen ruokavalio auttaa verenpaineen, painon ja huonojen lipidiprofiilien kanssa kamppailevia myös Suomessa?

Miksi ketoilu laskee verenpainetta?

David J. Unwin kertoo hiljattain tehdystä pilottitutkimuksesta, jossa tutkijat havaitsivat, että hyvin vähän hiilihydraatteja sisältävään ruokavalioon assosioitui merkittäviä verenpaineen, painon ja lipidiprofiilien paranemista, minkä vuoksi potilaiden lääkitystä voitiin tutkimuksen aikana vähentää.

Kysymys on: Voidaanko samanlaisia positiivisia terveyshyötyjä saada laajemmassa tutkimuksessa? Unwin tutkijaryhmineen rekrytoi perusterveydenhuollon seurantatutkimukseen 154 potilasta, jotka sairastivat aikuistyypin diabetesta, tai joilla sokerin sietokyky oli merkittävästi heikentynyt.

Vähähiilihydraattisen ruokavalion vaikutuksia sydämen ja verisuonitautien riskitekijöihin tutkittiin keskimäärin kaksi vuotta. Seurattujen potilaiden verenpaine laski merkittävästi LCHF-ruokavaliolla:

* Systolinen verenpaine laski keskimäärin 10,9 mmHg
*Diastolinen verenpaine laski keskimääräinen 6,3 mmHg
*Tutkimukseen osallistuneiden potilaiden paino laski keskimäärin 9,5 kg    *lipidiprofiilit paranivat selvästi

Tutkimuksen aikana potilaiden verenpainelääkitystä vähennettiin 20 prosentilla.  Kansallinen terveydenhuollon huippuosaamisinstituutti (National Institute for Health and Care Excellence – NICE) määrittelee kohonneen verenpaineen riskirajaksi 140/90 mmHg ja sitä korkeammat tulokset. Kotioloissa mitatut päivittäiset verenpaineen keskiarvot, jotka ovat vähintään135/85 mmHg ovat korkean verenpaineen riskirajoilla. Ymmärtääkseni näitä arvoja noudatetaan myös suomalaisessa terveydenhuollossa.

Hiljattain julkaistun tutkimuksen (lue tästä) mukaan huonojen ravitsemustottumusten jälkeen korkea verenpaine on globaalisti merkittävin sairastumisen riskitekijä.

Isossa-Britanniassa korkea verenpaine on tupakoinnin ja huonojen ravitsemustottumusten jälkeen kolmanneksi merkittävin sairastumiselle altistava riskitekijä.

Usein korkean verenpaineen syy voi johtua esimerkiksi ylipainosta, tupakoinnista, runsaasta suolan käytöstä tai perinnöllisistä tekijöistä, mutta toisinaan kohonneelle verenpaineelle ei löydetä mitään suoraa kausaalista syytä. Tällöin puhutaan essentiaalisesta hypertensiosta. Se on viisaalta kuulostava diagnoosi, joka kertoo, että syytä kohonneelle verenpaineelle ei tiedetä.

Tutkijat laativat vuonna 2013 ohjeita vähähiilihydraattisen ruokavalion (vähemmän kuin 130 g hiilihydraattia / päivä) hoitosuosituksia tyypin 2 diabeteksen. 19 potilaan pilottitutkimuksen potilaat sairastivat aikuistyypin diabetesta tai heidän sokerinsietokykynsä (IGT) oli merkittävästi heikentynyt. Kahdeksan kuukauden tutkimuksen hämmästyttävimmät seuraukset olivat potilaiden verenpaineen merkittävä parantuminen.  è systolinen 148 ± 17–133 ± 15 mmHg, p <0,005 è diastolinen 91 ± 8–83 ± 11 mmHg, p <0,05).  Koehenkilöiden verenpaineet laskivat huolimatta verenpainelääkkeiden käytön lopettamisesta.

Hypoteesi vuoden 2013 pilottitutkimuksen tuloksille oli, että vähähiilihydraattiset ruokavaliot voivat toimia diabeteksen ja painonhallinnan hoidossa perinteisiä hoitomuotoja paremmin. Aluksi hypoteesi herätti lääketieteellisessä yhteisössä runsaasti kritiikkiä ja epäilyjä, mutta sittemmin ketogeeninen ruokavalio on laajemmin hyväksytty osaksi aikuistyypin diabeteksen hoitoa. (Lue tästä ja tästä).

Hiilihydraattien vähentämisen vaikutukset insuliinin aktiivisuuteen ja metabolisen oireyhtymän oireiden hoitoon osoitettiin jo vuonna 2005 (lue tutkimus). Lisätyn sokerin lisäksi kaikkien ravinnon glukoosilähteiden, kuten leivän, perunan, viljan ja riisin rajoittaminen vähentää insuliinin eritystä ja parantaa insuliiniherkkyyttä.

Metabolinen oireyhtymä, korkea verenpaine DB2, keskivartalolihavuus, dyslipidemia ja alkoholista riippumaton rasvamaksa (NAFLD) ovat vain jäävuoren huippu. Kaikki nämä sairaudet palautuvat pinnan alla vaanivaan insuliiniresistenssiin.

Vuonna 2013 valmistunut vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion ja vähärasvaisen ruokavalion pitkäaikaisia vaikutuksia selvittänyt satunnaistettujen kontrolloitujen tutkimusten (> 12 kuukauden kesto) meta-analyysi, osoitti vähän hiilihydraatteja sisältävällä ruokavaliolla selvää laskua diastolisessa verenpaineessa, mutta ei systolisessa verenpaineessa.

Samana vuonna valmistunut toinen satunnaistettu kontrolloitu tutkimus havaitsi, että sekä systolinen että diastolinen verenpaine laskivat kuuden viikon kuluttua.

Tyypin 2 diabetesta sairastavilla hyperinsulinemia lisää munuaisten natriumin pidättämistä. Samaa ei tapahdu terveillä verrokeilla. Vuonna 2017 satunnaistettujen vertailututkimusten systemaattinen katsaus ja meta-analyysi osoitti, että pienemmän glykeemisen kuorman ruokavalio laskee merkittävästi verenpainetta. (Lue tästä)

Huolimatta ketogeenisen ruokavalion hyötyjen laajemmasta hyväksynnästä, vähähiilihydraattisen ruokavalion pitkäaikaisvaikutukset herättävät yhä kysymyksiä.

Iso-Britannian diabetesyhdistyksen marraskuussa 2018 antaman lausunnon mukaan: vaikka vähän hiilihydraatteja sisältävän ruokavalion ”lyhytaikaiset” hyödyt diabetesta sairastavan painonhallintaan, parantunut glykeeminen kontrolli ja pienentynyt sydän- ja verisuonitautien riski on osoitettu, ketogeenisen ruokavalion pitkäaikaisvaikutuksista tarvitaan lisää tutkimuksia.

Tutkimus ja menetelmät

Tutkimuksessa analysoitiin retrospektiivisesti yleislääkäreiden tutkimusta varten keräämiä kliinisiä tietoja 9700 potilaasta Pohjois-Englannista.  Lääkärit ja sairaanhoitajat tarjosivat tyypin 2 diabetesta tai heikentynyttä glukoositoleranssia (IGT) sairastaville potilaille vaihtoehtoisena hoitomuotona vähän hiilihydraatteja sisältävää ruokavaliota.

Tutkimuksesta poissuljettiin: raskaana olevat, syömishäiriöiset, alipainoiset, tyypin 1 diabetesta sairastavat ja alle 18-vuotiaat. Tietoja kerättiin maliskuusta 2013 marraskuuhun 2018.

Ruokavalio-kokeeseen osallistuneille annettiin kirjalliset ohjeet ja lisätukea potilaan valinnasta ja kliinisestä tarpeesta riippuen.  Kokeeseen valikoitui monenkirjava joukko eri ikäisiä ja erilaisissa elämäntilanteissa eläviä ihmisiä.  Lääkärin ja sairaanhoitajan tapaamisten lisäksi kokeeseen osallistuville tarjottiin säännöllisiä 90 minuutin ”ryhmäistuntoja” lähes kuukausittain.

Ryhmäistuntoihin osallistui myös perheenjäseniä. Kohorttiin valikoitui 154 osallistujaa: 90 miestä ja 64 naista. Kunkin potilaan paino, verenpaine ja verenkuva tutkittiin ennen tutkimuksen alkua. 89 oli tyypin 2 diabetes. Kokeeseen osallistuvien ikähajonta oli 40-89 ja ryhmän keski-ikä 63 vuotta tutkimuksen alkaessa. Useimmat seurantaan osallistuvista olivat ylipainoisia (keskimääräinen painoindeksi 34).

Alkutiedot Lähtötason mittauksiin sisältyivät seuraavat: Paino, verenpaine, kokonaiskolesteroli, HDL-kolesteroli, paaston triglyseriditasot ja verenpainetaudit. Kaikki mittaukset kerättiin käyttämällä Yhdistyneen kuningaskunnan kansallisen terveyspalvelun standardilaitteita ja laboratorioanalyysejä.

Tutkittavia ohjeistettiin vähentämään merkittävästi ruokavalion sisältämiä piilosokereita ja tärkkelyspitoisia elintarvikkeita, kuten perunoita, leipää ja riisiä. Ohjeistuksessa käytettiin apuna tutkimusta varten kehitettyä sokeriekvivalenttijärjestelmää, joka edustaa erilaisten elintarvikkeiden glykeemistä kuormaa.

Esimerkiksi pieni viipale leipää aiheuttaa vastaavan verensokerin nousun kuin kolme teelusikallista sokeria, ja 150 g keitettyä riisiä nostaa verensokeria saman verran kuin kymmenen teelusikallista sokeria.  Sokeriekvivalenttijärjestelmän avulla potilaat ymmärsivät, että esimerkiksi maissihiutaleista, paahtoleivästä ja mehusta muodostuva aamiainen on käytännössä sokeria.

Tulokset

Kahden vuoden tutkimuksen aikana tutkittavien potilaiden verenpaine, paino ja lipidiprofiilit paranivat selvästi ketogeenisellä ruokavaliolla.

Tutkimus osoitti, että hiilihydraattien rajoittaminen on turvallinen ja tehokas tapa hoitaa tyypin 2 diabeteksen oireita.


Yhteenveto

Ketogeenisen ruokavalion vaaroja liioitellaan. Todennäköisesti näin tehdään, koska keto-dieetti ei mahdu perinteisiin oppeihin hyvästä ja terveellisestä ruokavaliosta.

Tutkimuksia ketogeenisen ruokavalion terveyshyödyistä julkaistaan kiihtyvään tahtiin ja yhä useammat lääketieteen ammattilaiset ovat ottaneet ketogeenisen ruokavalion osaksi lihavuutta, verenpainetautia, metabolista oireyhtymää, tyypin 2 diabetesta jne. sairastavien potilaiden hoitosuunnitelmaa.

Ketogeeninen ruokavalio pitää verensokerin ja veren insuliinipitoisuuden tasaisena. Korkea verensokeri ja korkea insuliini assosioituvat  kardiometabolisiin ja kroonisiin sairauksiin, kuten tyypin 2 diabetekseen. Ketogeeninen ruokavalio on paras tapa hoitaa insuliiniresistenssiä, joka on monien sairauksien perussyy. Ruokavalio hillitsee oksidatiivista stressiä ja inflammaatiota, jotka assosioituvat lukemattomiin kroonisiin sairauksiin.

Kansainvälisesti yhä suurempi joukko lääketieteen ammattilaisia ja ketogeeniseen ruokavalioon syvällisesti perehtyneitä ravintoterapeutteja, insinöörejä ja nörttejä luennoi ja kirjoittaa ketogeenisen ruokavalion hyödyistä.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6695889/

https://en.wikipedia.org/wiki/Insulin_resistance

https://www.sciencedirect.com/science/article/pii/S0085253815301745

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6359196/

https://lipidworld.biomedcentral.com/articles/10.1186/s12944-019-1035-2

https://www.ncbi.nlm.nih.gov/pubmed/28193599

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664869/

 




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Onnellista alkanutta vuotta kaikille vielä kerran ja viivästyneesti! Oma vointini on jo ihan kakskyt-kakskyt. Ehkä edessämme on paras vuosikymmen ikinä tai sitten kiinalainen korona pelaa meidät pandemiaan. Maailmanlopun kelloa on jälleen siirretty eteenpäin. Enää on vain 100 sekuntia keskiyöhön. Jatkan yksinäistä sokereiden vastaista ketoiluhömppää artikkelissa: Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Mutkaton 6:1-ketoiluni on tuottanut toivottuja tuloksia ja voin hieman paukutella henkseleitäni. Viiden viikon aikana painoni putosi tuskattomasti 5-6 kiloa. Seitsemännellä viikolla paino käväisi ujonoloisesti 85 kilossa, mutta otin sitten menetettyjä kiloja varovasti takaisin erilaisten tekosyiden varjolla. Se onnistui helposti hampurilaisilla ja oluella.

Vointini on pysynyt energisenä, eikä nälkä ole juuri vaivannut. Sehän se ongelma lienee; uskon nälän parantavaan voimaan. Syön ehkä vieläkin liikaa, vaikka luulen, että tehostuneen rasva-aineenvaihdunnan ohella myös päivittäinen kokonaisenergian saantini on ketoillen laskenut.

Oli painon putoamisen syy mikä tahansa, ketogeeninen ruokavalio toimii omalla kohdallani mainiosti. Jännää on, että en kaipaa perunoita, pastaa, leipää ja sokereita enää lainkaan. Ajatus esimerkiksi karkkien tai vaalean leivän syönnistä tuntuu melkeinpä vastenmieliseltä. Tai tuntui, kun kirjoitin nuo sanat. Tänään ahmin karkkia koko alkaneen vuoden edestä. Hyi minua!


Sokerina pohjalla:

Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Anahad O’Connor kirjoitti 12.9.2016 New York Times -lehdessä sokeriteollisuuden toteuttamasta suuresta vedätyksestä 1960-luvulla. En tiedä saiko tämä uutinen ansaitsemaansa näkyvyyttä suomalaisissa uutismedioissa, joten uutisoidaan tämä viiveellä Ruokasodassa.

Sokeriteollisuuden rahoittama härski pseudotutkimus on vaikuttanut ravintotieteisiin ja ravintosuosituksiin jo 50 vuotta ja vaikuttaa yhä. Se on vakava aihe, vaikkakaan ei yllättävä, eikä ehkä uutinenkaan.

Kaikkien aikojen huijaustilastoissa sokeriteollisuuden huijaus yltää neljännelle sijalle. Edelle menee kuuhuijaus, tai se kun amerikkalaiset päättivät lavastaa kuukäynnin, mutta se tuli niin kalliiksi, että he kuvasivat kuuhuijauksen kuussa ja huijasivat vain lavastuksen. Se oli yllättävän ovelaa.

Ei oikeasti! Se on hölmö juttu, mutta kuulostaa hauskalta. Sokeriteollisuuden vedätys jää vain hieman jälkeen öljyteollisuuden huijauksesta ja tupakkateollisuuden katalista toimista. Ne ovat vahvasti todennettuja faktuaalisia tapahtumasarjoja.

Tämän kupletin viheliäinen juoni on se, että sokeriteollisuus maksoi löytyneiden dokumenttien valossa kolmelle Harvardin tutkijalle tutkimuksesta, joissa valkopestiin sokerin ja sydäntautien välinen yhteys. Tämän ei pitäisi yllättää, sillä myös sokereiden ja syöpien yhteydestä haluttiin vaieta. Sen tarinan voit lukea tästä.

Samassa tutkimuksessa epäily sydän- ja verisuonitautien ravitsemuksellisesta syystä vieritettiin tyydyttyneille (koville) eläinrasvoille. Ensimmäiset amerikkalaiset ravitsemussuositukset laadittiin sokeriteollisuudessa kannuksensa ansainneen tohtori Hegstedin suosituksesta rasvavastaisiksi ja sokereita suosiviksi jo 1970-luvulla.

Nämä yhdysvaltalaiset ravitsemussuositukset levisivät ympäri maailman ja lopulta myös Suomeen. Mikä vaikutus huijauksella on ollut lihavuus- ja diabetesepidemioihin? Suoraa kausaalisuhdetta tuskin voidaan osoittaa, mutta korrelaatio on selvä: rasvan rajoittamisen ja sokereiden suosimisen seurauksena aikuistyypin diabetes ja lihavuus kääntyivät selvään kasvuun.

”Se, että sokerin terveyshaittoja vähäteltiin ja rasvojen haittoja liioiteltiin vuosikymmeniä, on suurella todennäköisyydellä vaikuttanut nykyisiin lihavuus- ja diabetesepidemioihin, kertoo Sanjay Basu Stanfordin yliopistosta. Lihavuus ja diabetes yleistyivät vähärasvaisten ja rasvattomien tuotteiden kulutuksen seurauksena.”


Tutkijat salapoliiseina

Tämä tieteellinen huijaus paljastui Kalifornian yliopiston tutkijan esiin kaivamista sokeriteollisuuden dokumenteista. Löydöstä on raportoinut mm. arvostettu lääketieteellinen julkaisu JAMA.

Keskustelu sokerin mahdollista terveyshaitoista vaiennettiin vuosikymmeniksi, kertoo eräs JAMAn julkaiseman raportin tekijöistä, professori Stanton Glantz (Kalifornian yliopisto).

Löydetyt dokumentit todistavat, että Sugar Research Foundation -niminen sokeriteollisuuden järjestö (nykyään Sugar Association), maksoi kolmelle Harvardin tutkijalle nykyrahassa 49 000 dollaria vastaavan summan sokeria, rasvoja ja sydäntauteja käsittelevän tutkimuksen julkaisemisesta 1967.

Sokeriteollisuuden rahoittama tutkimus ohjattiin sokereita suosivaksi

Sugar Research Foundation määritteli tutkijoille ennalta valitun sokerin terveysriskejä vähättelevän tutkimusmateriaalin. Sen lisäksi sokeriteollisuuden johtajat tarkistivat tutkimuksen ennen sen julkaisemista. Sokereiden terveysriskejä vähättelevä ja eläinrasvojen haittoja korostava artikkeli julkaistiin arvovaltaisessa lääketieteellisessä julkaisussa (New England Journal of Medicine).

Sokeriteollisuuden suuresta huijauksesta on vierähtänyt vuosikymmeniä, mutta sama meno jatkuu yhä. Ruokateollisuus rahoittaa ja ohjaa ravitsemusta käsitteleviä tutkimuksia.

2015 New York Times kertoi, että Coca-Cola Company on rahoittanut miljoonilla dollareilla tutkijoita ja tutkimuksia, joissa pyritään kumoamaan sokeria sisältävien juomien ja lihavuuden välinen yhteys. 2016 kesäkuussa AP (Associated Press) kertoi, että makeisvalmistajat rahoittavat tutkimuksia, joiden mukaan makeisia syövät lapset ovat terveempiä ja laihempia kuin lapset, jotka eivät syö makeisia. Tällaisen ei pitäisi hämmästyttää enää tässä totuudenjälkeisessä maailmassa, mutta on se aika härskiä ja järkyttävää toimintaa. Teollisuuden ahneus on ainoa asia, johon enää voi uskoa.

Huijaukseen osallistuneet Harvardin tutkijat ja sokeriteollisuuden johtajat ovat jo kuolleet. Eräs sokeriteollisuudelta rahaa saanut tutkija oli tohtori Mark Hegsted, joka myöhemmin nousi Yhdysvaltojen maatalousministeriön ravitsemusasioiden johtajaksi ja oli laatimassa ensimmäisiä ravitsemussuosituksia 1977. Toinen sokeriteollisuudelta rahaa saanut tutkija oli tohtori Fredrick J. Stare, Harvardin yliopiston ravitsemustieteellisen tiedekunnan johtaja.

Mitäpä sokeri vastasi?

Sugar Association vastasi JAMA:n julkaisemaan raporttiin toteamalla, että vuoden 1967 raportti julkaistiin aikana, jolloin lääketieteellisissä lehdissä ei edellytetty tutkimusten rahoittajien paljastamista. New England Journal of Medicine aloitti tieteellisten raporttien rahoittajien ilmoittamisen vasta vuonna 1984.

Sugar Association myönsi, että avoimuus ja läpinäkyvyys tutkimustoiminnan rahoittajien osalta olisi ollut aiheellista, mutta puolusti julkaistun tutkimuksen tärkeää ja informatiivista roolia tieteellisessä keskustelussa. Sokeriteollisuus painotti vastauksessaan, että vuosikymmenten tutkimukset eivät ole osoittaneet merkittävää korrelaatiota sokerin ja sydäntautien väliltä, toisin kuin American Heart Association ja World Health Organization uskovat.

Tausta

Sota tyydyttyneiden rasvojen ja sokerin terveyshaitoista on jatkunut vuosikymmeniä. Rasvasodan käynnisti Ancel Keysin myöhemmin kyseenalaistetut tutkimukset kovien rasvojen yhteydestä valtimonkovettumatautiin eli ateroskleroosiin. John Yudkin varoitteli sokereiden terveyshaitoista jo 1970-luvulla, mutta hänet leimattiin naurettavaksi pelleksi.

Keskustelu sokereiden ja tyydyttyneiden rasvojen haitoista jatkuu edelleen yhtä aiheellisena kuin 1970-luvulla. Vuosikymmenien ajan ravitsemussuosituksissa on kehotettu välttämään rasvaa ja erityisesti kovia rasvoja. 1970-luvulla alkanut vähärasvaisuutta suosiva buumi johti siihen, että rasvoja korvattiin elintarvikkeissa lisätyillä sokereilla. Monien tutkijoiden ja maallikoiden, kuten allekirjoittaneen, mielestä tämä on tärkein syy aikuistyypin diabeteksen ja ylipainon räjähdysmäiseen kasvuun.

Huijaus toimi – yllättääkö se?

Sokeriteollisuuden kannalta suunnitelma toimi erinomaisesti: huomio sokereiden mahdollisista terveyshaitoista unohdettiin käytännössä kokonaan. Arvostetussa julkaisussa raportoitu tutkimusraportti sai merkittävän näkyvyyden tieteellisessä yhteisössä.

Tohtori Hegsted käytti tutkimusraporttia vakuuttaakseen terveysviranomaiset tyydyttyneiden rasvojen haitoista sydän- ja verisuoniterveydelle. Sokereiden haitoista ei juuri puhuttu muuten kuin tyhjinä kaloreina, jotka saattavat pahimmillaan vahingoittaa hampaita.

Hegstedin raportti toimii yhä yleisimpien ravitsemussuositusten perustana, vaikka Amerikan sydänliitto (AHA) ja Maailman terveysjärjestö (WHO) ovat osoittaneet myös lisätyn sokerin kasvattavan sydän- ja verisuonitautien riskiä. Hölmöksi leimattu Yudkin oli siis oikeassa jo 1970-luvulla.

New Yorkin yliopiston ravitsemuksen, ruokatutkimuksen ja kansanterveyden professori Marion Nestle kirjoitti JAMA:n julkaiseman tutkimusraportin liitteessä, että löydetyt asiakirjat todistavat vakuuttavasti sokeriteollisuuden pyrkimyksestä valkopestä sokereiden rooli sydän- ja verisuonitautien riskitekijänä.

Tohtori Walter Willett, Harvardin TH Chanin kansanterveydenlaitoksen ravitsemusosaston puheenjohtaja, totesi, että akateemiset eturistiriitasäädökset ovat muuttuneet merkittävästi 1960-luvulta lähtien. Hänen mukaansa löydetyt dokumentit ovat tärkeä osoitus siitä, miksi tieteellistä tutkimusta tulisi tukea julkisella rahoituksella sen sijaan, että rahoitus on teollisuuden varassa.

Tohtori Willett lisäsi, että tutkijoilla oli vain rajoitetusti tietoa sokereiden ja rasvojen suhteellisten riskien arvioimiseksi. Tuoreet tutkimukset ovat osoittaneet, että puhdistetut hiilihydraatit ja erityisesti sokeroidut juomat ovat mm. sydän- ja verisuonitautien, lihavuuden ja aikuistyypin diabeteksen riskitekijöitä, mutta myös ravinnosta saatujen rasvojen laatu vaikuttaa sydän- ja verisuonitautien riskiin.

JAMA perusti artikkelinsa tuhansiin sivuihin kirjeenvaihtoa ja muita asiakirjoja, jotka tutkijatohtori Christin E. Kearns löysin Harvardin ja Illinoisin yliopistojen kirjastojen arkistoista. Löydettyjen asiakirjojen mukaan sokeriteollisuuden ylin johtaja John Hickson keskusteli vuonna 1964 muiden sokeriteollisuuden johtajien kanssa suunnitelmasta, jossa yleiseen mielipiteeseen vaikutettaisiin tutkimuksella, tiedotuksella ja lainsäädännöllisin keinoin. Samoja menetelmiä on onnistuneesti soveltanut tupakka- ja öljyteollisuus.

Imperiumin vastaisku

Tutkimukset olivat jo 60-luvulla havainneet merkittävän korrelaation runsaasti sokeria sisältävän ravinnon ja sydänsairauksien väliltä. Samaan aikaan muut tutkijat, kuten Ancel Keys, tutkivat oletusta, jonka mukaan sydänsairauksien riskiä kasvatti ensisijaisesti tyydyttyneet rasvat ja ravinnon sisältämä kolesteroli.

Hicksonin mukaan sokeriteollisuutta huolestuttaviin tutkimuksiin oli vastattava sokeriteollisuuden omalla tutkimuksella, joka kumoaa sokeriin liitetyt negatiiviset terveysväittämät.  Vuonna 1965 Hickson pyysi Harvardin tutkijoita kirjoittamaan raportin, joka kumoaa sokerin terveyshaittoja käsittelevät tutkimukset. Tutkijoille maksettiin 6500 dollaria, joka nykyrahassa vastaa 49 000 dollaria. Hickson valitsi tutkijoille lähdeaineiston ja teki selväksi, että tutkimuksen tulosten pitää suosia sokeria.

Kirjeenvaihdon perusteella Harvardissa työskennellyt tohtori Hegsted vastasi sokeriteollisuuden johtajille: ”Ymmärrämme ongelman ja teemme parhaamme sen korjaamiseksi”. Tutkijat esittelivät tutkimusluonnoksen Hicksonille, joka kertoi olevansa siihen erittäin tyytyväinen. Harvardin tutkijat sivuuttivat tutkimuksessa sokerin terveyshaittoihin viittaavat tiedot ja painottivat tyydyttyneiden rasvojen ja valtimonkovettumataudin välistä yhteyttä.

Tutkimuksen julkaisemisen jälkeen keskustelu sokerin ja sydäntautien välillä vaiettiin kuoliaaksi. Samalla monet terveysviranomaiset hyväksyivät ”terveelliset” vähärasvaisuutta korostavat ruokavaliot.

Nonni. Tämä nyt on tätä. Jos se ei ole totta, niin ainakin se on hyvä tarina!

https://www.nytimes.com/2016/09/13/well/eat/how-the-sugar-industry-shifted-blame-to-fat.html

https://academic.oup.com/ajcn/advance-article/doi/10.1093/ajcn/nqz276/5680464?guestAccessKey=e676e010-0638-423b-a731-6c760b460bd4

https://www.stmichaelshospital.com/media/detail.php?source=hospital_news/2019/1230

https://jamanetwork.com/journals/jamainternalmedicine/article-abstract/2548255




Ketoherkut: Kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatti

Juu. Tiedetään. Ketoilu on hidas itsemurha. Ketoilijan päivän salaattina esittelen ihanan ja täydellisen kaikkea-mitä-kaapista-löytyy-joulun-jälkeen-salaatin. Bon Appetit!

Raaka-aineet:

Kylmäsavugraavilohi (n. 100 g jäi joulusta)
Tonnikala öljyssä (purkki)
Aurinkokuivatut tomaatit (kourallinen siivutettuina)
Marinoituja latva-artisokkia (kourallinen siivutettuina)
Kalamata-oliiveja (kourallinen puolikkaina)
Fetaa (n. 100 g kuutioituna)
Cosmopolitan-salaattia (aika paljon ja maun mukaan)
Eri värisiä kirsikkatomaatteja (n. 200 g puolikkaina)
Paprikaa (ohuina suikaleina yksi riittänee)
Kesäkurpitsaa (noin 15 cm pätkä)
Sipuli (pieneksi hienonnettuna)
Puolikkaan sitruunan mehu
Kreikkalainen jogurtti (pari runsasta ruokalusikallista)

Oma currymajoneesi

1 muna
2,5 dl öljyä
1 tl suolaa, mustapippuria ja valkosipulijauhetta
2-4 tl curryjauhetta
Korkillinen roseviinietikkaa tai etikkaa
1-2 rkl kreikkalaista jogurttia

Leikkasin raaka-aineet sopivan kokoisiksi siivuiksi isoon kulhoon. Puristin päälle puolikkaan sitruunan mehun ja lisäsin pari reilua ruokalusikallista kreikkalaista jogurttia. Majoneesin olin tehnyt aiemmin.

Helpoin tapa tehdä mahtavaa majoneesia on lisätä 2,5 dl rypsiöljyä ja 1 muna korkeaan ja kapeaan astiaan. Päälle lisätään korkillinen roseviinietikkaa tai etikkaa sekä muut mausteet. Annetaan seisoa lämpimässä 10-20 minuuttia. Asetetaan sauvasekoitin kapean astian pohjaan, käynnistetään ja nostetaan sauvasekoitinta hitaasti noin 10 sekunnin aikana ylöspäin. Jos käy niin ikävästi, että majoneesi juoksettuu, sen voi korjata lisäämällä yhden munan öljyyn ja sauvasekoittamalla uudestaan. Kun majoneesi valmistuu, siihen voi lisätä 1-2 rkl kreikkalaista jogurttia, joka tekee siitä hieman pehmeämmän.

Kruunasin salaatin currymajoneesilla ja sekoitin. Annoin salaatin makuuntua jääkaapissa tunnin verran. Tämä oli paras salaatti ikinä. Onnellista alkavaa vuotta kaikille!




Salaperäiset sirtuiinit

Salaperäiset sirtuiinit tehostavat solujen aineenvaihduntaa, hidastavat ikääntymistä, säätelevät geenien aktiivisuutta ja suojaavat aivoja. Mutta mitä sirtuiinit ovat ja miten ne vaikuttavat aineenvaihduntaan?

”Jo 1930-luvulta asti on tiedetty, että energiarajoitus pidentää jyrsijöiden elinikää. Nimenomaan energiamäärä (noin 60-70 % normaalista) eikä energian lähde näyttää tässä suhteessa olevan ratkaiseva tekijä. Energiamäärän vähentäminen saa aikaan kehon lämpötilan laskun sekä glukoosi- ja insuliinipitoisuuden, painon ja rasvamäärän vähenemisen (Guarente ja Picard 2005). Vähäinen energiansaanti tekee eläimet resistentiksi ulkoisille stressitekijöille, kuten oksidatiiviselle stressille. Tämä on tärkeä sopeutumismekanismi, sillä ikääntymisen uskotaan liittyvän ROS:n (reactive oxygen species) muodostukseen.”- Professori Markku Laakso / Duodecim


Johdanto

Nyt syntyviä sukupolvia odottavat ilmastonmuutoksen, hallitsemattoman väestönkasvun ja taloudellisesti yhä selvemmin jakaantuneen maailman asettamat haasteet.

Toisaalta lääketieteellinen kehitys ja ymmärrys geenien toiminnasta lupaa tuleville sukupolville pitkää ja tervettä elämää. Eräs mullistavimmista lääketieteellisistä keksinnöistä viime vuosina on ollut CRISPR-Cas-9 geenisakset, joilla DNA:sta voidaan leikata viallisia jaksoja ja korvata ne terveillä jaksoilla. Samaan aikaan ymmärrys ikääntymisestä ja siihen vaikuttavista aineenvaihduntamekanismeista on täsmentynyt.

Salaperäiset sirtuiinit ohjaavat ja tehostavat solujen rasva-aineenvaihduntaa silloin kun glukoosin saanti on vähäistä. Niukka energiansaanti käynnistää aineenvaihdunnan luonnollisen sopeutumismekanismin, johon osallistuu SIRT1-geeni. Sirtuiinit ovat NAD+ -riippuvaisia solujen apoptoosia, tulehdusvastetta, solujen elämänkaarta, geenitranskriptiota ja aineenvaihduntaa sääteleviä proteiiniasetylaaseja.



NAD+ eli nikotiiniamidiadeniinidinukleotidi ja proteiiniasetylaasit

Molekyylibiologiaan harjaannuttamattoman silmissä nämä sanat ovat silkkaa hepreaa. Mitä ne tarkoittavat ja mitä helvettiä ne meille tekevät? Vaikeilla sanoilla on miltei maagisia tarkoituksia. Mitä koentsyymit, kofaktorit ja entsyymit ovat?

NAD+ on kaikissa elävissä soluissa esiintyvä koentsyymi. Koentsyymit (tai kofaktorit) ovat orgaanisia molekyylejä tai epäorgaanisia metalli-ioneja, joka entsyymin on sidottava itseensä toimiakseen kemiallisia reaktioita katalysoivana entsyyminä.

Monet koentsyymeistä ovat vitamiineja, osa metalleja, kuten kofaktori-ionit Mn2+, Mg2+ ja Zn2+. Entsyymi, johon ei ole sitoutunut sen luontaista kofaktoria tai kofaktoreita on toimimaton apoentsyymi. Koentsyymi muodostaa entsyymin proteiiniosan eli apoentsyymin kanssa toimivan entsyymin.

Epäorgaanisia kofaktoreita ovat mm. ravinnosta saatavat metalli-ionit Cu2+, Fe2+ tai Fe3+, K+, Mg2+. Arvaatte varmaan, että näitä on paljon enemmän, mutta eiköhän pointti selvinnyt.

Nämä epäorgaaniset kofaktorit muodostavat apoentsyymien kanssa entsyymejä, kuten: sytokromi-c-oksidaasin, katalaasin, peroksidaasin, pyryvaattikinaasin, heksokinaasin ja glukoosi-6-fosfataasin.

Monet orgaanisista koentsyymeistä ovat vitamiineja tai niiden johdannaisia, kuten biosytiini, koentsyymi A, 5’-deoksiadenosyylikobolamiini, flaviiniadeniinidinukleotidi, lipoaatti, NADH/NAD+, pyriokdaalifosfaatti jne. Näiden koentsyymien esiasteet ovat vitamiineja, kuten biotiini (B7), pantoteenihappo(B5), B12, riboflaviini (B2), niasiini (B3), B6, folaatti (B9) ja tiamiini (B1).

Entsyymit ovat kemiallisia aineenvaihduntareaktioita nopeuttavia biologisia katalyytteja. Ne ovat yleensä proteiineja, mutta myös RNA-molekyylit eli ribotsyymit voivat olla entsyymejä. Entsyymien vaikutus perustuu niiden kykyyn alentaa substraattiin kohdistuvan reaktion aktivaatioenergiaa. Ilman entsyymejä kemialliset reaktiot tapahtuisivat soluissa liian hitaasti, eikä elämä olisi mahdollista. Nopeimmat entsyymit muuttavat jopa 40 miljoonaa molekyyliä reaktiotuotteiksi sekunnissa.


NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa biologisissa hapetus-pelkistysreaktioissa.

Nikotiiniamidiadeniinidinukeotidi muistuttaa kemialliselta rakenteeltaan toista tärkeää koentsyymiä, nikotiiniamidiadeniinidinukleodifosfaattia (NADP+). NAD+ osallistuu katabolisiin aineenvaihduntareaktioihin ja NADP+ on tärkeä koentsyymi anabolisissa reaktioissa.

Kataboliset aineenvaihduntareaktiot pilkkovat monimutkaisia molekyylejä yksinkertaisemmiksi ja anaboliset aineenvaihduntareaktiot rakentavat yksinkertaisemmista molekyyleistä suurempia ja monimutkaisempia molekyylirakenteita.

Eliöt tuottavat NAD+:a kahdella tavalla:

1. Geenien säätelemässä de novo-synteesissä tryptofaanista (aminohappo) syntetisoidaan ensin kinoliinihappoa, joka muutetaan nikotiinihappomononukleotidiksi ja edelleen nikotinaattinukleotidiadenyylitransferaasientsyymin avulla desamino- NAD+:ksi.
NAD+ syntaasientsyymi muuttaa desamino- NAD+:n nikotiiniamidiadeniinidinukleotidiksi.

2. NAD+-biosynteesiä tapahtuu myös nikotiiniamidista, joka prosessoidaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

Proteiiniasetylaasit ovat asetyyliryhmään kiinnittyviä proteiineja. Deasetylaasit poistavat osia asetyyliryhmästä. Nisäkkäillä tunnetaan seitsemän erilaista ja erilaisiin reaktioihin osallistuvaa sirtuiinia. Esimerkiksi SIRT1-3 ja SIRT5 ovat deasetylaaseja. Solun tumassa on SIRT1:tä, SIRT6:ta ja SIRT7:ää. Mitokondrioissa on puolestaan SIRT3-5:tä ja solulimassa SIRT2:ta.

Mitä ne sirtuiinit siellä soluissa tekevät?

SIRT1 säätelee aineenvaihduntaa ja solujen elinkaarta
SIRT2 ja SIRT6 saattavat vaikuttaa kasvaimien kehittymiseen ja syöpään
SIRT3 ja SIRT4 osallistuvan aineenvaihdunnan säätelyyn
SIRT4 liittyy aminohappovälitteiseen insuliinin eritykseen

SIRT1 vaikuttaa erityisesti energia-aineenvaihdunnan kannalta keskeisissä kudoksissa, kuten haimassa, maksassa ja rasvakudoksessa. SIRT1:n aktivoituminen lisää insuliiniherkkyyttä ja laskee glukoosi- ja insuliinipitoisuuksia.

Koska SIRT1 on PPAR*-estäjä (*peroxisome proliferator-activated receptor), se kiihdyttää rasvakudoksen lipolyysiä vapauttamalla rasvakudoksiin varastoituja rasvahappoja verenkiertoon.


Lipolyysi vs. lipogeneesi

Lipolyysi pilkkoo rasvasoluihin varastoituja triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu verenkierron mukana maksaan, ja rasvahapot energialähteiksi luurankolihaksille, maksalle ja sydämelle.

Lipolyysi aktivoituu paaston ja vähän hiilihydraatteja sisältävän ruokavalion yhteydessä hormonaalisesti lipolyyttisten hormonien: glukagonin, kortikotropiinin, adrenaliinin ja noradrenaliinin vaikutuksesta.

Lipolyysin tarkoitus on säästää glukoosia punasoluille ja hermosoluille, jotka eivät pysty käyttämään rasvahappoja energiantuotannossa. Lipolyysille vastakkainen aineenvaihduntareaktio on lipogeneesi, joka prosessoi ja varastoi ylimääräisiä sokereita rasvahapoiksi.

Insuliini osallistuu ravinnon soluun pääsyyn sekä ravinteiden varastoimiseen lihas-, maksa- ja rasvasoluihin. Glukagoni ja muut lipolyyttiset hormonit purkavat solujen sokeri- ja rasvavarastoja verenkiertoon, jolloin niitä voidaan käyttää solujen energiantuotannossa.

Lipolyysiä ohjaa lipaasi. Kun haima erittää vereen insuliinia, lipolyysi estyy. Rasvakudos on herkkä insuliinin säätelylle. Kun veren insuliinipitoisuus laskee, lipolyyttiset hormonit ohjaavat lipaasin toimintaa. Tämä käynnistää lipolyysin ja rasvahappoja vapautuu rasvasoluista vereen.

Veren mukana soluihin kulkeutuneista rasvahapoista tuotetaan beetaoksidaatiossa asetyylikoentsyymi-A:ta, joka on kaikille energiaravinteille yhteinen väliaine sitruunahappokierrossa. Asetyylikoentsyymi-A voi jatkaa solujen energiantuotantoa mitokondrioissa tapahtuvassa sitruunahappokierrossa, jos glukoneogeneesi ei ole käynnissä.

Kun SIRT1 aktivoituu, insuliinin eritys haimasta lisääntyy. SIRT1myös suojaa haiman beetasoluja oksidatiiviselta stressiltä.

PCG-1:n*-aktivoituminen (*peroxisome proliferator-activated receptor gamma coactivator-1) lisää glukoosin syntetisoimista maksassa osana SIRT1-aktivaatiota. PCG-1 kasvattaa mitokondrioiden määrää ja kokoa sekä kiihdyttää rasvahappojen hapettumista beetaoksidaatiossa. Nämä tekijät yhdessä vaikuttavat suotuisasti glukoosin aineenvaihduntaan.

SIRT1 suojaa keskushermoston soluja neurodegeneratiivisilta prosesseilta. Punaviinin, mustikoiden, viinimarjojen ja karpaloiden sisältämä fenoliyhdiste resveratroli on SIRT1-aktivaattori, joka lisää PCG-1-aktivaatiota. Tämä on tutkimuksissa tehostanut mitokondrioiden toimintaa, energiankulutusta ja hapenottokykyä. Se voi lisätä myös solujen insuliiniherkkyyttä ja laskea rasvamaksaan sairastumisen riskiä.

Resveratroli on eläinkokeissa suojannut runsaasti energiaa ravinnosta saavia hiiriä lihomiselta estämällä PPAR:n* (*peroxisome proliferator-activated receptor) aktivaation. SIRT1 voi vaikuttaa suotuisasti aikuistyypin diabetekseen, sillä se lisää solujen insuliiniherkkyyttä ja haiman insuliinin eritystä, sekä laskee painoa ja kehoon varastoituneen rasvan määrää.

Yhteenveto

SIRT1 (Silent Information Regulator 1) osallistuu useisiin aineenvaihduntaprosesseihin ja energia-aineenvaihdunnan säätelyyn. SIRT1 vaikuttaa lihavuuteen ja aikuistyypin diabetekseen säätelemällä rasvojen aineenvaihduntaa ja mitokondrioiden biogeneesiä.

Sirtuiinien hermoja ja aivosoluja suojaava vaikutus perustuu toisaalta SIRT1:n oksidatiivista stressiä vähentävään vaikutukseen ja toisaalta SIRT1:n kykyyn vähentää tulehdusvastetta sitoutumalla NF-kB*:en (Nuclear Factor-kappaB) ja siten ehkäistä hermosoluissa tapahtuvaa neurodegeneraatiota ja atrofiaa.


NF-kB


Hiirikokeissa sekä akuutit, että pitemmän ajan kuluessa syntyvät hermosoluvauriot johtavat lähes aina aivojen mikrogliasolujen aktivaatioon. M1-tyypin mikrogliat erittävät tulehdusta edistäviä sytokiineja, jotka lisäävät osaltaan hermosolujen atrofiaa, kun taas M2-tyypin solut poistavat kuolleita soluja ja erittävät vaurioituneisiin hermoston osiin erilaisia kasvutekijöitä.

Keskeisenä tulehdusreaktioiden välittäjänä toimii transkriptiotekijä, tumatekijä kappaB (NF-kB) ja erityisesti sen p50/105-alayksikkö. Hiirikokeissa havaittiin, että NF-kB p50/105-alayksiköllä on merkittävä rooli aivojen tulehdusreaktioiden välittäjänä ja sitä kautta aivojen uusien hermosolujen muodostumisessa. NF-kB p50/105-alayksikön puuttumisen vaikutus vaihtelee eri tautimalleissa ja eri ikäisillä hiirillä.  (Taisia Rõlova)

”Tulehdus on immuunijärjestelmän aikaansaama reaktio, jonka avulla elimistö pyrkii vastaamaan infektioon tai kudosvaurioon ja korjaamaan sen. Matala-asteinen krooninen tulehdus on häiriötila, joka voi ylläpitää tulehdusvasteita kudoksissa aineenvaihdunnan muutosten kautta ja johtaa edelleen kudosvaurioihin sekä altistaa monille sairauksille, kuten astmalle, Alzheimerin taudille, sydän- ja verisuonitaudeille ja erilaisille syöville.”- Anu Wiklund

VIDEO


OSA 1: Energia-aineenvaihdunnan perusteet


Evoluution seurauksena ihmiselle on kehittynyt tehokkaita selviytymismekanismeja toisaalta adaptiivisen immuunijärjestelmän kautta erilaisia taudinaiheuttajia vastaan, ja toisaalta turvaamaan välttämättömät elintoiminnot silloinkin, kun ravintoa ei ole riittävästi saatavilla.

Terve nuori aikuinen selviää pelkällä vedellä kolmisenkymmentä vuorokautta. Aineenvaihdunta käyttää energianlähteenä ensimmäiseksi elimistön sokeri- ja rasvavarastot, mutta ravinnonpuutteen jatkuessa myös lihasten proteiineja käytetään energian lähteenä välttämättömien elintoimintojen turvaamiseksi.

Nykyinen yltäkylläisyys ja ravinnon helppo saatavuus on uusi ilmiö. Meille ruoka ja sen vaivaton saatavuus on itsestäänselvyys, mutta kaukaiset esivanhempamme joutuivat elämään pitkiäkin aikoja hyvin niukalla ravinnolla tai kokonaan ilman ruokaa.

Varhaiset ihmiset söivät silloin, kun ravintoa oli tarjolla ja paastosivat, kun ruokaa ei ollut. Ravinnosta saatu ylimääräinen energia varastoitiin rasva- ja lihassoluihin. Lihominen auttoi ihmisiä selviämään niukoista ajoista.

Toisaalta ravinnon saatavuuden epävarmuus on ilmeisesti vaikuttanut erilaisten biologisten selviytymismekanismien kehittymisen lisäksi eräänlaisen psykologisen selviytymismoodin syntymiseen. Nälkäinen ihminen valpastuu, aistit tarkentuvat, keskittymiskyky paranee, ympäristön hahmottaminen tehostuu, päätöksenteko nopeutuu jne. Tälle on biokemialliset ja hormonaaliset syyt. Väitän, että hieman nälkäinen ihminen on älyllisesti ja fyysisesti parhaimmillaan. Se on asia, josta toki voi kiistellä.

Sokeria vai rasvaa? Kuinka solut saavat energiaa?

Kaikki solut voivat käyttää glukoosia energianlähteenä. Solujen sytoplasmassa tapahtuva glykolyysi pilkkoo glukoosimolekyylin kahdeksi pyruvaatiksi, mikä tuottaa kaksi runsasenergistä ATP-molekyyliä. Kummastakin pyruvaatista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Aminohapot, hiilihydraatit ja rasvahapot on muutettava asetyyliryhmiksi ja liitettävä koentsyymi-A:han, jotta ne pääsevät mitokondriossa tapahtuvaan sitruunahappokiertoon. Sitruunahappokierrossa pyruvaateista saadaan vielä kolmisenkymmentä ATP-molekyyliä. Tämän soluhengityksen lopputuotteena on vettä ja hiilidioksidia.

Myös rasvaa (ja proteiineja) voidaan käyttää energian tuottamiseen. Aineenvaihdunta osaa käyttää esimerkiksi eräitä proteiineista saatavia ja vapaita aminohappoja glukoosia tuottavassa glukoneogeneesissä.

Rasvojen energia-aineenvaihdunnan perusta on beetaoksidaatio, ketoosi ja ketogeneesi. Solujen kannalta hiilihydraateista saatava glukoosi on kaikkein helpoin ja nopein energianlähde. Siihen aineenvaihduntamme on totutettu lapsesta alkaen. Rasvan ja proteiinien muuttaminen energiaksi kelpaavaan muotoon edellyttää useita aineenvaihduntareaktioita.

Lähtökohtaisesti keho suosii siis hiilihydraatteja energianlähteenä. Hiilihydraatit pilkotaan sokereiksi, jotka imeytyvät ohutsuolen epiteelin läpi verenkiertoon. Glukoosi kohottaa verensokeria ja haima reagoi glukoosipitoisuuden kasvuun erittämällä vereen insuliinia. Insuliinimolekyyli kiinnittyy solun pinnassa olevaan insuliinireseptoriin ja toimii kuin avain, joka avaa solun glukoosimolekyyleille.

Fruktoosi prosessoidaan maksassa ensisijaisesti glykogeeneiksi eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi. Nämä ovat nopeita varastosokereita. Osa fruktoosista muutetaan glukoosiksi, joka vapautuu verenkiertoon ja 1-2 % fruktoosista muutetaan triglyserideiksi.

Myös veressä oleva ylimääräinen glukoosi muutetaan mahdollisuuksien mukaan lihasten glykogeeneiksi. Glykogeenivarastojen rajallisen koon vuoksi osa glukoosista varastoidaan rasvasoluihin ja muutetaan rasvasolussa tapahtuvassa lipogeneesissä triglyserideiksi.

Veren glukoosipitoisuuden laskiessa haiman alfasolut erittävät vereen glukagonia, joka vapauttaa maksan glykogeenivarastoista glukoosia vereen ja lihasten glykogeeneistä glukoosia lihasten käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.



Entä sitten kun sokerivarastot loppuvat?


Maksan ja lihasten sokerivarastot voivat loppua paastotessa, hyvin niukkaenergisellä ruokavaliolla tai hiilihydraattien saantia rajoitettaessa. Tällöin elimistön on turvauduttava varastoimaansa energiaan eli läskiin.

Veren glukoosipitoisuuden laskun seurauksena vereen erittyy lipolyyttisiä hormoneja: glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia. Näiden vaikutuksesta elimistön rasva-aineenvaihdunta tehostuu.

Ketoaineiden tuotanto

Lipolyysi purkaa rasvasolujen triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu maksaan, jossa sitä voidaan hyödyntää mm. glukoosia syntetisoivassa glukoneogeneesissä.

Soluihin kulkeutuvat vapaat rasvahapot pilkotaan beetaoksidaatiossa asetyylikoentsyymi-A:ksi. Glukoneogeneesin yhteydessä asetyylikoentsyymi-A:ta ei voida hapettaa normaalisti mitokondrioissa, vaan ylimääräisestä asetyylikoentsyymi-A:sta muodostetaan 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-syntaasin katalysoimana 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A:ta (HMG-KoA) ja edelleen mitokondrioissa 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-lyaasin (HMG-KoA-lyaasi) katalysoimassa reaktiossa ketoaineita: asetoasetaattia ja siitä edelleen betahydroksibutyraattia ja asetonia.

Asetyylikoentsyymi-A on kaikille ravintoaineille yhteinen väliaine solun valmistaessa energiaa. Sen asetyyliryhmän hiilet hapettuvat hiilidioksidiksi sitruunahappokierrossa (Krebsin sykli) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio

Oksidatiivinen fosforylaatio on elektroninsiirtoketjusta ja ATP-syntaasista koostuva aineenvaihduntareitti. Happea käyttävien solujen ATP-energiasta noin 90 % syntyy oksidatiivisessa fosforylaatiossa eli kun ravintoaineet hapettuvat ja energia sitoutuu suurienergisiin fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio, glykolyysi ja sitruunahappokierto päättävät solun katabolisen energiantuotannon. Glykolyysissä, rasvahappojen oksidaatiossa ja trikarboksyylihappokierrossa muodostuneiden pelkistyneiden koentsyymien (NADH ja FADH2) elektronit siirtyvät oksidatiivisen fosforylaation elektroninsiirtoketjuun. Nämä elektronit pelkistävät happimolekyylit vedeksi, jolloin vapautuva energia sitoutuu ATP:nä.

Yhdestä glukoosimolekyylistä saadaan noin 30 suurienergistä ATP-molekyyliä.

Katabolisessa aineenvaihdunnassa pienimolekyyliset yhdisteet (aminohapot, monosakkaridit, rasvahapot) pilkotaan ja ”poltetaan” solujen energiaksi. Kaikkien energiaravinteiden yhteinen väliaine on asetyylikoentsyymi-A.

Asetyylikoentsyymi-A voidaan pilkkoa sitruunahappokierrossa, jossa sen hiiliatomit hapettuvat hiilidioksidiksi ja vetyatomit siirtyvät hapetus-pelkistysreaktioissa keoentsyymeille (NADH ja FADH2) Nämä siirtävät vetyä sitruunahappokierron ja elektroninsiirtoketjun välillä. Koentsyymit menettävät elektronit ja hapettuvat NAD+:ksi ja FAD:ksi, jotka jatkavat kiertoa.

Osa 2: Ketoosi ja sirtuiinit

Ketoosi kiihdyttää sirtuiinien aktivaatiota soluissa. Sirtuiinit kuuluvat histonideasetylaaseihin (HDAC). Ne ovat proteiineja, jotka poistavat asetyyliryhmän geenin histonista ja näin ”sammuttavat” geenin ilmentymisen eli ekspression.

Jokainen solu sisältää yksilön jokaisen geenin, mutta geeni ilmentyy vain tietyissä soluissa, ja joskus vain tiettyyn aikaan. Sammutettua geeniä ei lueta proteiinin valmistuksessa.

Ketoosi lisää sirtuiini1:en (SIRT1) määrää hippokampuksen eli aivoturson alueella ohimolohkojen sisäosissa korvien lähellä. Kummankin ohimolohkon hippokampus on yhteydessä toiseen ja hypotalamukseen aivokaaren välityksellä.

Nyt liikutaan kiistanalaisilla vesillä. Vuosittain arviolta 2,8 miljoonaa ihmistä kuolee lihavuuden aiheuttamiin komplikaatioihin. Tutkimuksissa on havaittu, että väestöjen keskimääräinen älykkyys laskee. Voisiko olla niin, että runsasenerginen ravinto ei tuhoa vain terveyttämme, vaan myös kognitiiviset kykymme? Voisimmeko elää nälässä terveempinä ja älykkäämpinä. Siinä on provokatiivinen keskustelunaihe kahvipöytään.


Hippokampus ja deklaratiivinen muisti



Hippokampus osallistuu muistitoimintoihin. Erityisen tärkeä hippokampus on deklaratiivisen muistin eli säilömuistin toiminnassa. Deklaratiivinen muisti jakautuu semanttiseen ja episodiseen muistiin. Semanttiseen muistiin tallentuvat asiat, joiden merkitys ymmärretään. Episodimuistiin tallentuu välähdyksenomaisia muistoja tapahtumista. SIRT1-puutos aiheuttaa kognition, muistin ja suunnitelmallisuuden häiriötilan.

”Li-Huei Tsai’s group found that Sirt1 regulates memory by forming a complex that downregulates microRNA miR-134.  This microRNA targets mRNA transcripts for the key learning and memory genes CREB and BDNF, so by keeping miR-134 low, Sirt1 promotes memory formation by keeping CREB and BDNF levels high.”

2016 tehdyssä tutkimuksessa (Heyward et al.) havaittiin, että jatkuvasti liikaravittujen hiirien muistitoiminnot heikkenivät ja hippokampuksen sirt1-pitoisuudet laskivat. Muistia ja oppimista säätelevien geenien ekspression heikkeneminen assosioitui DNA:n lisääntyneeseen metylaatioon.

Tutkijat raportoivat myös SIRT1-geeniin liittyvän DNA:n hydroksimetylaation vähenemisestä. Runsaasti energiaa sisältävän ravinnon aiheuttama DNA:n metylaatio hiirillä alleviivaa ympäristövälitteisten epigeneettisten muutosten vaikutuksia geenin ilmentymiseen.

Hydroksimetylaation merkitys aivojen toiminnalle on yhä arvailujen varassa, mutta tutkijat uskovat, että hydroksimetyloitunut DNA estää eräiden repressiivisten kompleksien sitoutumisen DNA:han.

Kolmas ruokavalioon liittyvä havaittu epigeneettinen mekanismi on, että yksi kolmesta ketoainetyypistä, betahydroksibutyraatti on itsessään endogeeninen HDAC-estäjä. Vaikka sirtuiinit estävät muistin repressoreita (torjujat?), toiset HDAC-luokan histonideasetylaasit voivat estää muistia parantavien geenien toimintaa. Tällaisten histonideasetylaasien estäjät parantavat muistin toimintaa ja niillä on suuri terapeuttinen potentiaali.

Moses Chaon tutkijaryhmä havaitsi, että betahydroksibutyraatti lisää hippokampuksen BDNF-expressiota estämällä HDAC2:ta ja HDAC3-5:tä. Käänsin edellisen kappaleen niin sekavasti, että täsmennetään: betahydroksibutyraatti parantaa muistiin vaikuttavien geenien ilmentymistä estämällä eräitä histonideasetylaaseja.

Eläinkokeiden perusteella ravinnosta saadun energian rajoittaminen ja ketogeeninen ruokavalio suojaavat aivojen soluja, tehostavat muistia ja parantavat kognitiivisia toimintoja. Vastaavasti runsasenerginen ja hiilihydraattipainotteinen ravinto ylläpitää oksidatiivista stressiä ja kasvattaa neurodegeneratiivisten muutosten riskiä.  Eräässä lievistä muistivaikeuksista kärsivillä vanhuksilla toteutetussa tutkimuksessa kuuden viikon vähähiilihydraattinen ruokavalio paransi koehenkilöiden verbaalista muistia. Toisessa kokeessa terveille nuorille aikuisille annettiin annos glukoosia. Kognitiivisia kykyjä mitattiin ennen glukoosia ja sen jälkeen. Tässä tutkimuksessa nuorten kognitiiviset kyvyt heikkenivät 20 minuuttia glukoosiannoksen jälkeen.

Ketogeeninen ruokavalio säätelee NAD+-riippuvaisia entsyymejä ja vähentää DNA:n vaurioita hippokampuksen alueella

Ketogeenisen ruokavalion (KD) epileptisia kohtauksia vähentävät vaikutukset on hyvin dokumentoitu. Ketogeeninen ruokavalio on joillain lapsilla ainoa tehokas keino vähentää epilepsiaan liittyviä kohtauksia.

Hiljattain on havaittu ketogeenisen ruokavalion terapeuttinen potentiaali useiden neurodegeneratiivisten sairauksien hoidossa. Kokeellinen todistusaineisto ketoruokavalion hyödyistä on kuitenkin edelleen puutteellista.

Rotilla tehdyssä tutkimuksessa on osoitettu, että ketogeenistä ravintoa saavien rottien hippokampuksen alueen solujen nikotiiniamidiadeniinidinukleotidi+ (NAD+) -tasot kasvavat.

NAD+ on soluaineenvaihdunnan toiminnalle välttämätön koentsyymi, signalointimolekyyli, soluterveyden markkeri sekä pitkäikäisyyteen ja DNA:n vaurioiden korjaamiseen osallistuvien entsyymien, kuten sirtuiinien ja poly-ADP riboosi polymeraasi-1:n (PARP-1) substraatti.

NAD+-riippuvaisten entsyymien aktivaatio voi selittää laajemminkin ketogeenisen ruokavalion hyödyllisiä vaikutuksia. En mene tarkemmin tuon rottakokeen arviointiin, mutta sen tulokset olivat hyvin rohkaisevia aivojen terveyden osalta.

Miten ketogeeninen ruokavalio suojaisi aivoja?

Ketogeeninen (KD) eli LCHF-ruokavalio sisältää hyvin niukasti hiilihydraatteja, runsaasti rasvoja ja kohtuullisesti proteiineja. Hiilihydraattien määrä rajoitetaan noin 10 prosenttiin päivittäisestä energiansaannista. Suurin osa päivittäisestä energiasta saadaan rasvasta, jonka määrä voi olla 60-70 % päivittäisestä energiansaannista. Proteiinien saanti pidetään 20-30 prosentin tasolla päivittäisestä energiansaannista.

KD ohjaa energia-aineenvaihdunnan helpoista ja nopeista hiilihydraateista (glukoosista) enemmän energiaa kuluttavaan rasva-aineenvaihduntaan, jossa vapaista rasvahapoista valmistettuja ketoaineita käytetään solujen ATP:n lähteenä.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio on ainoa tehokas hoitomuoto lasten lääkeresistentin epilepsian epileptisten kohtausten hillitsemiseen. (Neal et al., 2009; Sharma et al., 2013; Cervenka et al., 2017)

Jatkuvasti kasvava tutkimusnäyttö osoittaa, että ketogeenisella ruokavaliolla on suotuisia vaikutuksia terveyteen (Yang and Cheng, 2010; Winter et al., 2017; Augustin et al., 2018) sekä pitkäikäisyyteen (Newman et al., 2017; Roberts et al., 2017).

Tuoreissa tutkimuspapereissa ketogeenisen ruokavalion terveysvaikutukset assosioituvat vahvasti NAD -koentsyymiin (Elamin et al., 2017), joka on välttämätön ATP:n prosessoinnille ja hapetus-pelkistys-reaktiolle. Ketoaine-perusteisessa aivosolujen energia-aineenvaihdunnassa pelkistyy vähemmän NAD-molekyylejä, kuin glukoosiin perustuvassa energia-aineenvaihdunnassa. Tämän seurauksena aivosoluihin jää korkeampia pitoisuuksia hapettuneita NAD+ -molekyylejä.

Ketogeeninen ruokavalio voi havaintojen perusteella indusoida nopeita ja pysyviä muutoksia NAD+ / NADH -suhteissa aivojen runsaasti energiaa kuluttavalla hippokampuksen alueella. Tämä aivojen osa tunnetaan leikkimielisellä nimellä – kohtausportti (seizure gate). Vastaavia havaintoja on tehty ikääntyneillä hiirillä. Sen sijaan ketoaineisiin nojaavan energia-aineenvaihdunnan ei havaittu vaikuttavan aivokuoren alueella.

Korkeammat NAD+ -tasot rajoittavat epileptisia kohtauksia ja kasvattavat koe-eläinten elinajan odotetta (Lin and Guarente, 2003; Mills et al., 2016; Liu et al., 2017). Kokeellisesti kohotetut NAD+ -arvot tehostavat mitokondrioiden toimintaa, suojaavat oksidatiivisen stressin aiheuttamilta vaurioilta ja vähentävät solujen kuolemaa (Kussmaul and Hirst, 2006). Nämä vaikutukset palautuvat alemman tason aineenvaihduntareitteihin.

NAD+ on kahden entsyymiryhmän, sirtuiinien ja poly-(ADP-riboosi) polymeraasien eli PARP:ien substraatti. Nämä entsyymiryhmät vaikuttavat solujen toimintaan geenien ilmentymisestä DNA:n vaurioiden korjaamiseen (Belenky et al., 2007).

NAD+-riippuvaiset sirtuiini-entsyymit ovat tärkeitä aineenvaihdunnan, tulehdusvasteiden ja DNA:n vaurioiden korjaamisen säätelijöinä. Sirt1 osallistuu transkriptiotekijöiden, kasvutekijöiden, anti-apoptisten (ohjattua solukuolemaa estävien) ja anti-inflammatoristen proteiinien deasetylaatioon, eli asetyyliryhmien purkuun.

Sirt1 on välttämätön kognitiivisten toimintojen, muistin ja neuroplastisuuden normaalille toiminnalle (Michan et al., 2010) ja sillä on havaittu epileptisia kohtauksia ehkäiseviä vaikutuksia. Ravinnosta saatavan energian (kaloreiden) rajoittaminen ja ketogeeninen ruokavalio assosioituvat solujen parempaan terveyteen ja ainakin eläinkokeissa odotettavissa olevan elinajan pidentymiseen. Sirt6 ja Sirt7 osallistuvat suoraan DNA:n emäsjaksojen korjaamiseen, mikä vähentää ikääntymisen aiheuttamia DNA-vaurioita.

Lopuksi

On kiinnostavaa seurata sirtuiinien ja ketogeenisen ruokavalion tutkimuksia. Väitteet karppauksen, rasvojen ja ketogeenisen ruokavalion haitallisuudesta ovat vähintäänkin liioiteltuja ja todennäköisesti jopa haitallisia. Tutkimusaineisto sirtuiinien molekyylibiologisesta roolista ja ketogeenisen ruokavalion terveysvaikutuksista karttuu vauhdilla. Minä palaan tähän aiheeseen Ruokasodassa varmasti vieläkin täsmällisempien tutkimusten kautta. Omalla kohdallani olen havainnut, että vähäisempi ravinnonsaanti kasvattaa motivaatiota, muistia ja aktiivisuutta. Nämä tutkimukset näyttävät vahvistavan omia huomioitani.

PS. Iloista ja rauhallista joulua!

Lähteinä olen käyttänyt erikseen ilmoitettujen lähteiden lisäksi mm. Duodecimia ja Wikipdiaa yleisimpien aineenvaihduntareaktioiden osalta. Kuvien lähde: Pixabay

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2928875/

https://www.jneurosci.org/content/36/4/1324.long

https://elifesciences.org/articles/15092

https://www.frontiersin.org/articles/10.3389/fncel.2018.00263/full

https://www.duodecimlehti.fi/lehti/2007/19/duo96781




Esidiabetes, diabetes ja ketoilu

Esidiabeteksessa verensokeri on selvästi koholla, mutta ei vielä niin korkea kuin diabetekseen sairastuneilla. Esidiabeteksen toteamisen jälkeen on tärkeää kiinnittää ravintoon ja elintapoihin enemmän huomiota. Todetuista esidiabetes-tapauksista jopa seitsemän kymmenestä johtaa aikuistyypin diabetekseen. Lue tästä.

Ruokavalio- ja elämäntapamuutokset pienentävät esidiabetes-diagnoosin saaneiden riskiä sairastua aikuistyypin diabetekseen jopa 40-75%.

Elämäntapamuutoksiin kuuluvat säännöllinen liikunta ja terveellinen ruokavalio. Terveellisestä ruokavaliosta on useita keskenään ristiriitaisia näkemyksiä. Eräiden tutkimusten mukaan ketogeeninen ruokavalio voi pienentää diabetekseen sairastumisen riskiä. Onko näin?


Uhkakuvia ja pelkokertoimia


Olen ketoillut alun kolmatta viikkoa. Sitä voi verrata laskuvarjohyppyyn ilman laskuvarjoa. Ketoilu tappaa yhtä varmasti kuin ydinsota ja marraskuun märkä pimeys Helsingissä. En laske leikkiä. Kaikki vähähiilihydraattista ruokavaliota noudattavat kuolevat sataprosenttisen varmasti.

Tämä on pelottavaa, sillä edes täyskäännös ruisleipään, vähärasvaisiin ruokiin, pehmeisiin rasvoihin ja kasviksiin ei pelasta kerran ketoillutta harhaoppista mitenkään. Vain Jumbo voi pelastaa.

Maailman yli 400 miljoonasta diabeetikosta ja 2,8 miljoonaa lihavuuteen vuosittain kuolevasta vain kourallinen sairastui tai kuoli vähähiilihydraattisen ruokavalion vuoksi. He sairastuivat ja kuolivat, koska se on Jumbon tahto. Tai ehkäpä ei.

LCHF-ruokavaliot eivät uhkaa kansallista tai edes monikansallista turvallisuutta. Joidenkin pohdintojen mukaan ketogeeninen ruokavalio voi tosin olla uhka sokeri-, lääke- ja elintarviketeollisuudelle. Se on kaiketi lööperiä.

Vähähiilihydraattista ruokavaliota demonisoidaan osin aiheettomasti. The Lancet julkaisi hiljattain tutkimuskatsauksen, jonka mukaan vähiten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi kohtuullisesti hiilihydraatteja syöviä verrokkeja enemmän. Clickbait-uutisen lopuksi mainittiin lyhyesti, että tosiasiassa U-käyrän toisella puolella myös eniten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi.

Miksi näin on? Mitä uutisella haluttiin kertoa?

Enkä sillä haluttiin kertoa, että ketoilu on helvetin vaarallista, moraalitonta ja halveksittavaa ja sitä vastaan on taisteltava kaikin kuviteltavissa olevin keinoin.

Kaikista uusitupalaisimpien näkemysten mukaan karppaus aiheuttaa, jos ei maailmanloppua, niin ainakin 10-15 miljoonaa uutta sydäntautitapausta pelkästään Suomessa. Näistä arviolta 83 % kuolee seuraavien 3-5 kuukauden sisällä. Jotkut onnettomuuksiin, toiset itsemurhiin ja useimmat hiilihydraattien välttämisen aiheuttamiin komplikaatioihin ja yleisvitutukseen. No niin. Siinäpä tuo saatanan sarkasmi taas tuli. Anteeksi.

Ehkäpä tärkeää ei ole niinkään makroravinteiden osuudet, vaan tasapuolinen ruokavalio ja mikroravinteiden  riittävä saanti. Sitä sietää harkita. Laihtumisen kannalta tällaiseen viittaa Stanfordissa tehty tutkimus, jossa verrattiin LCHF-ruokavaliota vähän kaloreita sisältävään ruokavalioon. Osallistujat laihtuivat molemmilla dieeteillä, mutta seuratuissa ryhmissä oli laihtumisen suhteen suuria sisäisiä eroja.


Ei ole vain yhtä tapaa syödä oikein tai väärin


Ihmiset syövät väärin ja sairastuvat. Se ei ole varsinaisesti kenenkään syy. Se on ennemminkin seuraus siitä, että ruokateollisuus tarjoaa yhä enemmän korkean glykeemisen kuorman ruokia, jotka sisältävät hyvin vähän elimistön tarvitsemia mikroravinteita.

Markkinointi ohjaa kuluttajat syömään halvemmalla, nopeammin, mutta laadullisesti heikompitasoista ruokaa. Sellainen maistuu lisättyjen sokereiden, transrasvojen ja viljojen ansiosta helvetin paljon paremmalta kuin parsa tai porkkana. Tämä johtaa lihomiseen ja kasvattaa sairastumisen riskiä.

Runsaasti energiaa sisältävä ruoka on helppoa, halpaa ja nopea valmistaa. Välttämättömiä ravinteita sisältävä ruoka vaatii enemmän työtä ja suunnittelua.  Kaikilla ei yksinkertaisesti ole aikaa ja energiaa valmistaa ruokaa itse, jolloin on houkuttelevaa turvautua nopeisiin ja halpoihin vaihtoehtoihin.

Ketogeeninen LCHF-ruokavalio ei ole täydellinen tai ainoa terveyttä ja painonhallintaa ylläpitävä ruokavalio, mutta jos sen toteuttaa monipuolisesti, se on ihan pätevä ja harkitsemisen arvoinen vaihtoehto.

Hiilihydraatit eivät pidä kylläisenä yhtä hyvin kuin rasvat. Hiilihydraatteja ja runsaasti huonoja rasvoja sisältävät herkut hampurilaisista donitseihin ja makeisista virvoitusjuomiin vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin päihteet.

On esitetty, että käytännöllisesti katsoen kaikkien riippuvuutta aiheuttavien aineiden addiktoiva vaikutus selittyy viime kädessä niiden kyvyllä vapauttaa dopamiinia aivojen nk. mielihyväkeskuksessa nucleus accumbensissa. (Duodecim)” Sokeri ja erityisesti fruktoosi vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin kokaiini tai alkoholi. Sokeririippuvuus on kokonaan toinen juttu.

Lihominen on vain yksi oire aineenvaihdunnan särkymisestä. Muita oireita ovat metabolinen oireyhtymä, aikuistyypin diabetes, tulehdukselliset suolistosairaudet ja alkoholista riippumaton rasvamaksa. Kaikki ovat lisääntyneet räjähdysmäisesti 1970-luvun jälkeen.

Melkein kaikki lihavat sairastuvat metaboliseen oireyhtymään, joka johtaa yleensä aikuistyypin diabetekseen. Useimmille diabetesta sairastaville kehittyy rasvamaksa. Huonot ravitsemustottumukset edesauttavat yleensä jonkin tulehduksellisen suolistosairauden kehittymistä. Näitä voi käsitellä yksittäisinä ilmiöinä, mutta mielestäni ne ovat osa laajempaa ravitsemukseen liittyvää ongelmaa. Kardiometabolisten sairauksien epidemia uhkaa jo terveydenhoidon kantokykyä ja kansantaloutta.


Oikotietä terveyteen ei ole, mutta jotain on syötävä


En laske hiilihydraatteja. Tiedän, että niiden määrä jää kohdallani 20-50 grammaan päivässä. Rasvaa voisin syödä ehkä hieman enemmän, mutta proteiinien saanti saattaa kohdallani olla hieman tarvetta runsaampaa. Haluan välttää lihomisen ja erityisesti vyötärölihavuuden aiheuttamat sairaudet. Yritän siis laihtua paetakseni aikuistyypin diabetesta. Multippeliskleroottisena en haluaisi uusia taakkoja kannettavakseni.

Näin ketoilun kolmannella viikolla huomaan noudattavani jonkinlaista 6:1-variaatiota. Syön siis kuutena päivänä vähähiilihydraattisesti ja yhtenä päivänä melkein mitä vain kohtuuden ja järjen sallimissa puitteissa. Tämä ei mene kirjan mukaan, mutta katsellaan mihin tämä johtaa.

Ketopäivinä syön kahdesti päivässä ja oloni on koko ajan kylläinen ja energinen. En kaipaa aamu- ja iltapalaa, välipaloja tai herkkuja. Juon vettä, kahvia ja teetä (tarvittaessa punaviiniä tai sokeritonta lonkeroa). Aiemmin napostelin pitkin päivää jotakin ja energiatasot olivat koko ajan aivan nollassa.

Ketogeenisen ruokavalion suuri hyöty laihtumisen kannalta onkin juuri siinä, että rasva pitää kylläisenä pidempään ja naposteluhalu vastaavasti vähenee. Näin päivittäinen energiansaanti laskee ilman näläntunnetta ja suuria uhrauksia.

Varoitus: Ketogeeninen LCHF-ruokavalio ei välttämättä sovi kaikille. Pitkäaikaistutkimuksia LCHF-ruokavalion vaikutuksista terveydelle ei ole. En halua hehkuttaa ketogeenistä ruokavaliota minään muuna kuin mitä se on.

Parantaako ketogeeninen ruokavalio kaikki vaivat? Ei helvetissä paranna. Sellaista väittävät puhuvat paskaa ja myyvät jotain. Aineenvaihdunnan tasolla ketogeenisen ruokavalion toiminta tunnetaan ja se on hyvin tehokas laihdutusruokavalio kahdesta syystä:

1) rasva pitää kylläisenä, jolloin kokonaisenergiansaanti laskee, ja
2) ketogeeninen ruokavalio pakottaa elimistön turvautumaan läskivarastoihin energian saamiseksi, jolloin rasvan ”poltto” tehostuu.

Viralliset mallit, kuten ruokapyramidit eivät ole aivan huonoja, mutta niissä hiilihydraattien eli sokereiden määrä pidetään tarpeettoman korkeana ja rasvojen saantia kehotetaan välttämään tai suosimaan rasvattomia tai vähärasvaisia elintarvikkeita, vaikka rasvat ovat solujen uusiutumiselle sekä aivojen ja hermoston toiminnalle välttämättömiä ravintoaineita. Aivojen kuivapainosta 60 prosenttia on rasvaa. Kolesterolista – jota elimistö tuottaa itse kolesterolisynteesissä, 25 prosenttia on aivoissa. Rasva ja kolesteroli ovat mm. hermoratoja suojaavien myeliinieristeiden rakennusaineita.

Vähän hiilihydraatteja sisältävään ravintoon liittyy monenlaisia ennakkoluuloja, joiden mukaan LCHF-ruokavaliolla syödään vain proteiinia ja rasvaa. Se ei ole aivan totta. Ketogeenisellä ruokavaliolla on mahdollista syödä terveellisesti ja monipuolisesti, jos vain jaksaa nähdä vaivaa ja valmistaa terveellistä ja monipuolista ruokaa.

Usein ketoilija korvaa paljon tärkkelystä sisältävät korkean glykeemisen kuorman hiilihydraatit, kuten perunat ruokavalion sallimilla vihanneksilla. Terveellisten vihannesten ja kasvisten päivittäinen saanti todennäköisesti kasvaa LCHF-ruokavaliolla aiempaan verrattuna.


Diabetes: 1 & 2


Hölöttäminen sikseen. Aiheena on diabetes ja erityisesti ketogeenisen ruokavalion vaikutus diabetesta ehkäisevänä ruokavaliona. Tyypin 1 ja typin 2 diabetes ovat hyvin erilaisia sairauksia.

Tyypin 1 diabeetikon kohdalla hiilihydraattien välttämisen tuottama ketoosi voi johtaa hengenvaaralliseen ketoasidoosiin. Ketogeeninen ruokavalio ei siis sovi tyypin 1 diabetesta sairastavalle, mutta voi vähentää lääkityksen tarvetta tyypin 2 diabetesta sairastavilla.

Diabetekseen sairastuvan sokeriaineenvaihdunta on häiriintynyt. Insuliinintuotanto on loppunut tai solujen insuliinisensitiivisyys on heikentynyt. Haiman Langerhansin saarekkeiden beetasolujen tuottama elintärkeä insuliini on eräänlainen avain, jonka glukoosi tarvitsee päästäkseen solun sisälle.


Insuliinin ja glukagonin vaikutus


Ruokailun jälkeen veren sokeripitoisuus kasvaa. Haima reagoi tähän erittämällä vereen insuliinia. Solujen pinnalla on insuliinireseptoreita, joihin kiinnittyvä insuliinimolekyyli tuo solun läpäisevän kanavamolekyylin solukalvolle. Näin glukoosimolekyyli pääsee soluun, jossa se muutetaan solun tarvitsemaksi energiaksi solulimassa tapahtuvassa glykolyysissä ja mitokondrioissa tapahtuvassa sitruunahappokierrossa. Aerobisessa energiantuotannossa eli soluhengityksessä sokerit (ja rasvat) poltetaan vedeksi ja hiilidioksidiksi.

Kun veren glukoosipitoisuus laskee, haiman alfasolut erittävät vereen glukagonia. Se on insuliinin vastavaikuttajana energia-aineenvaihdunnan kannalta elintärkeä hormoni. Glukagoni aktivoi maksan ja lihasten sokerivarastojen eli glykogeenien purkamisen. Näin veren sokeripitoisuus pysyy tasaisena myös aterioiden välillä.

Mitä tapahtuu, jos ja kun elimistön sokerivarastot loppuvat? Kuoleeko ihminen? Ei. Glukagoni purkaa rasvasoluista rasvahappoja vereen. Se käynnistää maksan ja munuaisten soluissa ketogeneesin ja glukoneogeneesin.

Ketogeneesi ja glukoneogeneesi

Ketogeneesi tuottaa vereen vapautuneista rasvahapoista ketoaineita, joita solut voivat käyttää energianlähteenä. Tähän täysin arkiseen aineenvaihduntaprosessiin ei liity mitään mystiikkaa. Se on elimistön eräs luonnollinen selviytymismekanismi.

Glukoneogeneesi tuottaa mm. sitruunahappokierron väliaineista ja eräistä vapaista aminohapoista glukoosia.

Glukagoni käynnistää beetaoksidaation, glukoneogeneesin ja ketogeneesin. Insuliini keskeyttää nämä aineenvaihduntaprosessit.

Glukagonin vaikutuksesta soluissa käynnistyvässä beetaoksidaatiossa rasvahapot pilkotaan asetyylikoentsyymi-A:ksi eli aktiiviseksi etikkahapoksi. Se on kaikkien energiaravinteiden yhteinen väliaine sitruunahappokierrossa.

Näin rasvasolujen sisältämä rasva muutetaan solujen energiaksi kelpaavaan muotoon ja rasvaa aletaan polttaa solujen energiaksi. Atkinsin hypoteesin mukaan jatkuvasti korkeat insuliinitasot estävät elimistön rasvavarastojen tehokkaan käyttämisen, koska beetaoksidaatio, ketogeneesi ja glukoneogeneesi eivät ehdi kuluttamaan rasvoja, kun tarjolla on jatkuvasti helppoja ja nopeita hiilihydraatteja.

Tyypin 1 diabetes on autoimmuunitauti, jossa kehon oma immuunijärjestelmä tuhoaa insuliinia valmistavat Langerhansin saarekkeiden beetasolut. Tämän seurauksena haima ei pysty tuottamaan riittävästi elintärkeää insuliinia.

Ennen insuliinilääkityksen keksimistä tyypin 1 diabetes oli käytännössä kuolemantuomio. Insuliinilääkityksen ansiosta diabeetikot saavat elää melko normaalisti, mutta se edellyttää jatkuvaa tasapainoilua veren glukoosipitoisuuden tasaisena pitämiseksi. Liian korkea ja liian matala veren glukoosipitoisuus aiheuttavat diabeetikoille jopa hengenvaarallisia komplikaatioita. Diabetesta kutsuttiin aiemmin sokeritaudiksi, koska se vaikuttaa sokerin aineenvaihduntaan.

Tyypin 2 diabeteksessa solujen insuliinireseptorien ”lukkomekanismi” rikkoutuu niin, että vaikka insuliinimolekyylit koettavat kiinnittyä insuliinireseptoreihin, ne eivät kiinnity siihen toivotulla tavalla. Haima voi tuottaa yhä insuliinia, mutta solut eivät reagoi insuliiniin niin kuin niiden pitäisi reagoida. Tätä kutsutaan insuliiniresistenssiksi.

Tyypin 1 diabetes on erityisesti lasten ja nuorten sairaus, vaikka siihen voi sairastua vanhempanakin. Se edellyttää perinnöllisen alttiuden sekä yhden tai useamman sairastumisen laukaisevan tekijän. Tyypin 1 diabetes on hoidettavissa insuliinilääkityksellä, mutta ei parannettavissa. Se on elinikäinen sairaus. Diabetesta sairastavista noin 5 % sairastaa tyypin 1 diabetesta.

Tyypin 2 diabetes on elämäntapoihin liittyvä sairaus, johon sairastutaan yleensä aikuisena. Tosin se yleistyy pelottavan nopeasti myös ylipainoisten lasten parissa. Myös tyypin 2 diabetekseen liittyy perinnöllinen alttius, mutta siihen sairastumista voidaan ehkäistä ja oireita helpottaa elämäntapamuutoksilla.

Molemmissa tapauksissa diabetes voi johtaa erilaisiin komplikaatioihin, kuten sydän- ja verisuonitauteihin, munuaisten sairauksiin, sokeuteen, erilaisiin neurologisiin häiriöihin sekä verisuoni- ja elinvaurioihin.

Yhdysvalloissa jo lähes joka kymmenes ihminen (noin 30 miljoonaa) sairastaa diabetesta, mutta sairastuneista 25 % ei tiedä sairastavansa.

Paistettua chilillä maustettua kanaa ja kasviksia, porkkanaraaste ja jogurttikastike

Raskausaikainen diabetes paranee usein synnytyksen jälkeen, mutta joissain tapauksissa se voi johtaa aikuistyypin diabetekseen myöhemmin elämässä.


Diabeteksen syyt


Tyypin 1 ja tyypin 2 diabetes johtuvat eri syistä, mutta molempiin liittyy insuliini. Insuliini on haiman tuottama sokeriaineenvaihdunnalle elintärkeä hormoni.

Tyypin 1 diabetes

Autoimmuunitautien tarkkaa syntytapaa ei tunneta. Niissä immuunijärjestelmän virheellinen toiminta kohdistaa aktivaation kehon omia kudoksia vastaan. Diabeteksessa immuunijärjestelmä tuhoaa haiman Langerhansin saarekkeiden insuliinia tuottavia beetasoluja. Autoimmuunitaudit edellyttävät perinnöllisen sairastumisalttiuden sekä yhden tai useamman sairastumisen laukaisevan ympäristötekijän. Tyypin 1 diabeteksen saattaa laukaista jokin lapsuudessa sairastettu infektio. Tutkimus.

Sairastumisen riskiin vaikuttavat mahdollisesti:

  • perinnölliset tekijät; suvussa esiintyy diabetesta
  • eräät geenimuutokset
  • muut sairaudet, kuten kystinen fibroosi ja perinnöllinen hemokromatoosi
  • altistuminen infektioille, kuten sikotaudille, vihurirokolle ja tavalliselle herpesvirukselle (cytomegalovirus)
  • matalat sikiöaikaiset D-vitamiinitasot

Tyypin 2 diabetes

Aikuistyypin diabeteksessa solut alkavat vieroksua insuliinia. Hiljalleen tauti etenee pisteeseen, jossa insuliinin tuotanto vähenee ja solut eivät pysty käyttämään glukoosia tehokkaasti. Glukoosi ei pääse soluihin ja sitä alkaa kerääntyä verenkiertoon. Insuliiniresistanssi ilmenee mittauksissa selvästi kohonneena verensokerina.

Insuliiniresistenssi voi syntyä, jos veren glukoosipitoisuus on jatkuvasti korkea ja veressä on runsaasti insuliinia. Solut ylikuormittuvat ja ”kyllästyvät” insuliiniin, jolloin ne reagoivat insuliinin vaikutuksiin huonommin.

Tyypin 2 diabeteksen selkeiden oireiden ilmenemiseen voi mennä vuosia. Taudin varhaisvaiheessa sairauden etenemistä voi vielä hidastaa ja oireita hillitä lääkkeiden, ruokavalion ja liikunnan avulla. Insuliinia ei sairauden alkuvaiheessa tarvita, mutta taudin edetessä insuliinin tarve kasvaa veren glukoosipitoisuuden tasaisena pitämiseksi.

Tyypin 2 diabeteksen riskitekijöihin kuuluvat:

  • perinnöllinen alttius; suvussa esiintyy aikuistyypin diabetesta
  • ylipaino ja lihavuus
  • tupakointi
  • huonot ruokatottumukset
  • liikunnan puute
  • eräät lääkkeet

Riskitekijät

Geneettiset tekijät sekä eräät ympäristömuuttujat voivat laukaista tyypin 1 ja tyypin 2 diabeteksen, mutta aikuistyypin diabeteksen voi välttää laihduttamalla, syömällä terveellisesti ja liikkumalla riittävästi. JAMA Oncology -julkaisu kertoo, että kuitujen ja maustamattoman jogurtin saanti laskee keuhkosyövän riskiä merkittävästi. Aiemmissa tutkimuksissa on havaittu jogurtin ja kuitujen vähentävän aikuistyypin diabeteksen riskiä.

D-vitamiini

On jonkin verran tutkimusnäyttöä siitä, että riittävä D-vitamiinin saanti laskee diabetekseen sairastumisen riskiä. Erityisesti odottavan äidin ja sikiön matalat D-vitamiinitasot voivat altistaa sairastumiselle myöhemmin elämässä. 2017 julkaistun tutkielman mukaan D-vitamiinin vajaus heikentää mm. immuunijärjestelmän säätelyä ja solujen insuliiniherkkyyttä; tämä puolestaan lisää diabetekseen sairastumisen riskiä.

Rintaruokinta

Rintaruokinta voi laskea lapsen riskiä sairastua tyypin 1 diabetekseen. 2012 julkaistu tutkimus tulkitsi rintaruokinnan suojaavan lasta tyypin 1 diabetekseen sairastumiselta, mutta tieteellinen näyttö rintaruokinnan suojaavasta vaikutuksesta jäi melko ohueksi.

Oireet

Diabeetikko voi kärsiä monenlaisista alhaisen verensokerin aiheuttamia oireita ja komplikaatioita.

Aikuistyypin diabetekseen liittyy metaboliseen oireyhtymään viittaavia piirteitä, kuten lihavuutta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja. Inflammaatio vaikuttaa metaboliseen oireyhtymään ja aikuistyypin diabetekseen.

Ketoilijan jauhelihasalaattia

Tyypin 1 diabetes Tyypin 2 diabetes
Ennen tautia Painoindeksi on tasolla (19–24.9) Painoindeksi (25 tai suurempi)
Taudin aikana Useita viikkoja jatkuva nälän- ja janontunne sekä lisääntynyt virtsaamisen tarve, näön hämärtyminen.

Näön hämärtyminen, väsymys, käsien ja jalkojen puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon äkillinen putoaminen.

Lisääntynyt janon- ja nälän tunne, lisääntynyt virtsaamisen tarve, näön hämärtyminen

Väsymys, jalkojen ja käsien puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon selittämätön lasku.

 

Komplikaatiot

Riskinä sydän- ja verisuonitaudit, sydänkohtaus, halvaus, munuaistauti ja munuaisen vajaatoiminta.

Silmävauriot ja sokeus, hermovauriot, hitaasti paranevat haavat, ketoasidoosi

Riskinä sydän- ja verisuonitaudit, sydänkohtaus ja halvaus, munuaistauti ja munuaisten vajaatoiminta, näön heikkeneminen, hermovauriot.
Hitaasti paranevat haavat, kuoliot (amputaation riski), ketoasidoosi.

Hyperglykemia

Jos diabeetikon veren sokeripitoisuus kasvaa liian korkeaksi, seurauksena on hyperglykemia. Tämä voi johtaa pitkäkestoisiin komplikaatioihin, sokeutumiseen, sydän- ja verisuonitauteihin ja elinvaurioihin. Hyperglykemiaan liittyy usein lisääntynyt virtsaamisen tarve ja kova jano.

Hyperglykemia voi johtaa ketoasidoosiin, eli happomyrkytykseen, joka on diabeetikoilla hengenvaarallinen ja lääkärin hoitoa vaativa tila.

Ketoasidoosin yleiset oireet:

  • hengitysvaikeudet
  • makealta ja hedelmäiseltä haiseva hengitys
  • pahoinvointi ja oksentelu
  • kuiva suu
  • kooma

Hypoglykemia

Diabetesta sairastavien pitää seurata veren sokeritasoja säännöllisesti. Diabetesta sairastavan verensokerin lasku liian alhaiselle tasolle viittaa hypoglykemiaan. Hypoglykemian voi aiheuttaa liian suuri annostus insuliinia tai insuliinia tuottavaa lääkettä.

Hypoglykemian oireita ovat:

  • hikoilu, vilunväreet, kalpeus
  • heikotus, vapina, hermostuneisuus, ahdistus
  • kiihtynyt pulssi
  • huimaus
  • pahoinvointi
  • väsymys
  • päänsärky
  • kihelmöinti

Hypoglykemian hoitamiseksi diabetesta sairastavan on saatava jotakin nopeaa hiilihydraattia, sokerivettä, makeisia tai glukagonitabletti. Hypoglykemia on hengenvaarallinen tila, jossa potilas tarvitsee nopeasti lääkärin apua.

Ilman asianmukaista hoitoa hiilihydraateilla tai glukagonilla hypoglykemia voi aiheuttaa:

  • kohtauksia
  • tajunnan menetyksen
  • kooman

Diagnoosi

Tyypin 1 diabetes alkaa usein nopeasti ja varoittamatta. Kun oireita ilmenee, potilaan on syytä hakeutua lääkärin vastaanotolle, jotta diagnoosi varmistuu ja asianmukainen hoito voidaan aloittaa.

Esidiabetesta ja alkavaa tyypin 2 diabetesta sairastavalla ei välttämättä ole minkäänlaisia sairauteen viittaavia oireita. Aikuistyypin diabetes varmistuu verikokeilla mitattavalla glukoosilla.

Lihavien sekä muiden aikuistyypin diabeteksen riskiryhmään kuuluvien olisi hyvä tarkistuttaa veren glukoosipitoisuus säännöllisesti. Kohonneisiin glukoositasoihin on tärkeää reagoida nopeasti, koska näin taudin kehittymisen voi parhaimmillaan estää ja usein ainakin hidastaa. Testejä:

Verikokeiden tulosten perusteella tutkittavan verensokeritaso selvittää mahdollisen esidiabeteksen tai aikuistyypin diabeteksen.

Tyypin 1 diabeteksen hoitomahdollisuuksia immunosuppressiivisilla lääkkeillä tutkitaan, mutta vaikutukset ovat vielä epäselviä. Myöskään aikuistyypin diabetekseen ei tunneta parantavaa hoitoa, mutta elämäntapamuutokset ja suolen ohitusleikkaus voivat kääntää taudin suunnan ja johtaa remissioon.

Silputtu paprika, sipuli, valkosipuli ja chili


Kannattaisiko ketoilu?


1. Vähähiilihydraattinen ruokavalio auttaa painonpudotuksessa

Rasvan muuttaminen energiaksi edellyttää enemmän työtä kuin hiilihydraattien käyttäminen energiaksi. Kun elimistölle ei tarjota helppoa energiaa hiilihydraattien muodossa, elimistön on turvauduttava rasvavarastoihin. Tämä nopeuttaa laihtumista. Rasva myös pitää kylläisenä, mikä vähentää kokonaisenergian saantia. Brasilialaistutkimus osoitti, että vähän hiilihydraatteja sisältävä ruokavalio on kaloreita rajoittamista tehokkaampi laihduttamisessa:

”The role of very-low-carbohydrate ketogenic diets (VLCKD) in the long-term management of obesity is not well established. The present meta-analysis aimed to investigate whether individuals assigned to a VLCKD (i.e. a diet with no more than 50 g carbohydrates/d) achieve better long-term body weight and cardiovascular risk factor management when compared with individuals assigned to a conventional low-fat diet (LFD; i.e. a restricted-energy diet with less than 30% of energy from fat). Through August 2012, MEDLINE, CENTRAL, ScienceDirect,Scopus, LILACS, SciELO, ClinicalTrials.gov and grey literature databases were searched, using no date or language restrictions, for randomised controlled trials that assigned adults to a VLCKD or a LFD, with 12 months or more of follow-up. The primary outcome was bodyweight. The secondary outcomes were TAG, HDL-cholesterol (HDL-C), LDL-cholesterol (LDL-C), systolic and diastolic blood pressure,glucose, insulin, HbA1c and C-reactive protein levels. A total of thirteen studies met the inclusion/exclusion criteria. In the overall analysis,five outcomes revealed significant results. Individuals assigned to a VLCKD showed decreased body weight (weighted mean difference -0·91 (95% CI -1·65, -0·17) kg, 1415 patients), TAG (weighted mean difference -0·18 (95% CI -0·27, -0·08) mmol/l, 1258 patients) and diastolic blood pressure (weighted mean difference -1·43 (95% CI -2·49, -0·37) mmHg, 1298 patients) while increased HDL-C(weighted mean difference 0·09 (95% CI 0·06, 0·12) mmol/l, 1257 patients) and LDL-C (weighted mean difference 0·12 (95% CI 0·04,0·2) mmol/l, 1255 patients). Individuals assigned to a VLCKD achieve a greater weight loss than those assigned to a LFD in the longterm; hence, a VLCKD may be an alternative tool against obesity.”

2. LCHF voi suojata aivoja

Joidenkin tutkimusten mukaan ketoilu suojaa aivoja mm. ikääntymiseen liittyviltä muistisairauksilta kuten dementialta ja Alzheimerin taudilta sekä neurodegeneratiiviselta Parkinsonin taudilta. Kirjoitin aiemmin tutkimuksesta, jonka mukaan vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio voi vaikuttaa suotuisasti etenevään multippeliskleroosiin. Tutkimuksia tarvitaan enemmän. On kuitenkin viitteitä siitä, että ketogeenisellä ruokavaliolla on aivojen hyvinvointia suojaavia ominaisuuksia. Tutkimuksissa on havaittu, että ketogeeninen ruokavalio parantaa unen laatua ja lisää lasten tarkkaavaisuutta ja oppimiskykyä. Kyllä vain. En keksinyt omasta päästäni. Lue tästä.

Entä se diabetes ja ketoilu?

Ketogeeninen LCHF-ruokavalio auttaa aikuistyypin diabetesta sairastavaa ylläpitämään terveitä verensokeritasoja.

Hiilihydraatit kohottavat veren glukoosipitoisuutta enemmän kuin muut ruoat ja sen vuoksi haiman on eritettävä vereen enemmän insuliinia.

Hiilihydraattien vähentäminen auttaa tasapainottamaan veren glukoositasot ja estämään verensokerin suuria heilahduksia. LCHF ruokavalio laihduttaa ja vaikuttaa myös elimistön hiljaista tulehdusta (inflammaatio) hillitsevästi.

Tästä huolimatta LCHF ei ole yksinkertaisesti helvetin hyvä ruokavalio. Se voi helposti johtaa välttämättömien vitamiinien, mineraalien, kuitujen ja antioksidanttien liian vähäiseen saantiin, mikä voi aiheuttaa monia muita terveysongelmia. Tähän jokaisen ketoilijan on syytä suhtautua riittävällä hartaudella ja vakavuudella. Välttämättömät ravintoaineet ovat välttämättömiä, koska elimistö ei toimi oikein ilman niitä.

Yleisesti ottaen erittäin vähän hiilihydraatteja sisältävä ruokavalio sisältää vain 10-50 grammaa hiilihydraatteja vuorokaudessa, vähän hiilihydraatteja sisältävä ruokavalio on sellainen, jossa hiilihydraattien saanti rajoitetaan 50-100 grammaan päivässä ja kohtuullisesti hiilihydraatteja sisältävä ruokavalio sisältää 100-225 g hiilihydraatteja päivässä. Nämä ovat lukuja ja luvut ovat abstrakteja. Ihmisten tarpeet vaihtelevat ja omaa kehoa on syytä kuunnella tarkasti. Ilman varavarjoa ei pidä hypätä tuntemattomaan. On ihan järkevää ensin selvittää mistä on kyse ja millaisia mahdollisia riskejä radikaaliin ruokavaliomuutokseen voi liittyä.

Eräs varteenotettava vaihtoehto on laskea päivittäistä hiilihydraattien saantia tasaisesti ja seurata samalla millaisia vaikutuksia hiilihydraattien vähentämisellä on veren glukoositasoihin, verenpaineeseen, painoon, yleiseen jaksamiseen jne. Tällaiseen päästään pienillä muutoksilla. Lisätyistä sokereista, valkoisista jauhoista, makeisista, virvoitusjuomista, mehuista yms. on helppo luopua, eikä se edellytä radikaalia elämäntapamuutosta. Leivän voi korvata täysjyväleivällä, pastan ja riisin täysjyväversioilla ja runsaasti tärkkelystä sisältäviä perunoita voi vähentää.

Mitä sitten saa syödä ja mitä ei?

Tästä vallitsee lukemattomia koulukuntia ja jokainen on aivan ehdottomasti omasta mielestään täysin oikeassa. Viime aikoina LCHF-skeneen on liittynyt virallisia ravitsemussuosituksia painottavia virallis-vähähiilihydraattisia tendenssejä.  Eli hiilihydraattien rajoittamisen ohella kehotetaan myös välttämään rasvoja ja suosimaan rasvattomia lihoja. Ei kai siitä haittaa ole, mutta LCHF-ruokavalio lähtee ajatuksesta, että hiilihydraateista saatava energia korvataan rasvasta saatavalla energialla. Siihen ei vähärasvaiset tuotteet sovi.

  • sallittuja vihanneksia (kaalit, parsa, vihreät lehtivihannekset, kesäkurpitsa, tomaatit, paprika jne.)
  • esimerkiksi liha, kana, kala, pähkinät,
  • virallisesti suositellaan rasvoiksi margariinia, oliiviöljyä, rypsiöljyä, mutta minä syön myös voita
  • chia-siemenet (kuituja, proteiinia ja hyviä rasvoja)
  • lanttu

Ruokavalion tavoitteista riippuen hedelmiä voi syödä niukasti. Hedelmät sisältävät sokeria, mutta myös monia kehon tarvitsemia ravintoaineita hyvässä muodossa. Hedelmä on kuitenkin terveellisempi vaihtoehto kuin makeiset.

Ruokavaliossa tulisi välttää:

  • valmisruokia ja suolaisia snacksejä
  • runsaasti sokeria sisältäviä herkkuja: kakkuja, makeisia, leivoksia, keksejä, virvoitusjuomia, mehuja
  • tärkkelystä sisältäviä vihanneksia: peruna, maissi, riisi
  • olutta ja alkoholia, mutta erityisesti olutta ja sokeria sisältäviä alkoholeja
  • valkoista pastaa

Täysjyväleivät, linssit ja pavut sisältävät runsaasti hiilihydraatteja, mutta ruokavalion tavoitteista riippuen niitä voi satunnaisesti syödä niiden sisältämien tärkeiden ravintoaineiden vuoksi.


Kuinka hiilihydraatit vaikuttavat diabetekseen?


Vähähiilihydraattinen ruokavalio on eräs tehokkaimmista tavoista hallita verensokeria aikuistyypin diabeteksessa. Insuliiniresistenteillä ihmisillä veren glukoositasot voivat pysyä korkeina tunteja syömisen jälkeen. Runsaasti hiilihydraatteja sisältävä ruoka ei pidä kylläisenä, vaan ruokahalu palaa pian, vaikka elimistöllä ei olisi energiantarvetta. Tämä johtaa helposti naposteluun ja lihomiseen. Lue tästä.

LCHF

  • lisää energiaa, tarkkaivaisuutta ja parantaa unenlaatua
  • laskee veren keskimääräistä glukoositasoa ja HbA1c-tasoja
  • vähentää napostelua ja makeanhimoa
  • pienentää hypoglykemian riskiä
  • auttaa pudottomaan painoa tehokkaasti ja ilman nälkää
  • laskee diabetekseen liittyvien komplikaatioiden riskiä
  • laskee kolesterolia

Ketoosi on normaali aineenvaihduntaprosessi. Kun elimistöllä ei ole riittävästi glukoosia solujen energian tuotantoon, aineenvaihdunta turvautuu varastorasvoihin, joista valmistetaan energiantuotantoon kelpaavia ketoaineita.

Ketogeenisellä ruokavaliolla (kuten Atkinsin ruokavalio) tavoitellaan ketoosia, jossa keho pakotetaan käyttämään läskiä polttoaineena. Hiilihydraatit ovat elimistön tärkein polttoaine, koska olemme opettaneet kehon käyttämään hiilihydraatteja energianlähteenä.

Elimistö osaa kuitenkin tuottaa energiaa varastoimastaan rasvasta. Se on oikeastaan rasvan keräämisen eli lihomisen tärkein pointti: rasva on varastoenergiaa.

Elimistö käyttää varastoenergiaa sitten, kun helppoja hiilihydraatteja ei ole saatavilla. Niin pitkään, kun elimistöä hemmotellaan herkullisilla sokereilla, rasvasolujen purkaminen energiaksi ei pääse alkamaan. Oleellista on veren insuliinipitoisuus. Kun veressä on insuliinia, glukagonia ei vapaudu. Glukagoni kuitenkin on välttämätön hormoni sokeri- ja rasvavarastojen purkamisessa. Vasta kun glukoosi loppuu ja insuliinin määrä laskee, glukagoni aloittaa rasvan muuttamisen energianlähteeksi kelpaavaan muotoon.

Käytännössä myös kaloreita rajoittamalla (vähärasvaisella) ruokavaliolla päästään samaan, mutta siinä hiilihydraateilla ”tekohengitetään” sokeripolttoista konetta, joten laihtuminen on ensimmäisten kuukausien aikana hitaampaa, ja nälkä sekä ruokaan liittyvät mielihalut suurempia. Myös vähärasvainen ruokavalio pakottaa elimistön turvautumaan varastorasvoihin, mutta hitaammin, koska helppoa glukoosia tarjotaan kokoa ajan.

Totesin aiemmin, että ketogeeninen ruokavalio ei ole suositeltava tyypin 1 diabetesta sairastaville. Ketoasidoosin riski siinä on suurempi kuin terveillä ja tyypin 2 diabetesta sairastavilla.

Tyypin 1 diabetesta sairastavat voivat hieman vähentää hiilihydraattien saantia välttääkseen verensokerin piikkejä, mutta vähähiilihydraattisella ruokavaliolla ei kannata leikkiä. Diabetes on hyvin vakava sairaus ja hiilihydraatit tyypin 1 diabeteksessa voivat olla elämän ja kuoleman asia.

Ketoosi

  • Ketoosi käynnistyy, kun elimistöllä ei ole riittävästi glukoosia solujen energiantuotantoon
  • Ketoosissa varastorasvoja muutetaan solujen energianlähteeksi kelpaaviksi ketoaineiksi
  • Ketoaineet ovat happoja ja niiden lisääntyminen lisää veren happamuutta
  • Hallitsematon ketoosi tyypin 1 diabetesta sairastavilla voi johtaa ketoasidoosiin eli happomyrkytykseen, joka on diabetesta sairastavalle hengenvaarallinen tila.

Onko LCHF sitten terveellistä?

On ja ei ole. Jos ketogeeniseen ruokavalioon saa lisättyä välttämättömät ravintoaineet, kuituja ja antioksidantteja, ketogeeninen ruokavalio voi olla hyvin terveellinen. Jos ruokavaliosta karsii kaikki kasvikset ja syö vain rasvaa ja proteiineja, se ei ole pidemmän päälle hyväksi. LCHF saattaa vaikuttaa suotuisasti esimerkiksi:

  • sydän- ja verisuonitauteihin
  • diabetekseen
  • metaboliseen oireyhtymään
  • aivojen terveyteen
  • kolesteroliarvoihin
  • verensokeriarvoihin
  • verenpaineeseen

Terveyshyödyt ovat seurausta terveellisempien ruokavalintojen, laihtumisen ja elimistön hiljaisen tulehduksen helpottamisen yhteisvaikutuksesta. Kuitujen ja hyvien rasvojen lähteeksi suosittelen esimerkiksi chia-siemeniä.

Ketogeenistä ruokavaliota hyödynnetään lääkärin valvonnassa epilepsiaa sairastavien lasten hoidossa, sillä se vähentää sellaisten lasten epileptisiä kohtauksia, joilla muista hoidoista ja lääkkeistä ei ole apua. On jonkin verran tutkimusnäyttöä myös siitä, että aikuiset epileptikot hyötyvät ketogeenisen ruokavalion noudattamisesta, mutta tämä edellyttää laajempia ja kattavampia tutkimuksia.

Ketoosi ja diabetes

Diabeetikoilla ketoosi kertoo siitä, että veressä ei ole riittävästi insuliinia glukoosin prosessoimiseen. Virtsanäytteen ketoaineet kertovat, että potilaan diabetes-hoidot eivät pure toivotulla tavalla.

Tyypin 2 diabetesta (non-insulin dependent diabetes eli NIDDM) sairastaville voidaan suositella ketogeenistä ruokavaliota. Heillä haima tuottaa yhä jonkin verran insuliinia, mutta solut eivät pysty hyödyntämään insuliinia tehokkaasti sokeriaineenvaihdunnassa.

Ketogeenisessä ruokavaliossa ravinnon sisältämien hiilihydraattien määrää vähennetään. Hiilihydraattien vähentämisen tarkoitus on laskea veren glukoositasoja. Kaikki hiilihydraatit muutetaan glukoosiksi tai tuhansista glukoosimolekyyleistä muodostuviksi glykogeeneiksi. Hiilihydraatit siis kohottavat veren sokeripitoisuutta.

Ketogeenistä ruokavaliota noudattavien diabeetikkojen on seurattava tunnollisesti veren ketoaineiden tasoja. Jos ketoaineiden määrä nousee liian korkeaksi, seurauksena voi olla ketoasidoosi.

Ketoosissa ketoaineiden määrä on noin kymmenesosa ketoasidoosiin verrattuna. Tyypin 1 diabetesta sairastavien riski saada ketoasidoosi on merkittävästi suurempi kuin tyypin 2 diabetesta sairastavilla.

Ketoasidoosi

Ketoasidoosissa veren ketoaineiden määrät nousevat poikkeuksellisen korkeiksi ja myrkyttävät elimistöä. Tämä on äärimmäisen vakava tila, joka diabeetikoilla edellyttää lääkärin hoitoa.

Ketoasidoosin voi laukaista useampikin tekijä. Usein siihen vaikuttaa jokin sairaus ja sen seurauksena häiriintynyt hormonien tuotanto, jolloin insuliinin vastavaikuttajia voi muodostua normaalia enemmän.

Ketoasidoosi voi myös aiheutua liian vähäisestä insuliinilääkityksestä tai

  • huumeiden käytön
  • stressin
  • fyysisen vamman
  • leikkauksen

seurauksena. Ketoasidoosi on selvästi yleisempi tyypin 1 diabetesta sairastavilla, koska näillä haima ei tuota insuliinia.

Ketoasidoosin varhaisia oireita ovat:

  • vatsakipu
  • sekavuus ja keskittymisvaikeudet
  • kuiva ja punoittava iho
  • kova jano ja kuiva suu
  • makeahkolta tai hedelmäiseltä haiseva hengitys
  • lisääntynyt virtsaamistarve
  • pahoinvointi ja oksentelu
  • hengen ahdistus, nopea hengitys

Esidiabetes: Mitä syödä ja mitä vältellä?

Diabeteksen ehkäisyyn tähtäävä ohjelma (Diabetes Prevention Program) on osoittanut, että laihtuminen laskee diabeteksen riskiä 16 % jokaista vuodessa laihdutettua painokiloa kohden.

Perinteisesti esidiabetekseen sairastuneita kehotetaan syömään vähärasvaisia, vähäkalorisia ja runsaasti kuituja sisältäviä ruokia. Onko sellainen hyvä ruokavalio? Ravinnosta saadun kokonaisenergian vähentäminen laihduttaa ja ylläpitää kyllä terveyttä.

Jo muutaman kilon karistaminen elopainosta laskee huomattavasti diabeteksen riskiä. Vuonna 2001 julkaistu suomalainen diabeteksen ehkäisytutkimus osoitti, miten esidiabetes-vaiheessa diabeteksen syntyä voidaan ehkäistä. Tutkimuksessa seurattiin 500 esidiabetes-diagnosoitua lihavaa henkilöä. Puolet heistä sai ohjausta- ravinto ja liikuntatottumuksiin ja puolet toimi vertailuryhmänä. Koeryhmän tavoitteina oli: 5 prosentin painonpudotus, ruoan rasvan vähentäminen (alle 30 prosenttiin päivittäisestä energiasta), kovien rasvojen välttäminen ja vähärasvaisten tuotteiden suosiminen, ravinnon kuitujen lisääminen (täysjyväviljat) ja kohtuullinen liikkuminen (esim. puolen tunnin kävelylenkki päivittäin). Vuoden seurannan jälkeen koeryhmä oli laihtunut 4 kiloa enemmän kuin vertailuryhmä. Neljän vuoden seurannan jälkeen diabetes todettiin koeryhmässä 11:lla ja vertailuryhmässä 23:lla.

Esidiabetes ja diabetes

Terveillä paaston verensokeri on aamulla vähintään 8 tunnin syömättömyyden jälkeen alle 6 mmol/l tasolla, eikä verensokeri nouse laboratoriossa tehtävässä sokerirasitustestissä yli 7,7 mmol/l.

Esidiabeteksessa aamun paastoverensokeri on välillä 6,1-6,9 mmol/l tai kun verensokeri nousee sokerirasitustestissä välille 7,8-11,0 mmol/l.

Diabeteksessa paaston verensokeri (IP-gluc) on aamulla 7 mmol/l tai korkeampi kahtena eri päivänä tai verensokeri sokerirasitustestissä ylittää arvon 11,0 mmol.

Niin kutsuttu ”pitkäaikaissokeri” voidaan mitata verinäytteestä määrittämällä veren punasolujen hemoglobiinin sokeroituminen sokerihemoglobiini- eli HBA1c-kokeessa. Tämä kuvaa noin parin kuukauden verensokeritasoa. Jos HBA-1c on yli 48 mmol/mol, todetaan diabetes.

Glykeeminen indeksi ja glykeeminen kuorma

Glykeeminen indeksi (GI) kuvaa ruoka-aineen imeytyvien hiilihydraattien aiheuttamaa muutosta verensokerissa verrattuna referenssiruoka-aineeseen. Tällä pyritään seuraamaan hiilihydraattien imeytymisnopeutta. Suuri GGI tarkoittaa sitä, että verensokeri nousee nopeasti ja vereen vapautuu paljon insuliinia. Pieni GI kertoo hiilihydraatin tasaisemmasta imeytymisestä ja vähäisemmästä vaikutuksesta verensokeriin. Korkean glykeemisen indeksin elintarvikkeita ovat mm. perunat, valkoinen riisi, leipä, keksit, makeiset, sokeri jne.

Verensokeria säätelee monet tekijät. Elimistö pyrkii ylläpitämään tasaista verensokeria sillä, että maksan glykogeeneista vapautuu glukagonin vaikutuksesta glukoosia verenkiertoon aterioiden välillä. Syöminen kohottaa verensokeria, jolloin haimasta vapautuu insuliinia verenkiertoon. Insuliini pysäyttää maksan glykogeenien purkamisen ja käynnistää sokerivarastojen täydentämisen.

GI-taulukko (100 kuvaa suurinta vaikutusta verensokeriin. GI 0 ei vaikuta verensokeriin)

Ruoka-aine GI Ruoka-aineen määrä, joka
sisältää 50 g hiilihydraattia
Hiilihydraattien määrä
100 g:ssa ruoka-ainetta
GK/ 100 g ruoka-ainetta
A                   
Ananas 81 462 11 9
Appelsiini 58 545 9 5
Appelsiinimehu 63 481 10 6
B
Banaani 72 250 20 14
Bataatti 77 268 19 15
C
Cashewpähkinät 30 192 26 8
Cornflakes 112 58 87 97
Croissant (voisarvi) 92 110 46 43
D
Dextrosol-rypälesokeri 146 55 91 133
G
Greippi 35 545 9 3
Greippimehu 66 625 8 5
H
Hapanleipä, ruis- 83 100 50 42
Hedelmäsokeri (fruktoosi) 26 50 100 26
Herneet, tuoreet 66 571 9 6
Hunaja 76 69 72 55
J
Jogurtti, kevyt,
hedelmiä ja sokeria
46 323 16 7
K
Kaali 99 750 7 7
Kauralese 76 100 12 9
Kauraryynipuuro 80 568 9 7
Kiivi 73 500 10 7
Kikherneet 39 250 20 8
Kirsikka 30 500 10 3
Ksylitoli 11 50 100 11
Kurpitsa keitetty 104 1000 5 5
Kuskus 90 431 12 11
L
Laktoosi 63 50 100 63
Lanttu 99 750 7 7
Leipä, hampurilais- 84 100 50 42
Leipä, täysjyväruis- 80 107 47 38
Linssit, punaiset 36 417 12 4
Linssit, vihreät 41 441 11 5
Luumu 54 500 10 5
M
Maapähkinät 19 417 12 2
Maissi, pakaste 67 270 18 67
Maissi, tuore 73 234 21 15
Maito, 0,5 % 44 962 5 2
Maito, 0,1 % 44 962 5 2
Makaronit 65 188 27 18
Mango 70 353 14 10
Mansikat 55 2000 3 2
N
Nektari 94 500 10 9
Nuudelit, mungopapu- 46 200 25 11
Nuudelit, pika- 65 225 22 14
Nuudelit, riisi- 84 231 22 19
Näkkileipä 95 63 79 75
O
Ohraleipä, täysjyvä- 39-66 100 50 20-33
Omena 52 400 13 7
Omenamehu 55 431 12 7
P
Pannukakut 92 69 73 67
Papaija 81 353 14 11
Patonki 131 100 50 66
Pavut, kidney- 39 300 17 7
Pavut, säilykekidney- 72 441 11 8
Pavut, mung- 43 441 11 5
Pavut, idätetyt mung- 35 441 11 4
Pavut, musta- 28 300 17 5
Pavut, mustasilmä- 58 250 20 12
Pavut, pinto- 54 288 17 9
Pavut, ruskeat 33 100 50 17
Pavut, soija- 25 1250 4 1
Pavut, säilykesoija- 19 1250 4 1
Pavut, valkoiset,
tomaattikastikkeessa
66 500 10 7
Pavut, vihreät 52 242 21 11
Persikka 58 545 9 5
Persikka, säilyke sokeriliemessä 79 353 14 11
Peruna, keitetty, jauhoinen 90 300 17 15
Peruna, keitetty, kiinteä 80 300 17 14
Peruna, raaka 79 357 14 11
Perunamuusi 102 375 13 13
Porkkana, keitetty 80 667 8 6
Porkkana, raaka 22 500 10 2
Porkkanamehu 59 543 9 5
Popcorn 99 91 55 55
Punajuuri 88 571 9 8
Päärynä 52 545 9 5
R
Ranskalaiset perunat 104 259 19 20
Riisi, basmati- 80 197 25 20
Riisi, esikeitetty 65 208 24 16
Riisi, jasmin- 150 179 28 42
Riisikakut 126 60 83 104
Ruisleipä, kokojyvä- 69 125 40 28
Ruisleipä, pellavansiemenillä 57 78 100 50
Ruisleipä, täysjyvä- 89 100 50 45
Rusinat 88 68 73 64
Rypäleet 63 333 15 10
Rypälesokeri (glukoosi) 138 50 100 138
S
Soijamaito, kevyt- 61 735 7 4
Soijamaito, täys- 55 694 7 4
Sokeri 94 50 100 94
Spagetti, keitetty 10 – 15 min. 59 188 27 16
Spagetti, täysjyvä- 51 214 23 12
Sushi 72 135 37 27
T
Taatelit, kuivatut 142 75 67 95
Tattari 75 205 20 15
Tomaattimehu 52 1389 4 2
U
Uuniperuna 117 250 20 23
V
Vesimeloni 99 1000 5 5
Viikunat, kuivatut 84 15 43 36
Viili 15 136 4 1
Viinimarjat 30 500 10 3
Vohvelit 105 135 37 39

Taulukon lähde: Keittotaito

Glykeeminen indeksi on hyödyllinen työkalu hiilihydraattien ja niiden vaikutusten arviointiin. Esidiabetesta ja diabetesta sairastavien on tärkeää seurata hiilihydraattien määrää ja laatua. Mitä korkeampi GI, sitä nopeammin hiilihydraatit nostavat verensokeria.

Glykeeminen kuorma (glycemic load /GL)

Glykeeminen kuorma määrittelee ravinnon sisältämien hiilihydraattien laatua ja määrää. Sitä voidaan hyödyntää, kun lasketaan aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen. Pelkkä GI ei kerro koko totuutta. Vähäisellä määrällä korkean GI-arvon ruokia ei ole suurta vaikutusta verensokeriin, ja siksi on tärkeämpää arvioida koko aterian vaikutusta verensokeriin ja insuliinivasteeseen eli glykeemista kuormaa. GL lasketaan seuraavasti:

GI x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa arvioitaessa lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Mitä tämä tarkoittaa?

Täysjyväviljat ja runsaasti kuitua sisältävät ravintoaineet imeytyvät ruoansulatuskanavasta verenkiertoon hitaammin kuin ”nopeat hiilihydraatit”. Elimistö prosessoi sokerit ja raffinoidut hiilihydraatit nopeasti. Se kohottaa verensokerin nopeasti.

Korkea verensokeri ja happomyrkytys

Korkea verensokeri eli hyperglykemia aiheuttaa yleensä väsymystä, janon tunnetta, lisääntynyttä virtsaamistarvetta, pahoinvointia ja kuivumista. Pitkään jatkuessaan korkea verensokeri lisää riskiä sairastua diabeteksen lisäsairauksiin. Korkea verensokeri on 10-13,9 mmol/l ja hyvin korkea verensokeri yli 13,9 mmol/l.

Rasvahappojen aineenvaihdunta tuottaa ketoaineita, eli beetahydroksivoihappoa, asetetikkahappoa ja asetonia. Näiden määrä kasvaa elimistössä paastotilassa ja insuliininpuutoksen seurauksena. Ketoaineiden tuotanto on elimistön luontainen prosessi, mutta diabeetikoilla insuliinin puute voi johtaa elimistön happamoitumiseen ja happomyrkytykseen eli ketoasidoosiin, joka diabeetikoilla voi olla hengenvaarallinen tila. Ketoosi ja ketoasidoosi ovat kaksi eri asiaa.

Esidiabetesta sairastavien on tärkeää välttää sokeripiikkejä.

  • ruoat, joiden GI on 55 tai vähemmän, nostavat verensokeria hitaasti
  • ruoat, joiden GI on 56-69, kohottavat verensokeri keskinopeasti
  • ruoat, joiden GI on 70 tai suurempi, nostavat verensokeria nopeasti
  • Puhtaiden (raffinoitujen) sokereiden GI on yleensä korkeampi kuin luonnollisia sokereita sisältävien elintarvikkeiden, kuten hedelmien GI.
  • Täysjyväviljojen GI on matalampi kuin raffinoitujenviljojen GI.
  • Bataattien, useimpien vihannesten ja palkokasvien GI on pienempi kuin tärkkelystä sisältävien perunoiden ja maissin GI.
  • Hedelmien kypsyminen lisää hedelmän sokeripitoisuutta ja GI-arvoa.
  • Pastojen tärkkelyssidokset voivat olla sellaisia, että niillä on matalahko GI.
  • Esikiehautetun (parboiled) riisin, basmati-riisin ja täysjyväriisin GI on pienempi kuin lyhytjyväisten puuroriisien ja jasmiiniriisin GI.

Hiilihydraattien laskeminen

Hiilihydraattimäärien laskeminen voi helpottaa ruokavalion seuraamista. Hiilihydraattien täydellinen poistaminen ruokavaliosta ei ole suositeltavaa, sillä monet hiilihydraatteja sisältävät vihannekset sisältävät tärkeitä terveyttä ylläpitäviä ravintoaineita.

Toisaalta monet vähän hiilihydraatteja sisältävät ravintoaineet voivat korvata runsaasti hiilihydraatteja sisältävät ravintoaineet.

Esimerkiksi:

Seuraavat ruoat sisältävät runsaasti tärkkelystä eli hiilihydraatteja:

  • perunat
  • pavut ja linssit
  • riisi
  • viljat
  • maissi

Paljon hiilihydraatteja sisältävät kasvikset voi korvata mm. seuraavilla ravinne- ja kuitupitoisilla vähän hiilihydraatteja sisältävillä kasviksilla:

  • parsa
  • parsakaali
  • porkkanat (vähän)
  • selleri
  • vihreät pavut
  • salaatit ja tummanvihreät lehtivihannekset
  • paprika
  • pinaatti
  • tomaatti
  • kesäkurpitsa

Syö tasaisin väliajoin

Esidiabetesta sairastavan tulee pitää verensokeri mahdollisimman tasaisena.

Paastoaminen voi vaikuttaa merkittävästi verensokeritasoihin, joten pienet matalan- tai keskitason GI-arvon omaavat ruoat tasaisesti pitkin päivää pitävät verensokerin tasaisena ilman suuria piikkejä.

Asiantuntijat suosittelevat:

  • syömään kolmesti päivässä. Aterioiden välillä ei tulisi olla yli 6 tunnin jaksoa.
  • syömään tasapainoisesti ravinteiltaan rikasta, sopivassa suhteessa hiilihydraatteja, rasvoja ja proteiineja sisältävää ruokaa

Lautasmalli

Yksi tapa syödä terveellisesti ja tasapainoisesti on ns. lautasmalli, jota Yhdysvalloissa suosittelee paikallinen Diabetesliitto. Siinä puolet lautasesta täytetään vihanneksilla, neljännes proteiinia sisältävillä ruoka-aineilla ja neljännes hiilihydraateilla, kuten ruskealla riisillä tai kvinoalla.

Lautasmallissa jokaisen aterian tulee sisältää kolmea seuraavista neljästä ruoka-aineryhmästä.

  • hedelmä tai vihannekset
  • täysjyväviljat
  • maito- ja meijerituotteet
  • liha, kala, palkokasvit, linssit tms.

Laihtumisessa auttaa terveellisen ruokavalion lisäksi pienempi lautanen ja se, että välttää santsaamista ja ähkyksi syömistä.

DASH-dieetti

DASH on laajalti suositeltu ja terveelliseksi todettu ruokavalio. Sen tiedetään laskevan verenpainetta, mutta se voi myös ehkäistä diabetesta seuraamalla yhtäältä hiilihydraattien saantia ja toisaalta ravintoaineiden glykeemistä indeksiä.

DASH ei perustu kaloreiden vähentämiseen, vaan terveellisiin valintoihin.

DASH suosittelee syömään:

  • vihanneksia
  • hedelmiä
  • täysjyväviljoja
  • rasvattomia tai vähärasvaisia meijerituotteita
  • kalaa
  • siipikarjaa
  • papuja
  • pähkinöitä
  • kasvisöljyjä

Vältettäviä ruokia DASH-ruokavaliossa ovat esimerkiksi:

  • rasvaiset lihat
  • täysirasvaiset meijerituotteet
  • trooppiset öljyt, kuten kookosöljy ja palmuöljy
  • makeiset
  • vaaleat leivät
  • leivonnaiset, snacksit, keksit
  • makeat juomat

Pahoittelut, jos tekstiin jäi ylettömästi toistoa, asia- ja/tai kirjoitusvirheitä. Siinä oli tiistain ja keskiviikon välisen yön anti Ruokasodalle. Ehkä tuosta jotain oppi. Jokseenkin noin homma toimii ketogeenisen ruokavalion ja diabeteksen kanssa, mutta toki asioita  voi käsitellä toisesta näkövinkkelistä ja laajemminkin.

Ravitsemuksen osalta konsensuksen löytäminen on mahdotonta. Todetaan siis sama, mitä totesin aiemmin: On monta tapaa syödä oikein ja monta tapaa syödä väärin.

Kuvat: Pixabay tai ja huonommat kuvat ovat omia




Ketoherkut: Lassaka

Lassaka on vähähiilihydraattinen ja ihanan rasvainen ketoherkku. Ruoka on lasagnen ja moussakan kesäkurpitsapohjainen variaatio. Lassaka maistuu myös useimmille ketoilua vierastaville. Tästä on olemassa monenlaisia versioita. Tämä on yksi:


Raaka-aineet


Kesäkurpitsa
Sipuli
Valkosipuli
Chili
Paprika
Jauheliha
Kerma
Tomaattipyre tai -murska
Mozzarella tai Emmental-raaste
Suola, pippuri, oregano


Ohje


Viipaloi ja itketä kesäkurpitsat. Itkettäminen kannattaa, sillä kesäkurpitsat sisältävät niin paljon nestettä, että jos sitä ei poista, tuloksena on keitto. Eli levitä viipaloidut kesäkurpitsat liinalle ja ripottele päälle suolaa. Viipaleet kannattaa pyyhkäistä kuiviksi ennen käyttöä.


Silppua sipuli, valkosipulia (maun mukaan), chili ja puolikas paprika.


Ruskista jauheliha. Mausta suolalla ja pippurilla ja lisää silputut sipulit, valkosipulit, paprikat ja chili. Chilin voi korvata silputulla jalapenolla. Paista hetkinen ja lisää tomaattipyre tai murska. Täyte kannattaa keittää hyvin kokoon. Lopuksi täytteeseen voi lisätä reilusti oreganoa.


Perinteisen valkokastikkeen tilalla on kermasta ja mozzarellasta tehty kastike,joka maustetaan suolalla ja pippurilla. Erittäin kivan vivahteen antaa feta ja sinihomejuusto, joita voi lisätä maun mukaan kermaan.


Hifistelijöillä on varmasti jokin tiukka järjestys, jossa ainekset ladotaan uunivuokaan. Minä laitoin kolmessa kerroksessa keskurpitsaa, jauhelihatäytettä ja mozzarellakastiketta. Lopun mozzarella kerman lorottelin vuoan päälle ja lisäsin vielä reilusti juustoraastetta.

Lassakaa paistetaan 200-asteisessa uunissa 30-45 minuuttia tai kunnes juustokuorrutus on saanut kauniin kullanruskean värin.




Mitä, miten ja miksi LCHF-ruokavalio?

Mitä, miten ja miksi LCHF`Vähän hiilihydraatteja ja runsaasti rasvoja sisältävässä ruokavaliossa (LCHF) hiilihydraattien saantia korvataan hyvillä rasvoilla. LCHF-ruokavaliot (ketogeeninen ruokavalio ja Atkinsin dieetti) ovat suosittuja etenkin laihduttajien keskuudessa, sillä ne laihduttavat nopeasti ja tehokkaasti.

Vähän hiilihydraatteja sisältävässä ruokavaliossa elimistö opetetaan käyttämään energianlähteenä sekä ravinnosta saatua että rasvasoluihin varastoitua rasvaa, josta aineenvaihdunta valmistaa energiaravinteiksi kelpaavia ketoaineita.

Lääketieteellisesti suhtautuminen LCHF-dieetteihin on hyvin kaksijakoinen. Perinteisemmän rasvateorian mukaan rasvat ovat syypäitä lähes kaikkiin terveysongelmiin ja kaikkiin maailman muihinkin ongelmiin nälänhädästä Antti Rinteen hallitukseen.

Kasvavan tutkimusaineisto haastaa perinteiset ja fakkiutuneet opit rasvojen haitallisuudesta. Yleistä tieteellistä konsensusta rasvojen terveyshaitoista ja -hyödyistä ei kuitenkaan vallitse.


Miten noin niin kuin aikuisten oikeasti? Kannattaako ketoilu?


Täällä Ruokasodan ketonurkkauksessa haluan tarjota objektiivisen ja kattavan kuvan ketogeenisistä ruokavalioista, Atkinsin dieetistä ja muista pahamaineisista moraalia ja terveyttä turmelevista LCHF-ruokavalioista. Yritän tarjota terveellisiä LCHF-reseptejä ja vinkkejä ketoiluun. Katsotaan kuin tämä etenee.

Lähdin tähän seikkailuun 02.12.2019. Aiemmat kokemukseni vähähiilihydraattisesta ruokavaliosta olivat hyvin rohkaisevia, mutta niistä on jo vuosia. Sen jälkeen vyötärönympärys on harpannut kolme paitakokoa ja paino 20 kiloa. Tervetuloa mukaan!

Asetun itse ruokavalion keskiöön koekaniiniksi. Kommentoin ketonurkkauksessa viimeaikaista keskustelua ketogeeenisten ruokavalioiden ympärillä, tuoreita tutkimuksia ja uutisia sekä omia havaintojani. Lähtöpainoni on 92 kg ja vyötärölihavuus alkaa olla hengenvaarallisella tasolla. Lisäksi sairastan etenevää multippeliskleroosia, mikä vaikuttaa fyysiseen aktiivisuuteen sitomalla minut käytännössä tuoliin. Tavoitepainoni on 72 kg. Verenpaineeni ovat nyt riskirajoilla (keskimäärin 80-90 alapaine ja yläpaine 135-150 tasolla).

Vähän hiilihydraatteja, mutta runsaasti rasvaa ja proteiineja sisältävä ruokavalio ylläpitää kylläisyyden tunnetta hiilihydraatteja paremmin. Tämän seurauksena ravinnosta saatu kokonaisenergia yleensä laskee, mikä edistää laihtumista. Kaikissa ruokavalioissa on kuitenkin muistettava turvata välttämättömien ravintoaineiden saanti. Se on terveyden kannalta olennaista.

Laihtumisen lisäksi LCHF-dieetti auttaa ylläpitämään terveyttä, kuten European Journal of Clinical Nutrition kertoo katsauksessaan. Tuoreiden tutkimusten valossa LCHF-ruokavaliolla on suotuisia vaikutuksia

  • aikuistyypin diabetekseen
  • eräisiin syöpiin
  • munasarjojen monirakkulaoireyhtymään (PCOS)
  • Alzheimerin tautiin
  • sydämen terveydelle
  • etenevään multippeliskleroosiin

Varoituksen sana on paikallaan: tutkimukset ovat antaneet ristiriitaisia tuloksia LCHF-ruokavalioiden terveysvaikutuksista. Vähän hiilihydraatteja, kohtuullisesti proteiineja ja runsaasti rasvoja sisältävien ruokavalioiden pitkäaikaisvaikutuksia ei vielä tunneta.

Lääketieteellisessä Lancet-julkaisussa esitetyn tutkimuksen mukaan LCHF lisää kuolleisuutta kaikkiin syihin, mutta sama ilmiö toteutuu U-käyrän toisessa päässä; myös eniten hiilihydraatteja syövien kuolleisuus kasvaa saman tutkimuksen perusteella verrokkeihin nähden. Mistä tällainen voisi johtua?

On luultavaa ja jopa todennäköistä, että molemmissa ääripäissä ruokavalion yksipuolisuuden vuoksi syntyy puutoksia välttämättömistä ravintoaineista. Erään toisen tutkimuksen mukaan terveyden kannalta tärkeintä ei ole se, kuinka monta pizzaa tai hampurilaista syö, vaan se, että samalla saa kaikki välttämättömät ravintoaineet. Välttämättömien ravintoaineiden merkitystä terveydelle ei voi korostaa liikaa.

On jännä, että varsin monille LCHF-ruokavalio on punainen vaate, joka herättää suoranaista raivoa. Samanlainen vihainen asennoituminen on havaittavissa suhtautumisesta kasvisruokaan, lihan rajoittamiseen, vegaanisuuteen ja paleo-dieetin noudattamiseen. Yhteistä kaikille näille ruokavalioille on se, että niillä pyritään ylläpitämään terveyttä. Jonkin rajatun ruokavalion noudattaminen johtaa nopeasti paljon syvällisempään ravintoaineiden ja aineenvaihdunnan ymmärtämiseen, kuin mihin raivokkaimmat ruokavalioiden vastustajat koskaan yltävät. Miksi sortua trendikkäisiin ruokavalioihin, jotka muuttuvat nopeammin kuin muoti?

En halua asettaa ruokavalioita paremmuusjärjestykseen. Useimmat niistä painottavat välttämättömien ravintoaineiden saantia ja karsivat epäterveellisiä tai elimistön kannalta turhia ravintoaineita pois. On valtavasti tutkimusnäyttöä siitä, että esimerkiksi kasvisruokavaliot ja vegaanisuus ovat oikein noudatettuina hyvin terveellisiä.


Tärkeimmät syyt miettiä mitä suuhunsa laittaa ovat


Aikuistyypin diabetes

The International Diabetes Federation arvioi maailmanlaajuisesti aikuistyypin diabetekseen sairastuneiden määräksi yli 400 miljoonaa vuonna2015. Sairastuneiden määrä lisääntyy nopeasti.

Tutkimusten mukaan Yhdysvalloissa esidiabetesta sairastaa yksi kolmesta aikuisesta ja yhdeksän kymmenestä esidiabetesta sairastavasta ei tiedä olevansa sairas ennen kuin esidiabetes pahenee diabetekseksi. Pelkästään Yhdysvalloissa aikuistyypin diabetesta sairastavia on lähemmäksi 10 % väestöstä ja joka vuosi diagnosoidaan 1,4 miljoonaa uutta sairastunutta. Yhdysvalloissa diabeteksen hoitomenot olivat 245 miljardia dollaria vuonna 2012 ja kasvavat vuosittain.

Maailmanlaajuisesti diabetes aiheutti arviolta 1,5 miljoonaa ennenaikaista kuolemantapausta vuonna 2012. Sairastuneiden määrä, hoidon hinta ja kuolleisuus lisääntyvät joka vuosi.

Tyypin 2 diabetes on elintaso- ja elintapasairaus, johon vaikuttavat mm. lihavuus (erityisesti vyötärölihavuus), ikä, vähäinen liikunta ja huonot ravitsemustottumukset. Tutkimusten mukaan LCHF-ruokavaliot pienentävät sairastumisen riskiä ja vähentävät aikuistyypin diabetesta sairastavien lääkkeiden tarvetta. Esimerkiksi Ruotsissa LCHF on aikuistyypin diabeteksen hoidossa hyväksytty ruokavalio.


Lihavuus

Lihominen on maailmanlaajuinen ongelma. Se tappaa jo enemmän ihmisiä kuin aliravitsemus. Vuoden 1975 jälkeen lihavien määrä on kolminkertaistunut. Ylipainoisia aikuisia maailman väestöstä oli vuonna 2016 yli 1,9 miljardia. Näistä 650 miljoonaa eli 39 % oli lihavia. Alle 5-vuotiaista lapsista jopa 41 miljoonaa ja 5-19-vuotiaista 340 miljoonaa oli samana vuonna ylipainoisia tai lihavia. Luvut ovat käsittämättömiä. (WHO)

WHO:n mukaan ylipainoisia ovat ihmiset, joiden BMI (painoindeksi) on 25 tai suurempi. Lihavia ovat ihmiset, joiden BMI on 30 tai suurempi.

Lihavuus on lisääntynyt dramaattisesti. Lihavien ja ylipainosten osuus lapsista oli 4 % vuonna 1975. Nyt lapsista lähes viidennes (18 %) on ylipainoisia tai lihavia. Vuonna 1975 ylipainoisten ja lihavien 5-19-vuotiaiden osuus ikäryhmässä oli vain 1 %, vuonna 2016 saman ikäisten ylipainoisten ja lihavien osuus oli ikäryhmän tytöistä 6 % ja pojista 8 %.

Lihavuus kasvattaa mm. sydän- ja verisuonitautien, metabolisen oireyhtymän, aikuistyypin diabeteksen, syöpien, luunmurtumien ja erilaisten nivel- ja selkävaivojen sekä ennenaikaisen kuoleman riskiä.


Suolistotulehdukset (ärtyvän suolen oireyhtymä eli IBS)

Ärtyvän suolen oireyhtymä (IBS) vaivaa jopa 10-15 prosenttia maailman aikuisväestöstä. IBS ei sinänsä ole hengenvaarallinen sairaus, mutta sen vaikutukset elämänlaatuun ja terveydenhoidolliset kustannukset ovat merkittäviä. IBS on suurin sairauspoissaolopäivien syy tavallisen flunssan jälkeen.

Tulehdukselliset suolistosairaudet yleistyvät nopeasti. Suomessa myös paksusuolen syöpä lisääntyy, mutta lisääntymisen syytä ei tunneta.

Crohnin tauti ja haavainen paksusuolentulehdus ovat kroonisia suoliston tulehduksellisia sairauksia, jotka oireilevat mm. ripulina, verisenä ulosteena ja vatsakipuina. Molemmat edellyttävät perinnöllisen alttiuden sairastua, mutta sairastuminen käynnistyy usein jonkin infektion (kuten turistiripulin) tai stressin seurauksena. Riskitekijöitä ovat lisäksi runsaasti eläinperäistä proteiinia sisältävä ja rasvainen ruoka sekä D-vitamiinin puutos.

Ärtyvän suolen oireyhtymää sairastaa Suomessa jo noin 300 000 henkilöä ja esiintyvyys aikuisväestössä on 10 %. Diagnosoitujen keliakiatapausten ja tulehduksellisten suolistosairauksien esiintyvyys on 1 prosentin luokkaa molempien kohdalla.

Ärtyvän suolen oireyhtymän tavallisia oireita ovat: vatsan turvotus, vatsakipu sekä ummetus- ja ripulioireet. Oireiden taustalla voi olla mm.

Tavallista herkempi vatsan alueen kipuaistimus (alhainen kipukynnys)

  • Lisääntynyt kaasun tuotto paksusuolessa ja mahdollisesti ohutsuolessa
  • Häiriöitä suoliston mikrobitasapainossa
  • Matala-asteinen tulehdus suolessa
  • Suoliston voimakas ja kivulias supistelu tai suolen toiminnan laiskistuminen


    FODMAP-hiilihydraattien (fermentoituvien hiilihydraattien) rajoittaminen helpottaa viimeaikaisen tutkimusnäytön perusteella ärtyvän suolen oireyhtymää. FODMAP-hiilihydraatit ovat kasvikunnan tuotteissa esiintyviä huonosti ohutsuolessa imeytyviä kuitumaisia hiilihydraatteja. FODMAP-hiilihydraattien huono imeytyminen ohutsuolessa päästää näitä paksusuoleen, jossa ne fermentoituvat paksusuolen mikrobien vaikutuksesta. Fermentaatio on sinänsä aivan luonnollinen ja hyvä reaktio, mutta IBS-potilailla se aiheuttaa oireita.

    Laktoosi-intoleranteilla ihmisillä oireita aiheuttaa maitotuotteet. Ksylitoli, sorbitoli, laktitoli, maltitoli, mannitoli ja isomalti, luumut ja kivelliset hedelmät, omenat, sienet, raffinoosi, inuliini, vehnä, ruis, ohra, palkokasvit, sipulit, kaalikasvit ja vesimelonit, jogurtit ja fruktoosi selittävät oireita monilla ärtyvän suolen oireyhtymää sairastavilla.

Kesäkuussa 2009 Clinical Gastroenterology and Hepatology -lehdessä julkaistun tutkimusraportin mukaan hyvin vähän hiilihydraatteja sisältävä ruokavalio helpottaa ärtyvän suolen oireyhtymän oireita. On jonkin verran tieteellistä näyttöä siitä, että suolisto-oireet helpottavat LCHF-ruokavaliolla.

Alkoholista riippumaton rasvamaksa (NAFLD)

Alkoholista riippumaton rasvamaksa yleistyy nopeasti myös Suomessa. Maksan vähäinen rasvoittuminen ei välttämättä ole vaarallista, mutta se voi johtaa vakavampiin sairauksiin, kuten NASH (non-alcoholic steatohepatitis), jossa maksan rasvoittuminen assosioituu maksan tulehdukseen. Se voi johtaa maksan arpeutumiseen ja maksakirroosiin. Rasvamaksa ei välttämättä juuri oireile ennen kuin se pahenee maksatulehdukseksi.

NAFLD liittyy lihomiseen, metaboliseen oireyhtymään, esidiabetekseen ja aikuistyypin diabetekseen. Mikä maksan rasvoittumista aiheuttaa. Tästä vallitsee useita tieteellisesti perusteltuja näkemyksiä. Tutkimuksissa on havaittu, että vakavampaan NASH-tautiin vaikuttavat mm.

– Oksidatiivinen stressi
– Inflammaatio
– Maksasolujen nekroosi eli maksasolujen kuoleminen
– Rasvakudoksen inflammaatio
– Suoliston mikrobiomin epätasapaino (huono bakteerikanta)

Alkoholista riippumattoman rasvamaksan riskitekijöistä lihavuus on ylivoimainen ykkönen. Lihavista kahdella kolmanneksella on rasvoittunut maksa. Insuliiniresistenssi ja aikuistyypin diabetes sekä PCOS kasvattavat myös maksan rasvoittumisen riskiä.

Tehokkain tapa hoitaa rasvoittunutta maksaa on laihduttaminen. Myös lisättyjen sokereiden ja aivan erityisesti teollisen fruktoosisiirapin saannin vähentäminen päivittäisestä energiansaannista on järkevää, koska fruktoosin aineenvaihdunta tapahtuu maksassa ja pieni osa fruktoosista muutetaan aina triglyserideiksi maksassa.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävistä LCHF-ruokavalioista ja niiden terveysvaikutuksista voidaan toki olla montaa mieltä, mutta varmaa on se, että oheiset ravitsemukseen liittyvät epidemiana leviävät sairaudet eivät johdu siitä, että kourallinen ihmisiä rajoittaa hiilihydraatteja ja korvaa merkittävän osan päivän energiansaannista rasvoilla.

Jos LCHF ei paranna mainittuja sairauksia, on todennäköistä, että oksidatiivisen stressin ja inflammaation hillitseminen sekä laihtuminen helpottavat oheisten sairauksien oireita ja laskevat sairastumisriskiä LCHF-ruokavaliolla.

Nykyiset elintavat, energiatiheät ja ravitsemukseltaan köyhät ruoat sekä stressi ja jatkuva kiire ylläpitävät ja levittävät lihavuusepidemiaa, metabolista oireyhtymää, suolistosairauksia, diabetesta, rasvamaksaa jne. Siksi mikä tahansa ruokavalio kasvisruokavaliosta välimerelliseen tai LCHF-ruokavalioon sekä ymmärrys ravintoaineista ja aineenvaihdunnasta voi laskea sairastumisen riskiä ja ylläpitää terveyttä ja terveellistä painonhallintaa.

Joskus lääketieteessä tuntuu olevan vallalla ajatus, että jos auto liikkuu, ei autolla kannata ajaa ennen kuin tiedetään mihin sen liikkuminen perustuu. Tarvitaan siis lisää tutkimuksia. Se on hyvä asia. LCHF toimii ja sitä noudattavat ihmiset raportoivat jatkuvasti laihtumisesta ja terveyden kohenemisesta, mutta teoriassa sitä ei kannata noudattaa, koska vielä ei sataprosenttisesti ymmärretä, miksi se toimii. LCHF-ruokavalion pitkäaikaisvaikutuksista ei ole olemassa tutkittua tietoa ja siksi siihen suhtaudutaan vielä hyvin varovaisesti. Jokaisen on järkevää kuunnella ja seurata oman elimistönsä lähettämiä viestejä.

Ruokasotaa aloitellessani vuosia sitten uskoin, että jos kysyn oikeat kysymykset, löydän myös oikeat vastaukset. Nykyään olen paljon skeptisempi. Uskon, että ei ole oikeita kysymyksiä ja oikeita vastauksia. Kaikkiin lupauksiin, joita nettivideoissa ja kirjoituksissa annetaan, kannattaa suhtautua terveen skeptisesti.

Helppoja ja yleispäteviä vastauksia vaikeisiin kysymyksiin ei ole. LCHF ei ole ruokavalio, joka soveltuu kaikille tai parantaa kaikki vaivat. Se on tehokas laihdutusruokavalio, joka tutkimusten mukaan voi vähentää oksidatiivista stressiä ja inflammaatiota. Stanfordin yliopistossa tehdyn tutkimuksen mukaan sekä kaloreita rajoittamalla että runsaasti rasvaa sisältävällä ruokavaliolla laihtuu, mutta molemmissa tutkimusryhmissä esiintyi paljon vaihtelua seurattujen henkilöiden laihtumisen suhteen.

Kesäkurpitsanuudelit


Okei, miten aloitan?


Aineenvaihdunta on mutkikas järjestelmä. Ihmisten painonhallintaan vaikuttaa lukemattomia tekijöitä stressistä hormoneihin ja perinnölliseen lihomisalttiuteen. Jotkut eivät liho ja toiset keräävät varastorasvoja luokattoman helposti ja nopeasti. Toisaalta joillekin arkiliikunta ja tasapainoinen ruokavalio riittävät hyvän terveyden ylläpitoon, kun taas sairaalloisen lihavien laihtuminen vaikuttaa jo mahdottomalta.

Jörn Donner totesi, että lukeminen kannattaa aina. Hän oli oikeassa. Sama pätee laihduttamiseen ylipainoisilla. Laihtuminen parantaa terveyttä ja lisää terveitä elinvuosia. Se, miten ihminen laihtuu, on vähemmän tärkeää kuin se, että ihminen laihtuu. Tavallaan on ristiriitaista, että ihmisiä syyllistetään ja pelotellaan onnistumisesta, perustuu onnistuminen sitten vegaaniruokavalioon tai Atkinsin dieettiin. Jos ihmisen verenkuva, paino, verenpaine, verensokeri ja yleinen hyvinvointi kohenevat, onko sillä väliä, päästiinkö tulokseen LCHF-ruokavaliolla vai kasvisruokavaliolla.

Tärkeintä on, että ihminen saa ravinnostaan kaikki välttämättömät ravintoaineet. Laajemmin on havaittu, että vähemmän energiaa sisältävä ravinto (syödyistä makroravinteista riippumatta) ylläpitää terveyttä ja terveitä elinvuosia. Tämä johtunee sirtuiineista (histonideasetylaaseista). Esimerkiksi SIRT1 säätelee keskeisiä metabolisia prosesseja ja sillä on tärkeä merkitys aineenvaihdunnan säätelyssä.

SIRT1 säätelee mm. mitokondrioiden biogeneesiä sekä energia- ja rasvametaboliaa, oksidatiivista stressiä ja vaikuttaa esimerkiksi lihavuuteen ja diabetekseen. SIRT1 säätelee todennäköisesti tulehdusvaisteita ja kudosten atrofioitumista sitoutumalla NF-kB:en. SIRT2 vaikuttaa solunjakautumiseen.

Henkilöiden, jotka päättävät kohentaa terveyttä ja laihtua LCHF-ruokavalion avulla, on syytä syödä hiilihydraattirajoitteista riippumatta mahdollisimman monipuolisesti.

On jonkin verran tutkimusnäyttöä, jonka mukaan kasviperäisten proteiinien ja rasvojen saanti LCHF-ruokavaliossa ylläpitää terveyttä paremmin kuin eläinperäiset rasvat ja proteiinit. Ruokavalion sallimia kasviksia on hyvä syödä runsaasti. Niistä saa kuituja, antioksidantteja, polyfenoleita, vitamiineja, mineraaleja jne., joita elimistö tarvitsee. Rasva on LCHF-ruokavaliossa polttoaine, mutta keho tarvitsee myös aminohappoja, kuituja, vitamiineja jne.

Ensimmäinen ja kenties yksi tärkeimmistä ravintoon liittyvistä valinnoista koskee lisättyjen sokereiden, valkoisten jauhojen ja voimakkaasti raffinoitujen elintarvikkeiden välttämistä. Pelkästään tämä pieni muutos elämäntavoissa voi auttaa laihtumaan ja parantamaan yleistä hyvinvointia. Vaaleat leivät kannattaa korvata täysjyväviljoista leivottuihin leipiin, makeisista ja virvoitusjuomista on hyvä luopua kokonaan jne.

Minä en laske kaloreita tai hiilihydraatteja lainkaan. Tiedän suurin piirtein, mitä kasviksia voin syödä ja sen jälkeen seuraan vain omaa kylläisyyttäni. Luultavasti saan päivittäisestä energiastani nyt yli puolet rasvasta, 30 prosenttia proteiineista ja 10-20 % hiilihydraateista. Se ei aivan noudata ketogeenistä ruokavaliota tai Atkins-ruokavaliota, mutta toisaalta olen luopunut lisätyistä sokereista, runsaasti tärkkelystä sisältävistä perunoista ja riisistä sekä viljoista ja korvaan noiden rajoittamisen tuottaman energiavajeen rasvoilla.

Tämä on kolmas päivä ruokavaliomuutokseni jälkeen. Kaksi ateriaa päivässä on pitänyt minut kylläisenä ja energisenä kahtena ensimmäisenä päivänä. Olen syönyt lounasbrunssin puolen päivän tienoilla ja päivällisen 17-18 aikaan.

Molempien päivien ruoka on koostunut suuresta määrästä sallittuja kasviksia (tomaatit, kurkku, kaali, paprika, salaatti, kesäkurpitsa), rasvasta ja proteiinista (jauheliha, kana). Mitään välipaloja tms. ei ole tehnyt mieli. Yhtenä huomiona olen havainnut, että suoli on toimin poikkeuksellisen hyvin ja täsmällisesti. Se on ilahduttavaa, sillä minulla on ollut ärsyttäviä suolistovaivoja.

Eilinen ruoka (0.12.2019)

Heräsin viiden aikaan. Join aamun ja aamupäivän aikana 4 kupillista mustaa kahvia. En ole koskaan ollut aamupalan ystävä.

Nälkä tuli kello 11 ja 12 välillä, jolloin tein kanasalaattia lounaaksi. Salaattiin tuli jäävuorisalaattia, kurkkua, tomaatteja ja keitettyjä vihreitä papuja. Paistoin ja maustoin (pippurilla, suolalla ja chilillä) kanafileistä leikkaamani suikaleet runsaassa voissa. Tein majoneesin itse: 2 dl rypsiöljyä, muna, korkillinen etikkaa, 0,5 tl suolaa, 1 tl mustapippuria, 1 tl valkosipulijauhetta, 1 tl chilimurskaa öljyssä, 2 tl currya. Näin syntyy hyvin kiinteä majoneesi, jota pehmensin 1,5 desillä rasvaista maustamatonta turkkilaista jogurttia. Sekoitin ainekset keskenään ja hyvää tuli. Se oli lounas.

Iltapäivällä join melkoisesti vettä. Päivälliseksi tein ison täytetyn kesäkurpitsan, johon tuli täytteeksi mm. paistettua jauhelihaa, tomaattikastiketta ja runsas juustokuorrutus. Päivällisen jälkeen join vielä 4 kupillista teetä.

Ruokavalion noudattamisessa on tärkeää seurata ja kuunnella omaa elimistöä

LCHF sisältää useita koulukuntia ja erilaisia ravintohifistelijöitä mahtuu jokaiseen koulukuntaan ruokavalioista riippumatta. En pidä hifistelyä tarkoituksenmukaisena. Pääpiirteitten ollessa selvät henkilön tulee kuunnella omaa elimistöään, eikä jotain gurua. Hiilihydraattien määrä LCHF-ruokavaliossa lasketaan maksimissaan 50 grammaa päivätasolle, mutta mieluummin vieläkin alemmalle tasolle, jos tarkoituksena on ketoosiin pääsy.

Atkinsin ruokavalio

Atkinsin ruokavalio koostuu neljästä vaiheesta:

  • Vaihe 1: Hiilihydraattien määrä lasketaan 20 grammaan päivässä. Tämä jatkuu 2 viikkoa.
  • Vaihe 2: Päivittäiseen syömiseen lisätään pähkinöitä, vähäisiä määriä hedelmiä ja vähähiilihydraattisia vihanneksia.
  • Vaihe 3: Asetetun painotavoitteen lähestyessä hiilihydraattien saantia voidaan lisätä.
  • Vaihe 4: Ruokavalioon otetaan mukaan täysjyväviljoja ja muita terveellisiä hiilihydraatteja sen verran, että paino pysyy tasaisena.

The ketogeeninen ruokavalio

Ketogeeninen ruokavalio rajoittaa hiilihydraatteja merkittävästi ja tähtää ketoosiin, jossa elimistö alkaa tehokkaasti käyttää rasvoja solujen energian lähteenä.

Ketogeeniset ruokavaliot jakautuvat opillisten ja tavoitteellisten erojen puitteissa eräänlaisiin koulukuntiin. Tavallisesti tavoitteena on laskea päivittäinen hiilihydraattien saanti 5-10 prosenttiin päivittäisestä energiasta. Määrällisesti tämä tarkoittaa noin 20-50 grammaa hiilihydraatteja/päivässä.

Ruokavalion tavoitteena on ketoosi, joka on luonnollinen tila, kun elimistö ei saa riittävästi energiaa hiilihydraateista. Ketoosissa elimistö alkaa pilkkomaan varastoimiaan rasvahappoja ketoaineiksi, joita solut voivat hyödyntää energian tuotannossa. Ketoosia ei tule sekoittaa vaaralliseen happomyrkytykseen, ketoasidoosiin. Ketoasidoosissa veren ketoainepitoisuudet nousevat jopa kymmenkertaisiksi ketoosiin verrattuna.

Kanasalaatti


Hyvin suunniteltu on puoliksi tehty


Kaikki ruokavaliot edellyttävät hieman valmistelua ja suunnittelua. Ongelmia syntyy, jos ruokavalio yksipuolistuu liikaa. Silloin se ruokavalion noudattamisesta tulee vaikeaa ja laihduttaminen loppuu nopeasti alkuinnostuksen jälkeen. Siksi on tärkeää suunnitella ruokavaliota niin, että se sisältää vaihtelua, monipuolisia raaka-aineita ja tarjoaa kaikki tarvitut ravinteet.


Mitä söisin tänään?


LCHF-ruokavalioissa hiilihydraattien rajoittaminen rajoittaa syötävien ruokien määrää. Tämä voi tuottaa motivaatio-ongelmia.

Alkavan ketoilijan kauppalista

– Cashew-pähkinät (hyviä rasvoja ja proteiineja)
– Lihat (possu, nauta, kana, kalkkuna, lammas)
– Kalat (erityisesti rasvaiset lohi, sardiinit ja makrilli)
– Juustot
– Voi
– Avokadot
– Öljyt (oliivi-, kookos-, avokado- ja pellavansiemenöljy)
– Pähkinät (maapähkinät, mantelit, cashew-pähkinät)
– Siemenet (auringonkukan siemenet, chia ja pellavansiemenet)
– Munat
– Pinaatti ja muut tummanvihreät lehtivihannekset
– Marjat (mustikat, mustaviinimarjat, mansikat )
– Parsakaali
– Kukkakaali
– Valkokaali
– Ruusukaali
– Parsa
– Kesäkurpitsa
– Tomaatit
– Paprika
– Myskikurpitsa
– Juomaksi (vesi, kahvi, tee)

Seuraavia voi ketogeenisella ruokavaliolla syödä hieman ruokavalion tavoitteista riippuen:

– Porkkanat (vähän)
– Punajuuret (vähän)
– Omena, vesimeloni tai persikka (vähän)
– Kvinoa (vähän)
– Bataatti (vähän)
– Pavut ja palkokasvit (vähän)
– Kauraa (vähän)
– Täysjyviä (vähän)

Rajoitettavia ruokia ovat

Kaikilla LCHF-ruokavalioilla rajoitetaan hiilihydraatteja ja aivan erityisesti puhtaita sokereita ja runsaasti tärkkelystä sisältäviä kasviksia, kuten perunoita ja riisiä. Ruokavalio ei suosittele virvoitusjuomia, mehuja, kakkuja, leivoksia, makeisia, fruktoosisiirapilla tai millään teollisilla makeutusaineilla makeutettuja raffinoituja elintarvikkeita tai alkoholisokereita. Muita rajoitettavia ovat:

  • valkoinen pasta
  • valkoinen riisi
  • leipä, sämpylät ja patongit
  • leivonnaiset, pullat, muffinssit jne.
  • makeiset
  • virvoitusjuomat, mehut
  • olut
  • dieettijuomat ja yleensäkin dieetti-mitkä tahansa
  • vähärasvaiset elintarvikkeet, sillä niissä rasvat on korvattu sokereilla

Kaikkia hiilihydraatti- ja tärkkelyspitoisia ruokia ei ole pakko poistaa ruokalistalta. LCHF-ruokavaliota voi noudattaa, jos siihen sisältyy rajoitetusti papuja ja muita palkokasveja sekä täysjyväviljoja. Niiden määrien tulisi olla vähäisiä, eikä niitä suositella päivittäiseen ruokavalioon.

Ja lopuksi

LCHF-ruokavaliot vaikuttavat eri ihmisiin eri tavoin. Korostan jälleen, että välttämättömien ravintoaineiden saannista tulee huolehtia, vettä tulee juoda riittävästi ja elimistöä pitää kuunnella. LCHF-ruokavaliot voivat aiheuttaa (ainakin kuurin alkuvaiheessa)

  • väsymystä ja heikkoutta
  • kramppeja
  • päänsärkyä
  • ummetusta tai ripulia
  • kutinaa
  • pahanhajuisen hengityksen

Kun elimistö sopeutuu ruokavalion muutoksiin, sivuoireet vähenevät ja katoavat. Tsemppiä ja hyvää terveyttä kaikille, jotka tämän tien valitsevat. Omat kokemukseni olivat ja ovat rohkaisevia, mutta nähtäväksi jää. Oli LCHF-ruokavalio terveellinen tai ei, se ei ainakaan voi olla huonompi vaihtoehto kuin ravinneköyhien ja energiatiheiden transrasvoja runsaasti sisältävien eines- ja pikaruokien, makeisten ja makeiden virvoitusjuomien ahmiminen pitkin päivää.

Kuvat: Pixabay




Ketogeeninen ruokavalio ja MS

Noudatin vähähiilihydraattista ruokavaliota vuosia sitten. Kokeilu jäi vain vajaan vuoden mittaiseksi, mutta kokemukseni olivat sekä painonhallinnan että yleisen hyvinvoinnin kannalta rohkaisevia. Oloni oli erinomaisen hyvä ja painoni laski.

Ruokavalion noudattaminen kaatui jouluherkkuihin. Noiden aikojen jälkeen olen lihonut 20 kiloa ja rasvaa on kerääntynyt erityisesti keskivartalolle haitallisena viskeraalisena läskinä. On aika tehdä jotain.

Ketogeeninen ruokavalio ja MS selvittää vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion vaikutuksia etenevää MS-tautia sairastavan terveyteen. 

Ketogeeninen ruokavalio herättää voimakkaita tunteita. Monien on yhä vaikea hyväksyä sitä, että syöty rasva voi laihduttaa. Ketogeeninen ruokavalio kuitenkin toimii mainiosti laihdutusruokavaliona.

MS on siinä mielessä viheliäinen sairaus, että se vaikuttaa vääjäämättä fyysiseen aktiivisuuteen. Painoa alkaa kertyä huomaamatta. Minä olen nauttinut invaliditeetin tuomasta joutenolosta syömällä epäterveellisesti ja juomalla pikkukylän vuosittaista vedenkulutusta vastaavan määrän olutta. Siinäpä tekosyyt.

Mitä ketogeenisella ruokavaliolla tarkoitetaan?

Ketogeeninen dieetti on vähähiilihydraattinen ja runsaasti rasvaa sisältävä ruokavalio. Proteiinien määrä pidetään ruokavaliossa maltillisena.

Evidenssiä tämän ruokavalion hyödyistä laihdutusruokavaliona on runsaasti. Sen sijaan näyttö siitä, että ketogeeninen ruokavalio helpottaisi etenevän multippeliskleroosin oireita, on vähäistä.

Laihtumisella ja elimistön hiljaisen tulehduksen – inflammaation – hillitsemisellä on terveyttä edistäviä vaikutuksia. En usko, että ruokavalio tekee ihmeitä sairaudelleni, mutta toivon laihtuvani sen avulla.

Ruokavaliossa hiilihydraattien, kuten tärkkelyksen ja sokereiden määrää rajoitetaan. Tämä tarkoittaa, että monet yleiset ruoka-aineet, kuten perunat, pastat, riisi, leivät ja hedelmät ovat rajoitettavien ravintoaineiden listalla.

Lihakasvis-vartaat

Ruokavalion puolestapuhujat korostavat, että ketogeeninen ruokavalio voi auttaa laihtumaan ja hillitsemään keskushermostoa degeneroivia tulehdusreaktioita.

Ketogeenisen aineenvaihdunnan perusteet ja toivotut hyödyt

Ketogeeninen ruokavalio voi mahdollisesti hillitä multippeliskleroosin oireita. Mihin ruokavalio ja tällaiset väitteet perustuvat?

Ketogeenisen ruokavalion tarkoituksena on ohjata solujen energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Kehon energiantuotantoa säätelee monet hormonit ja entsyymit, joista ketogeenisen ruokavalion kannalta mielenkiintoisimpia ovat insuliini ja glukagoni.
Ketogeeninen ruokavalio perustuu pitkälti juuri insuliinin ja glukagonin toiminnan ymmärtämiseen ja hyödyntämiseen.

Solujen energiantuotanto

Solut rakastavat glukoosia, sillä se on helppo ja nopea energianlähde. Ruoansulatuskanavassa hiilihydraatit, kuten tärkkelystä sisältävät perunat ja riisi, pilkotaan sokereiksi ja muiksi ravinteiksi. Glukoosi kulkee ohutsuolen endoteelin läpi verenkiertoon eräiden glut-molekyylien kuljettamana ja kohottaa verensokeria.

Haima reagoi sokeripitoisuuden lisääntymiseen erittämällä vereen insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, jolloin solun sisältämät solukalvon läpäisevät glukoosia kuljettavat kanavat tulevat solukalvolle. Näiden avulla glukoosi pääsee soluun.

Solun sytoplasmassa käynnistyy glykolyysi, jossa glukoosimolekyyli pilkotaan kahdeksi pyruvaatiksi. Reaktiossa syntyy myös kaksi korkeaenergistä ATP-molekyyliä ja kuusi vetyionia kumpaakin pyruvaattia kohden. Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit.

NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen. Anaerobinen (hapeton) energiantuotanto loppuu siihen, että pyruvaatit pelkistyvät laktaatiksi.

Sitruunahappokierto
Kuvan lähde: Wikipedia

Aerobinen (hapellinen) energiantuotanto jatkuu soluhengityksenä sitruunahappokierrossa sellaisissa soluissa, joilla on käytettävänään happea ja mitokondrioita. Sitruunahappokierto (Krebsin sykli, trikarboksyylihappokierto (TCA-kierto)) käynnistyy sitraattisyntaasientsyymin katalysoidessa sitraatin muodostumista oksaaliasetaatista ja asetyylikoentsyymi-A:sta.  

Sitraatista kierto etenee isositraattiin, siitä alfa-ketoglutaraattiin, edelleen sukkinyyli-koentsyymi-A:han, sitten sukkinaattiin, edelleen fumaraattiin, sitten malaattiin, kunnes kierto palaa oksaaliasetaattiin. Tuloksena asetyyliryhmä on hapetettu täydellisesti hiilidioksidiksi ja kolme NADH:ta, yksi FADH2 ja yksi GTP on tuotettu. Ketoilijoiden kannalta oleellista on, että rasva muutetaan sitruunahappokierron väliaineeksi – asetyylikoentsyymi-A:ksi.

Ennen kuin hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi.

 Mitokondrioissa tapahtuvassa sitruunahappokierrossa syntyy vielä parikymmentä korkeaenergistä ATP-molekyyliä ja protoneja elektroninsiirtoketjuun. Soluhengityksen lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat ihon ja hengityksen kautta. Sokerit ja rasvat siis palavat solujen mitokondrioissa vedeksi ja hiilidioksidiksi. Glukoosi kelpaa sellaisenaan solujen energiantuotantoon. Rasvat ja proteiinit on ensin muokattava asetyylikoentsyymi-A:ksi ja sokerit glukoosiksi.

Kun elimistö pakotetaan hyödyntämään rasvasoluihin varastoitua rasvaa energianlähteenä, läskin palaminen tehostuu huomattavasti.

Kaikki sokerit eivät kelpaa suoraan energiantuotantoon, vaan ne pitää ensin muuttaa glukoosiksi ja glykogeeneiksi, jotka muodostuvat jopa kymmenistä tuhansista yksittäisistä glukoosimolekyyleistä. Ravinnosta saatavan fruktoosin aineenvaihdunta eli fruktolyysi tapahtuu maksassa. Suurin osa fruktoosista syntetisoidaan glykogeeneiksi maksan nopeisiin sokerivarastoihin. Osa fruktoosista muutetaan maksassa glukoosiksi, joka vapautuu verenkiertoon ja ravitsee solujen energiantarvetta. Pari prosenttia fruktoosista muutetaan maksassa suoraan triglyserideiksi eli varastorasvaksi. Fruktoosin aineenvaihdunta rasittaa ja voi pahimmillaan rasvoittaa maksaa. Ilmeisesti epidemiaksi äitynyt alkoholista riippumaton rasvamaksa palautuu väestön ylettömään sokerin kulutukseen.

Jos veressä on liikaa glukoosia solujen ravinteiksi sekä lihasten ja maksan glykogeenivarastoihin, aineenvaihdunta alkaa muuttaa sokereita triglyserideiksi eli varastorasvaksi de novo lipogeneesissa. Insuliini osallistuu myös rasvanhappojen varastoimiseen rasvasoluihin. Tähän perustuu sokereiden lihottava vaikutus.

Kun veren sokeripitoisuus laskee, haima erittää vereen glukagonia. Glukagoni on insuliinin vastavaikuttaja ja sillä on monia tärkeitä tehtäviä aineenvaihdunnan säätelyssä.

1. Glukagoni purkaa maksan glykogeenivarastoja glukoosiksi verenkiertoon solujen energiantuotannon turvaamiseksi ja lihasten glykogeenivarastoja lihasten energiantuotantoon.

2. Glukagonin vaikutuksesta rasvasoluihin varastoituja triglyseridejä vapautuu verenkiertoon. Maksassa ja munuaisissa käynnistyvät ketogeneesi ja glukoneogeneesi. Ne valmistavat verenkiertoon vapautuneista vapaista rasvahapoista yms. aineista solujen energiantuotantoon kelpaavia ketoaineita ja glukoosia. Glukoneogeneesi syntetisoi mm. vapaista aminohapoista ja sitruunahappokierron välituotteista glukoosia.

Verensokerin kohotessa insuliini keskeyttää ketogeneesin ja glukoneogeneesin.

3. Rasvahappojen beetaoksidaatio käynnistyy

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Sen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta, kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Ketogeenisessä ruokavaliossa elimistö alkaa aktiivisesti muuttaa varastoimiaan rasvoja energiaksi kelpaavaan muotoon, koska soluille ei tarjota helppoa ja nopeaa glukoosia energianlähteeksi. Keho siis pakotetaan polttamaan rasvaa. Tästä ketoosissa ja ketogeenisessä ruokavaliossa on kyse.

Aineenvaihduntaprosessi on täysin luonnollinen. Elimistö osaa käyttää rasvaa polttoaineena, mutta koska solut on lapsuudesta lähtien tehokkaasti opetettu käyttämään polttoaineena sokeria, rasvavarastoja ei juurikaan pureta; lihominen jatkuu niin kauan kuin tarjolla on helppoja hiilihydraatteja ja veren insuliinipitoisuus säilyy korkeana. Elimistö alkaa purkaa rasvavarastoja, kun sille ei tarjota helppoa energiaa. Tavallaan kaloreita merkittävästi rajoittamalla päädytään samaan tilanteeseen, jossa kehon on turvauduttava varastoenergiaan.


Ketoosin hyödyt

Elimistö menee ketoosiin, kun veren sokeripitoisuus ja sen seurauksena insuliinipitoisuus ovat matalat. Varsinainen ketoaineita tuottava ketoosi käynnistyy muutamassa vuorokaudessa, jos hiilihydraattien saantia rajoitetaan 20-50 grammaan vuorokaudessa. Kehon varastoimien rasvojen tehokas käyttö energianlähteenä alkaa noin kolmessa viikossa edellyttäen, että hiilihydraattien saanti pysyy hyvin matalana. Ketoosissa:

  • paino laskee ja elimistö käyttää tehokkaasti varastorasvoja energianlähteenä
  • muuttunut aineenvaihdunta suojaa soluja
  • inflammaatio ja hapetus-pelkistysreaktion epätasapainon seurauksena syntyneet happiradikaalit vähenevät ja antioksidatiiviset prosessit tehostuvat
  • stressihormonien määrä elimistössä ja stressitasot laskevat


Ketogeeninen ruokavalio ja MS

Eräs ketogeeniseen ruokavalioon liitetty vaikutus on se, että se suojelee elimistöä solutasolla vaikuttamalla hapetusstressiin (oksidatiivinen stressi). Verensokerin nousu assosioituu oksidatiiviseen stressiin ja se ylläpitää inflammaatiota.  

Lihavilla myös ylimääräinen rasvakudos ylläpitää elimistön tulehdustilaa, koska rasvakudos erittää erilaisia tulehdussytokiineja eli tulehdusta välittäviä aineita. Laihduttaminen vähentää tällaista inflammaatiota ja tehokas laihtuminen voi laskea tulehdusarvoja (CRP) merkittävästi ja siten parantaa yleistä terveyttä.  

Mitä tutkimukset sanovat?

Saksalaisen 2015 toteutetun seurantatutkimuksen perusteella ketogeeninen ruokavalio parantaa multippeliskleroosia sairastavien elämänlaatua. Tutkimuksen miinuksena on, että se oli hyvin pienimuotoinen (60 osallistujaa) ja kesti vain puoli vuotta.

Saman vuoden aikana ilmestynyt tutkimusraportti löysi viitteitä siitä, että ketogeeninen ruokavalio suojaa etenevää multippeliskleroosia sairastavien keskushermostoa etenevään multippeliskleroosiin assosioituvilta neurodegeneratiivisilta tuhoilta.

”Until recently, multiple sclerosis has been viewed as an entirely inflammatory disease without acknowledgment of the significant neurodegenerative component responsible for disease progression and disability. This perspective is being challenged by observations of a dissociation between inflammation and neurodegeneration where the neurodegenerative component may play a more significant role in disease progression. In this review, we explore the relationship between mitochondrial dysfunction and neurodegeneration in multiple sclerosis. We review evidence that the ketogenic diet can improve mitochondrial function and discuss the potential of the ketogenic diet in treating progressive multiple sclerosis for which no treatment currently exists.” Lue tutkimus
tästä.

Ketogeeninen ruokavalio näyttää hyödyttävän multippeliskleroosia sairastavia solutasolla. Se vähentää oksidatiivista stressiä ja lisää veren antioksidanttitasoja. Tämä suojaa hermo- ja aivosoluja neurodegeneraatiolta. Vastaavia havaintoja on tehty dementian ja Alzheimerin taudin kohdalla; ketogeeninen ruokavalio on tutkimuksissa liitetty pienempään muistisairauksien riskiin.

Oksidatiivinen stressi ja antioksidantit

Oksidatiivinen stressi tarkoittaa solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Käytännössä hapettavien tekijöiden liiallinen määrä ja antioksidatiivisten järjestelmien vajavainen toiminta välittyy reaktiivisten happi- ja typpiradikaalien kautta, mikä ylläpitää elimistön inflammaatiota.

Verensokeri vaikuttaa oksidatiiviseen stressiin ja inflammaatioon sitä enemmän, mitä korkeammalle verensokeri nousee ja mitä suuremmasta syödystä hiilihydraattimäärästä on kyse. Suuren glykeemisen kuorman sisältävät ruoka-annokset nostavat verensokeria rajusti. Oksidatiivisen stressin aiheuttamia tulehdusta lisääviä vaikutuksia voi vähentää tulehdusta jarruttavilla tekijöillä: polyfenoleilla, C-vitamiinilla, kanelilla ja etikalla, kuiduilla ja rasvalla.

Miten se toimii?

Reaktiivinen happiradikaali sisältää parittoman elektronin ja on siksi hyvin reaktiivinen. Energiataloudellisesti parittomat elektronit ovat epäedullisia ja siksi yhdiste pyrkii parilliseen elektronimäärään reagoimalla läheisyydessä olevien muiden yhdisteiden kanssa. Happiradikaali vaurioittaa kohtaamiaan molekyylejä. Tämä voi ilmetä eri tavoin:

Lipidiperoksidaatiossa rasvat härskiintyvät. Oksidatiivisessa stressissä rasvat hapettuvat happiradikaalien liiallisen määrän vuoksi ja seurauksena voi olla esimerkiksi rasvakalvojen virheellinen toiminta, joka vaikuttaa hormonien ja muiden viestiaineiden aikaansaamien signaalien välittymisessä solukalvon kautta soluun.
– Proteiinien vauriot. Proteiinit toimivat entsyymikatalyytteina, jotka mahdollistavat elintoiminnoille välttämättömät kemialliset reaktiot. Jotkin proteiinit toimivat reseptoreina, jotka vastaanottavat soluun tulevia kemiallisia viestejä. Happiradikaalien vaikutukset proteiineihin voivat aiheuttaa monenlaisia elintoimintojen häiriöitä.
– Myös DNA voi vaurioitua hapettumisen seurauksena. Tämä aiheuttaa geneettisiä vaurioita eli mutaatioita DNA:n emäsjärjestyksissä. Tällaiset muutokset voivat muuttaa ko. aluetta koodinaan käyttävän proteiinin rakennetta ja edelleen pysyvästi solun toimintaa, minkä seurauksena solut saattavat muuttua pahanlaatuisiksi. Se altistaa syövän kehittymiselle.  

Happiradikaaleja syntyy elimistön normaalin toiminnan seurauksena esimerkiksi ruokailun jälkeen ja soluhengityksessä, kun mitokondrioiden elektroninsiirtoketju käyttää happea energiantuotannossa. Happiradikaalien muodostuminen on osa perusaineenvaihduntaa, mutta niiden määrää rajoittaa elimistön omat antioksidatiiviset järjestelmät. Hapetus-pelkistystiloissa tapahtuvat muutokset ovat osa solujen välistä viestintämekanismia (redox signaling). Keho voi hyödyntää happiradikaaleja myös immuunijärjestelmän osana. Luontainen immuniteetti ja siihen liittyvät fagosytoivat solut tuhoavat elimistölle vieraita mikrobeja tuottamalla happiradikaaleja.

Elimistöllä on omia mekanismeja reaktiivisten happiradikaalien määrän rajoittamiseen. Näistä tärkeimpiä ovat happiradikaaleja vaarattomiksi molekyyleiksi muuttavat entsyymit, kuten superoksididismutaasi, katalaasi ja glutationiperoksidaasi.  Ravinnosta saatavat pienimolekyyliset antioksidantit pystyvät myös inaktivoimaan happiradikaaleja. Antioksidantteihin kuuluu eräitä vitamiineja ja flavonoideja. Tutuimpia ovat C- ja E-vitamiinit.

Liiallinen oksidatiivinen stressi voi johtaa solukuolemaan ja kudostuhoon. Inflammaatio on kaikkien kroonisten sairauksien riskitekijä.

Tässä on syytä painottaa sitä, että kovin paljon tutkimustietoa ketogeenisen ruokavalion hyödyistä multippeliskleroosia sairastavien oireiden helpottajana ei ole. Havaitut hyödyt on todennettu lähinnä eläinkokeissa ja pitkäaikaisvaikutuksista ei ole tietoa. Toisaalta tutkimusten tulokset ovat hyvin rohkaisevia.

Huomioitavaa

Ketogeenisen ruokavalion noudattaminen voi aiheuttaa multippeliskleroosia sairastavilla väsymystä (fatiikkia). Omalla kohdallani en sellaista huomannut, mutta multippeliskleroosi vaikuttaa eri ihmisiin eri tavoin, joten varoituksen sana on paikallaan.

Usein vähän hiilihydraatteja sisältävää ruokavaliota noudattavia varoitetaan kuitujen ja välttämättömien ravintoaineiden mahdollisista puutoksista hiilihydraattirajoitteiden seurauksena. Se voi olla yksipuolisella ketogeenisella dieetillä ongelma, mutta myös vähän hiilihydraatteja sisältävällä ruokavaliolla saa kaikki välttämättömät ravintoaineet ja riittävästi kuituja, jos ruokavalio on riittävän monipuolinen.

Mitä pitäisi vältellä

Ketoosi edellyttää hiilihydraattien tuntuvaa rajoittamista päivittäisessä ruokavaliossa ja hiilihydraattien korvaamista rasvalla ja proteiineilla. Välteltäviä ravintoaineita ovat erityisesti sokerit ja tärkkelys, jauhot ja niistä valmistetut ruoat sekä riisi, peruna, maissi ja hedelmät.

Rasvat

Hyväksyttyihin ravintoaineisiin kuuluvat hyvät rasvat ja proteiinit sekä vähän hiilihydraatteja sisältävät kasvikset ja pähkinät. Voi kuuluu monissa virallisissa ravintosuosituksissa vältettäviin epäterveellisiin rasvoihin, mutta minä suhtaudun voihin äärimmäisen myönteisesti. Sen sijaan margariineja en mielelläni syö. Voin terveysvaikutuksista vallitsee kaksi koulukuntaa: klassinen rasvavastainen koulukunta ja uusimpiin tutkimuksiin perustuva modernimpi lähestymistapa. Jokainen tehköön valintansa itse. Yhtä totuutta voin terveysvaikutuksista ei ole olemassa.

  • oliiviöljy
  • voi (tai ei, jos syö mieluummin voimakkaasti raffinoituja margariineja)
  • avokadot
  • pähkinät, mantelit, pistaasit
  • rasvaiset kalat, kuten lohi, sardiinit ja makrilli

Proteiinit

Ketogeeniseen ruokavalioon voi sisältyä sekä eläin- että kasvisperäisiä proteiineja.

  • liha
  • meijerituotteet (juustot yms.)
  • munat
  • pähkinät, maapähkinät ja cashew-pähkinät

Hiilihydraatit

Ketogeenisella ruokavaliolla rajoitetaan erityisesti seuraavien hiilihydraattien saantia:

  • sokerit
  • hedelmämehut, virvoitusjuomat ja makeutetut teet
  • makeiset ja leivonnaiset
  • maitoa, sillä se sisältää maitosokeria eli laktoosia
  • pasta
  • leipä
  • pavut
  • hedelmät
  • murot, puurot yms.
  • tärkkelyspitoiset vihannekset, kuten perunat ja maissi

Esimerkki päivän ruoista ketogeenisella ruokavaliolla

Aamiainen

  • pari paistettua munaa
  • pekonia
  • kahvia

Välipala

  • puolikas avokado, kourallinen pähkinöitä

Lounas

  • viipaloitua kurpitsaa
  • lihapullia ja tomaattikastiketta

Välipala

  • manteleita

Päivällinen

  • paistettua lohta
  • kukkakaalia ja voita
  • pinaattia

Tuo on vain eräs esimerkki päivittäisen ruokavalion sisällöstä. Tulen lisäämään tänne ketonurkkaukseen erilaisia hyviksi koettuja reseptejä sekä muuta aihetta sivuavaa infoa.  

Lopuksi

En voi sietää sanaa ”karppaaminen”. Siinä on jotenkin negatiivinen sointi. Lisäksi se kuulostaa pikemminkin hiilihydraattien syömiseltä kuin niiden rajoittamiselta. Käytän itse ketoilu-sanaa vähän hiilihydraatteja ja runsaasti rasvaa sisältävästä ruokavaliosta.

 Aloitin ketoilun eilen 2.12.2019. Söin päivän aikana kaksi ateriaa. Brunssi-lounaalla naudan jauhelihapihvin, runsaasti paistettua valkosipulilla ja chilillä maustettua kaali-paprika-sekoitusta ja juustoraastetta. Päivällisellä 3 paistettua munaa, kaali-paprikasekoituksen jämät ja paistetun naudan jauhelihapihvin. Pysyin kylläisenä, enkä kaivannut välipaloja tai iltapalaa.

Aloitan tulevien viikkojen aikana kokoamaan Ruokasotaan erityistä Ketonurkkausta, jossa kerron ketoiluun liittyvistä tutkimuksista, omista havainnoistani ja hyvistä resepteistä.

 




Atkinsin dieetti

Atkinsin dieetti on tunnetuin pysyvään laihtumiseen tähtäävä vähähiilihydraattinen ruokavalio.

Atkinsin mukaan insuliinilla on tärkeä rooli rasvan varastoimisessa ja rasvakudoksen rakentamisessa. Atkinsin dieetin tavoitteena on hiilihydraatteja rajoittamalla laskea haiman erittämän insuliinin määrää verenkierrossa, mikä Atkinsin mukaan vähentää rasvan varastoitumista rasvakudokseen, tehostaa varastoidun rasvan ”polttamista” energiaksi ja auttaa laihtumaan.

Amerikkalainen kardiologi Robert Atkins laati Atkinsin dieetin 1970-luvun alussa. Ruokavalio on kehittynyt vuosikymmenten saatossa. Nykyisin Atkinsin dieetti kehottaa täydentämään liha- ja rasva-painotteisen ruokavalion laihduttavia vaikutuksia runsaskuituisilla, vähän tärkkelystä sisältävillä kasviksilla ja liikunnalla.

Kahden viikon vähähiilihydraattisen induktiovaiheen tavoitteena on käynnistää ketoosi. Induktion jälkeen hiilihydraattien määrää lisätään varovasti jatkuvan laihtumisen, esiylläpidon- ja ylläpidon vaiheiden aikana, kunnes ihannepaino saavutetaan.


Atkinsin dieetti ja aineenvaihdunta


Ketoosi on aineenvaihdunnan tila, joka käynnistyy, kun ravinnosta saatavien hiilihydraattien määrä ei riitä täyttämään elimistön energiantarvetta. Hiilihydraateista saatava glukoosi on elimistön ensisijainen ”polttoaine”, mutta aineenvaihdunta osaa tuottaa tarvitsemansa energian myös rasvasta ja proteiineista. Kun glukoosi ei täytä energiantarvetta, aineenvaihdunta aloittaa energiantuotannon rasvoista.

Kun veren insuliinipitoisuus laskee, haiman erittämän glukagonin määrä veressä lisääntyy. Glukagoni käynnistää maksaan ja lihaksiin varastoitujen glykogeenien purkamisen vereen glukoosi- eli sokerimolekyyleiksi. Glukagonin vaikutuksesta maksassa ja munuaisisten kuoriosissa alkaa glukoneogeneesi ja ketogeneesi sekä rasvahappojen hiiliä asetyylikoentsyymi-A:ksi hapettavan β-oksidaatio.

Ketoosissa vapaista rasvahapoista muodostetaan ketoaineita, joita solut voivat käyttää energiantuotantoon.

Ketoosin aikana rasvasoluista vapautuu rasvahappoja verenkiertoon. jolloin aineenvaihdunta alkaa hyödyntää vapaita rasvahappoja energianlähteenä.

Ketoosi ja varastorasvojen hyödyntäminen

Glukoneogeneesin käynnistyessä elimistö alkaa muodostaa glukoosia vapaista aminohapoista, rasvojen glyseroliosista ja maitohaposta. Glukoneogeneesin rinnalla käynnistyy ketogeneesi.

Ketogeneesi vähentää glukoosin tuottamisen tarvetta, mikä säästää vapaita aminohappoja solujen uusiutumiseen.

Ketogeneesi muodostaa verenkierron vapaista rasvahapoista ketoaineita (asetoasetaatti, beeta-hydroksibutyraatti), joita useimmat solut pystyvät käyttämään energianlähteenä palauttaen ketoaineet asetyylikoentsyymi-A:ksi, joka on suoraan käytettävissä oksidatiiviseen energiantuotantoon sitruunahappokierron kautta mitokondrioissa samaan tapaan kuin glukoosi.

Insuliini

Insuliini, jolla on keskeinen merkitys Atkinsin ajattelussa, on ihmiselle elintärkeä sokeriaineenvaihduntaa säätelevä hormoni, jota erittyy haiman Langerhansin saarekkeiden β-soluista, kun hiilihydraateista ohutsuolesta verenkiertoon imeytyvä sokeri (glukoosi) nostaa veren sokeripitoisuutta.

Vereen erittyneet insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, mikä saa solussa olevat solukalvon läpäisevät glukoosinsiirtäjäproteiinit siirtymään solukalvolle. Näiden avulla glukoosimolekyylit pääsevät verestä solun sisälle.

Solussa glukoosimolekyylit osallistuvat energiantuotantoon glykolyysissä ja sitruunahappokierrossa. Ylimääräinen glukoosi varastoidaan lihasten ja maksan glykogeeneihin ja / tai muutetaan rasvasynteesin avulla varastorasvaksi.

Veren sokeripitoisuuden kasvu lisää insuliinin eritystä. Verensokerin lasku puolestaan aktivoi haimaa erittämään glukagonia, jonka vaikutuksesta maksan ja lihassolujen glykogeenejä puretaan glukoosimolekyyleiksi. Kun glykogeenivarastot tyhjentyvät, elimistö siirtyy ketoosiin ja alkaa tuottaa energianlähteiksi kelpaavia ketoaineita mm. rasvahapoista.

Insuliinireseptori

Insuliinireseptorin tehtävä on ohjata veren sokeria siirtävät proteiinit kuten SLC2A4 solukalvolle, edelleen ohjata näiden reseptoreiden suorittamaa glukoosin siirtoa soluihin ja glykogeenin sekä rasvahappojen synteesiä.

Insuliinimolekyylin elinkaari kestää noin 71 minuuttia. Haiman erittämästä insuliinista suuri osa on tavallisesti kiinnittyneenä maksan insuliinireseptoreihin. Osa insuliinista vapautuu reseptoreista takaisin verenkiertoon. Insuliinimolekyylit voivat hajota verenkierrossa monella tavalla.

Endoteliinit

Verenkierrossa insuliini stimuloi myös endoteliinien, eli verisuonten endoteelisolujen tuottamien peptidihormonien tuotantoa. Endoteliinit säätelevät verisuonten sileiden lihassyiden supistumista ja osallistuvat verenkierron paikalliseen säätelyyn. Endoteliinit voivat myös paksuntaa ja jäykentää verisuonia, mikä kohottaa verenpainetta ja altistaa sydän- ja verisuonitaudeille.


Atkinsin dieetti käytännössä


Atkinsin ruokavalioon sopivat vähähiilihydraattiset vihannekset, proteiinit ja rasvat.

Atkinsin kehittämässä ruokavaliossa hiilihydraattien saantia ravinnosta vähennetään rajusti, mutta rasvojen ja proteiinien määrää ei tavallisesti rajoiteta lainkaan.

Atkinsin mukaan prosessoidut hiilihydraatit, sokerit, maissisiirappi ja valkoiset jauhot ovat lihomisen tärkeimmät aiheuttajat. Atkins ei usko perinteiseen kaloriteoriaan.

Atkinsin ruokavalion päämääränä on vähentää glykeemistä kuormaa ja tehostaa laihtumista.

Glykeeminen kuorma (GL) ja glykeeminen indeksi (GI) kertovat ravinnon sisältämien hiilihydraattien laadusta, määrästä ja imeytymisnopeudesta. Sitä voidaan hyödyntää arvioitaessa aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen.

Nopeilla ja hitailla hiilihydraateilla viitataan korkean glykeemisen indeksin hiilihydraatteihin ja matalan glykeemisen indeksin hiilihydraatteihin. Yleensä nopean glykeemisen indeksin hiilihydraatteja pidetään terveyden ja painonhallinnan kannalta huonompina kuin hitaasti imeytyviä hiilihydraatteja.

Glykeeminen kuorma

Glykeeminen kuorma voidaan laskea, ja siten selvittää syödyn ravinnon vaikutus veren sokeriin ja elimistön insuliinivasteeseen. Suuri hiilihydraattimäärä ja hiilihydraattien korkea glykeeminen indeksi kasvattavat ravinnon glykeemista kuormaa. Glykeemisen indeksin ja kuorman ymmärtäminen on erityisen tärkeää diabeetikoille.

Glykeeminen kuorma lasketaan seuraavasti: aterian glykeeminen indeksi x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa määritettäessä lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Glykeeminen indeksi

Glykeeminen indeksi määrittelee ruoka-aineen imeytyvien hiilihydraattien aiheuttaman vaikutuksen verensokeriin verrattuna referenssiruoka-aineeseen kuten glukoosiliuokseen tai valkoiseen leipään.

Hiilihydraatin korkea GI kertoo, että se kohottaa verensokeria nopeasti ja vereen vapautuu paljon insuliinia. Matala GI kertoo, että hiilihydraattien imeytyminen on hitaampaa ja tasaisempaa.

Runsaasti prosessoidut hiilihydraatit, kuten leivokset, karamellit ja valkoinen leipä sekä runsaasti tärkkelystä sisältävät hiilihydraatit, kuten perunat ja riisi, ovat korkean glykeemisen indeksin ruokia ja ne kohottavat verensokeri- ja insuliinitasoja nopeasti aterian jälkeen. Määrä on kuitenkin laatua keskeisemmässä asemassa, joten glykeeminen kuorma on parempi indikaattori aterian vaikutuksista verensokeri- ja insuliinitasoihin.

Jotkin hiilihydraatit, kuten kaura, kohottavat veren glukoositasoja hitaasti ja tasaisesti. Niiden glykeeminen indeksi on matala.

Nettohiilihydraatit

Nettohiilihydraattien määrä saadaan, kun hiilihydraattien kokonaismäärästä vähennetään kuidut ja sokerialkoholit. Sokerialkoholeilla on minimaalinen vaikutus veren sokeripitoisuuteen. Atkinsin mukaan parhaita hiilihydraatteja ovat ne, joiden glykeeminen kuorma on vähäisin.

Vitamiinit lisäravinteina

Atkinsin ruokavaliossa vältetään monia mineraali- ja vitamiinirikkaita vihanneksia ja hedelmiä, joten vitamiini- ja mineraalilisien ottaminen on suositeltavaa Atkinsin dieetin aikana.

Kuinka Atkinsin ruokavalio toimii?

Atkinsin ruokavalion neljä perustavoitetta:  

  • Laihtuminen
  • Painonhallinta
  • Hyvä terveys
  • Sairauksien ehkäisy

Atkinsin ruokavalion tavoitteena on muuttaa elimistön energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Se muistuttaa monin tavoin muita vähähiilihydraattisia ruokavalioita, kuten ketogeenistä ruokavaliota.

Hiilihydraattien korvaaminen rasvalla ja proteiineilla ohjaa elimistön käyttämään energianlähteenä ravinnon sisältämien rasvojen lisäksi kehoon varastoituneita rasvoja.

Aloittaminen

Atkinsin dieetti aloitetaan kahden viikon idnuktiovaiheella, jossa hiilihydraattien saanti rajoitetaan alle 20 grammaan vuorokaudessa. Tavoitteena on elimistön ketoositilan nopea saavuttaminen.

Induktion jälkeen hiilihydraattien määrää nostetaan kuukausien mittaan eri vaiheissa vähitellen, kunnes saavutetaan ihannepaino ja sopiva ylläpitotaso.

Ruokavalion laihduttava vaikutus perustuu siihen, että elimistö oppii käyttämään energianlähteenä rasvasoluihin varastoimiaan rasvoja, kun energia-aineenvaihdunnan kannalta nopeita ja helppoja hiilihydraatteja ei ole tarjolla ja veren insuliinitaso pidetään hiilihydraatteja rajoittamalla matalana.

Toisaalta Atkinsin ruokavalio hillitsee myös ruokahalua, jolloin ravinnosta saatava energiamäärä laskee luonnostaan.

Huomioi ennen Atkinsin dieetin aloittamista!

Jos sairastat jotain kroonista sairautta ja syöt siihen säännöllisesti lääkkeitä, sinun on syytä neuvotella lääkärin tai ravitsemusasiantuntijan kanssa ennen Atkinsin ruokavalion aloittamista.
Eräillä lääkkeillä, kuten insuliinilla, voi Atkinsin ruokavaliota noudatettaessa olla odottamattomia ja negatiivisia vaikutuksia.

Muista juoda riittävästi

Atkinsin dieetti on diureettinen, eli nesteitä poistava, joten myös nesteitä poistavien lääkkeiden ja muiden diureettien, kuten kahvin ja alkoholin välttäminen on suotavaa dieetin aikana. Riittävän nesteensaannin turvaaminen ja kehon nestetasapainon ylläpitäminen on Atkinsin ruokavaliossa erittäin tärkeää. Nestehukka aiheuttaa yleensä päänsärkyä, joten Atkinsin ruokavalioon liittyvä päänsärky viittaa usein liian vähäiseen nesteytykseen.

Diabeetikoilla insuliinintarve muuttuu Atkinsin ruokavalion seurauksena, joten on ehdottoman tärkeää, että diabetesta sairastavat neuvottelevat Atkinsin ruokavalioon siirtymisestä lääkärin kanssa ja noudattavat ruokavaliota asiantuntijan tai lääkärin valvonnassa.


Induktio ja syöminen


Atkinsin ruokavaliossa ketoosi käynnistetään nopeasti pudottamalla syötyjen hiilihydraattien määrä alle 20 grammaan vuorokaudessa. Tämä induktiovaihe jatkuu kaksi viikkoa. Proteiineja ja rasvaa voi induktiovaiheen aikana syödä nälkäänsä rajoituksetta.

Ruokavalioon sopivat kaikki lihat, kalat, linnut, äyriäiset, kananmunat ja juustot ja vihannekset, joissa on alle 10 % hiilihydraatteja. Atkinsin ruokavaliossa ei syödä induktio-, laihdutus- ja esiylläpitovaiheen aikana hedelmiä, viljoja, margariinia, tärkkelystä (kuten perunat, riisi, maissi), pastoja tai vähärasvaisia maitotuotteita.

Hiilihydraattien rajoittamisesta seuraava verensokerin lasku aktivoi haiman erittämään insuliinin vastavaikuttajaa, glukagonia, joka käynnistää ketogeneesin ja glukoneogeneesin. Glukagoni myös aktivoi soluissa tapahtuvan β-oksidaation käynnistymisen.

β-oksidaatio

β-oksidaatio tapahtuu solujen mitokondrioissa ja peroksisomeissa. Oksidaatiossa ravinnon ja rasvasolujen rasvahappojen β-hiiliä hapetetaan karbonyyleiksi. Reaktioketju tapahtuu neljässä vaiheessa:

– Dehydraus
– Hydraatio
– Hapetus-pelkistysreaktio
– Tiolyysi

Reaktiosarja toistuu, kunnes rasvahappo on kulunut loppuun. Joka toistossa rasvahapoista poistuu 2 hiiltä asetyylikoentsyymi-A:na. Tiolyysin asetyylikoentsyymi-A siirtyy yleensä sitruunahappokiertoon mennen siten ATP:n tuottoon. Muissa vaiheissa saadut NADH ja FADH2 päätyvät ATP:n tuottoon menemällä mitokondrion elektroninsiirtoketjuun. Lähde: Wikipedia


Kuvakaappauksen lähde. Wikipedia

Ketoosin käynnistyminen

Tavoitteena oleva ketoosi saavutetaan yleensä parissa viikossa, kun maksan ja lihasten polysakkarideista muodostuvat glykogeenivarastot tyhjenevät. Tämän vaiheen tavoitteena on katkaista energia-aineenvaihdunnan hiilihydraattiriippuvuus ja siirtää elimistön aineenvaihdunta käyttämään sokerin sijasta rasvaa ja varastorasvoja energianlähteenä.

Atkinsin ruokavalion alkuvaiheessa elimistöstä poistuu paljon nesteitä. Ensimmäisen puolentoista viikon aikana painonpudotus johtuu pääasiassa elimistöstä poistuvista nesteistä.


Atkinsin dieetti sisältää neljä vaihetta


Vaihe 1: Induktio

Hiilihydraattien saanti lasketaan alle 20 grammaan päivässä. Päivittäiset hiilihydraatit saadaan hyvin vähän tärkkelystä ja hiilihydraatteja sisältävistä vihanneksista.

Ruokavaliossa syödään runsaasti rasvaa ja proteiineja sekä salaatteja tms. vihreitä lehtivihanneksia.

Vaihe 2: Jatkuva laihtuminen / tasapainottaminen

Ravinnerikkaita ja runsaasti kuituja sisältäviä ruokia lisätään päivittäiseen ruokavalioon. Hiilihydraattien päivittäistä määrää nostetaan viidellä grammalla kerrallaan niin kauan kuin laihtuminen jatkuu.

Sallittuihin ruokiin sisältyvät edellisten lisäksi mm. pähkinät, vähähiilihydraattiset vihannekset ja vähäinen määrä hedelmää.

Vaihe 3: Esiylläpitovaihe

Hiilihydraattien määrää nostetaan tasolle, jossa painonpudotus hidastuu tai loppuu. (25-90 g /vuorokausi), kun dieetissä on päästy noin viiden kilon päähän tavoitepainosta. Tämä esiylläpitovaihe jatkuu vähintään 2 kuukautta siten, että painoa putoaa alle puoli kiloa viikossa.

Vaihe 4: Ylläpitovaihe

Kun asetettu tavoitepaino on saavutettu, siirrytään Atkinsin dieetissä ylläpitovaiheeseen. Laihduttaja lisää ruokavalioonsa monipuolisesti erilaisia hiilihydraatteja, mutta tarkkailee samalla, että paino pysyy vakiona, eikä lähde kasvuun. Ylläpitovaiheessa ketoosi ei enää ole tarpeellinen.

Ylläpitovaiheen aikana voi jo syödä lihan ja rasvan lisäksi monipuolisemmin useimpia vihanneksia, pähkinöitä, marjoja ja kokojyväviljoja sekä joskus hiukan perunaa ja hedelmiä. Lisättyä sokeria ei suositella. Alkoholia ja kahvia tulee käyttää kohtuudella. Robert Atkinsin mukaan liikunta on tärkeä osa Atkinsin laihdutusohjelmaa.

Atkins suositteli, että tyydyttyneen rasvan osuus päivittäisestä energiansaannista pysyisi alle 20 prosentissa.

Atkins 40:

Atkinsin ruokavaliosta on olemassa erilaisia variaatioita. Atkins 40 on hieman helpompi noudattaa, sillä alun induktiovaiheessa saa syödä 40 grammaa hiilihydraatteja vuorokaudessa.

Atkinsin ruokavaliota noudatettaessa omaan hyvinvointiin tulee kiinnittää huomiota. Ruokavalio ei välttämättä sovi kaikille. Jos paino alkaa nousta, päivittäisten hiilihydraattien määrää tulee jälleen laskea laihduttavalle tasolle.

Atkins ja kasvisruokavalio

Atkinsin dieetin noudattaminen kasvisruokavaliona on ongelmallista, koska kasviproteiinit esiintyvät yleensä yhdessä hiilihydraattien kanssa. Dieetistä voi toisaalta muokata kasvisruokavalion, kun siihen sisällyttää maitotuotteita ja kananmunia. Lakto-ovovegetaristinen Atkinsin dieetti suositellaan aloittamaan kakkosvaiheesta, eli jatkuvan painonpudotuksen vaiheesta, jossa hiilihydraattien määrä pidetään 30 grammassa vuorokaudessa.

Atkinsin kasvisversio sisältää runsaasti kasviöljyjä. Myös vegaaninen Atkinsin dieetti on mahdollinen, jos hiilihydraattien määrä pidetään 50 grammassa päivässä, mutta siinä proteiinien saannin kanssa on oltava erityisen tarkkana. Proteiininlähteiksi soveltuvat esimerkiksi siemenet, pähkinät, soijaruoat, kvinoa ja vegaanisessa Atkinsin dieetissä myös palkokasvit.

Mitä Atkinsin dieetissä saa ja ei saa syödä

Syötävät ruoat:

Laihduttajat saavat syödä avokadoja, sillä ne sisältävät terveellisiä rasvoja.

  • kaikki lihat ovat
  • rasvaiset kalat ja äyriäiset
  • munat
  • avokadot
  • vähän hiilihydraatteja sisältävät vihannekset, kuten valkokaali, parsakaali ja parsa
  • täysirasvaiset maitotuotteet, kuten juustot
  • pähkinät ja siemenet
  • terveelliset rasvat, kuten neitsytoliiviöljy, kookosöljy ja avokadoöljy

Dieettiin sopivia juomia ovat vesi, kahvi ja vihreä tee

Päivän ruokavalio on esimerkiksi tällainen:

  • Aamiainen: Juustomunakas ja vähän hiilihydraatteja sisältäviä vihanneksia
  • Lounas: Kanasalaatti ja pähkinöitä
  • Päivällinen: Lihapullia ja vähähiilihydraattisia vihanneksia

Välipaloiksi sopivat esimerkiksi pähkinät, siemenet, kananmunat ja kreikkalainen jogurtti

Vältettävät ruoat:

  • sokeri, virvoitusjuomat, leivokset ja makeiset
  • kaikki viljat, kuten vehnä, speltti ja riisi
  • vähärasvaiset laihdutusruoat, koska niissä rasva on usein korvattu hiilihydraateilla
  • palkokasvit, kuten linssit, pavut, herneet

Induktiovaiheen aikana runsashiilihydraattisia hedelmiä, kuten banaaneita, omenoita ja rypäleitä sekä runsashiilihydraattisia vihanneksia, kuten porkkanoita, tulee välttää.

TL;DR

Atkinsin mukaan verensokeri ja pohjukaissuolen erittämä GIP-hormoni stimuloivat insuliinin eritystä ja insuliinia tarvitaan rasvan ja sokereiden varastoimiseen rasvasoluihin. Rasvasoluissa myös sokerimolekyyleistä syntetisoidaan rasvahappoja. Insuliinin erityksen vähentäminen hiilihydraattien rajoittamisella vähentää rasvan varastoitumista, tehostaa varastorasvojen käyttämistä energiaksi ja auttaa laihduttamaan.


Kritiikki


”Insuliinilla on aineenvaihdunnassa muitakin tehtäviä. Verensokerin ohella se säätelee myös rasvahappojen siirtymistä verestä rasvasoluihin, jotka varastoivat ne rasvana. Varastorasva on juuri sitä tuttua rasvaa, jota nimitämme läskiksi. – – – Vaikka päättely insuliinista saattaa kuulostaa loogiselta, se on täysin virheellinen yksinkertaistus. Sen esittäjät ovat poimineet ihmisen aineenvaihdunnasta yhden palan ymmärtämättä rasvan varastoitumisen kokonaisuutta.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Pertti Mustajoki korostaa, että Atkinsin dieetin laihduttavat ominaisuudet perustuvat siihen, että Atkinsin ruokavaliota noudattava saa ravinnostaan vähemmän kaloreita. Vastakkain ovat klassinen kaloriteoria ja uudempi aineenvaihdunnan erilaisia mekanismeja korostava näkemys. Tutkimuksissa on osoitettu, että vähähiilihydraattinen ruokavalio laihduttaa vähän kaloreita sisältävää ravintoa selvästi tehokkaammin dieetin ensimmäiset kuukaudet, mutta erot ruokavalioiden välillä tasoittuvat noin vuoden laihduttamisen jälkeen.

”Oikeastaan ei tarvita edellä kuvattujen monimutkaisten aineenvaihdunnan tapahtumien tuntemusta. Energian häviämättömyyden lain perusteella voidaan helposti ymmärtää, että painonhallinnassa ruuan rasva ei suinkaan ole viaton. Jos saamme ruuasta energiaa enemmän kuin ”poltamme” eli kulutamme, ainoa mahdollisuus on varastoida se. Ylimääräinen energia ei voi hävitä. Se jää meihin, oli se sitten peräisin hiilihydraateista, proteiinista tai rasvoista.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Kuinka rasvasolut vaikuttavat painonhallintaan?

Rasvasolut eli adiposyytit tai liposyytit ovat kantasoluista kehittyneitä soluja, joiden tärkein tehtävä on varastoida ylimääräistä energiaa. Ihmisillä on kahdenlaisia rasvasoluja: valkoisia rasvasoluja (WAT) ja ruskeita rasvasoluja (BAT).

Ravinnon sisältämä ylimääräinen energia varastoidaan rasvasoluihin. Kun rasvasolut täyttyvät ja kasvavat riittävän suuriksi, ne jakautuvat ja tekevät näin varastoitavalle energialle enemmän tilaa.

Kerran muodostuneet rasvasolut eivät katoa mihinkään, vaikka paino putoaisi. Se on eräs laihduttamisen vaikeuteen vaikuttava tekijä. Laihtumisen ja lihomisen seurauksena rasvasoluihin varastoituneen rasvan määrä vaihtelee; solut eivät katoa.

Valkoiset rasvasolut

Valkoiset rasvasolut ovat yhden nesterakkulan soluja, jotka sisältävät ohuen sytoplasman ympäröimän ”rasvapisaran”. Valkoiset rasvasolut varastoivat ensisijaisesti triglyseridejä.

Valkoiset rasvasolut muistuttavat toiminnaltaan elintä, sillä ne erittävät aineenvaihduntaan vaikuttavia hormoneja, adipokiinejä kuten resistiiniä, adiponektiinia, leptiiniä ja apeliinia. Näillä hormoneilla on suuri vaikutus painonhallintaan. Esimerkiksi rasvasolujen erittämä leptiini kertoo aivoille, kun kehon energiavarastot ovat täyttyneet. Leptiini on siis kylläisyyshormoni.

Mitä enemmän ihmisellä on rasvasoluja, sitä hitaammin kehon energiavarastot täyttyvät ja rasvasolujen kemiallinen viesti energiavarastojen täyttymisestä hidastuu.

Suuri määrä energiatyydyttyneitä rasvasoluja voi aiheuttaa leptiinisignaaleilla eräänlaisen oikosulun aivojen leptiinireseptoreissa. Tällainen aiheuttaa leptiiniresistenssin, jossa aivot eivät enää reagoi kylläisyyshormoniin normaalisti. Kun rasvasolujen määrä kasvaa tai leptiinin toiminta heikkenee, ihminen syö enemmän kuin tarvitsee.

Ihmisellä on keskimäärin 30 miljardia valkoista rasvasolua, joihin on varastoitunut noin 13,5 kiloa rasvaa.

Ruskeat rasvasolut

Ruskeat rasvasolut sisältävät useita nesterakkuloita, joihin on varastoitunut rasvapisaroita. Ruskeat rasvasolut poikkeavat valkoisista rasvasoluista erityisesti koska ne sisältävät runsaasti energiaa tuottavia mitokondrioita. Ruskeaa rasvaa kutsutaan joskus vauvanrasvaksi ja se tuottaa elimistöön lämpöä.

Atkinsin dieetti voi vaikuttaa suotuisasti tyypin 2 diabetesta tai metabolista oireyhtymää sairastavien terveyteen ja vähentää lääkkeiden tarvetta. Diabetekseen erikoistuneet lääkärit varoittavat kuitenkin, että Atkinsin dieetti ei ole yksinkertainen ratkaisu tyypin 2 diabeteksen hoitoon, vaikka hiilihydraattien ja glukoosin saannin seuraaminen on tärkeä osa diabeteksen hoitoa.


Entä vaikutukset – toimiiko Atkinsin dieetti?


Atkinsin ruokavalion tavoitteena on laihtua ja ehkäistä eräitä sairauksia, kuten metabolista oireyhtymää, tyypin 2 diabetesta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja.

Tutkimuksen mukaan useimmat lopettavat Atkinsin ruokavalion noudattamisen 2-3 vuodessa.

Stanfordin yliopiston tutkimuksessa Atkinsin dieettiä noudattavien verenpaine ja kolesterolitasot kehittyivät suotuisaan suuntaan, ja dieetti laihdutti tehokkaammin kuin vertailtavat laihdutusruokavaliot.

Ruokavalion alkuvaiheessa joillain laihduttajilla ilmenee:

  • päänsärkyä
  • huimausta
  • heikotusta
  • väsymystä
  • ummetusta

Atkinsin dieetin puolestapuhujien mukaan ruokavalio sopii painonpudotuksen ohella diabeteksen ja korkean verenpaineen hoitoon. Muunneltua Atkinsin dieettiä käytetään myös lasten vaikean epilepsian lääketieteelliseen hoitoon.

Hyödyt

Ruokavalion kehittäjän Robert Atkinsin mukaan vähähiilihydraattisen ruokavalion etuja ovat:

  • Ruoan määrää tai kalorimäärää ei rajoiteta
  • Nälkää ei tarvitse tuntea
  • Ruokahalu vähenee
  • Ruoansulatus paranee
  • Paino laskee eikä tule takaisin, koska ruokavalio sopii pysyvään painonhallintaan
  • Useimmat ylipainoisuuteen liittyvät terveysongelmat helpottuvat

Atkinsin mukaan vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion myötä veren kolesteroliarvot paranevat ja sydäntautien riski vähenee. Atkinsin mukaansa ruokavalioon liitetyt terveysongelmat eivät johdu rasvasta, vaan 1800-luvun jälkeen yleistyneiden prosessoitujen hiilihydraattien käytöstä.

ketogeenisen ruokavalion hyötyjä:

1. Vähähiilihydraattinen ruokavalio vähentää ruokahalua

Monissa laihdutusruokavalioissa jatkuva näläntunne tuottaa ongelmia. Se johtaa helposti dieetin lopettamiseen. Vähähiilihydraattinen ruokavalio ylläpitää kylläisyyden tunnetta erinomaisesti, vaikka se samalla leikkaa energiansaantia.

Tutkimusten mukaan hiilihydraatteja rasvalla ja proteiineilla korvaavat saavat ravinnosta vähemmän kaloreita kuin hiilihydraattipainotteista ruokavaliota noudattavat.

2. Atkinsin dieetti on tehokkain laihdutusruokavalio ensimmäiset kuukaudet

Hiilihydraattien rajoittaminen on yksinkertaisin ja tehokkain tapa laihtua. Tutkimusten mukaan vähän hiilihydraatteja sisältävää ruokavaliota noudattavat laihtuvat nopeammin kuin laihduttajat, jotka rajoittavat rasvaa ja laskevat kaloreita.

Tutkimuksissa, joissa on vertailtu vähähiilihydraattisen ruokavalion ja vähärasvaisen ruokavalion tehoa laihduttamisessa, on havaittu, että hiilihydraatteja rajoittamalla laihtuu selvästi nopeammin ja enemmän tuntematta nälkää.

Vähän hiilihydraatteja sisältävä dieetti on muita laihdutusruokavalioita tehokkaampi ensimmäisen puolen vuoden aikana, mutta sen jälkeen erot ruokavalioiden välillä tasoittuvat.

3. Viskeraalinen vyötärölihavuus vähenee selvästi

Kaikki rasvat eivät ole samanarvoisia. Pahinta elimistöön kertyvää rasvaa on vatsaonteloon elinten ympärille varastoituva viskeraalinen rasva eli sisälmysrasva.

Sillä mihin kehon osaan rasva varastoituu, on merkitystä terveyden ja sairastumisriskin kannalta. Viskeraalinen rasva on yleisintä ylipainoisilla miehillä. Vyötärölihavuuteen liittyy usein myös maksan rasvoittuminen.

Viskeraalinen rasva kerääntyy vatsaontelossa elinten ympärille ja kasvattaa inflammaation sekä insuliiniresistenssin riskiä.

Vähän hiilihydraatteja sisältävät ruokavaliot, kuten Atkinsin dieetti, vähentävät hyvin tehokkaasti erityisesti vatsaonteloon kerääntyvää viskeraalista rasvaa.

4. Triglyseridien määrä veressä laskee merkittävästi

Triglyseridit ovat verenkierrossa kiertäviä vapaita rasvahappoja. Koholla olevat triglyseridit on tunnettu sydäntautien riskitekijä. Runsaasti hiilihydraatteja sisältävä ravinto ja etenkin fruktoosi kasvattavat veren triglyseridipitoisuutta.

Hiilihydraatteja rajoittavassa ruokavaliossa veren vapaat rasvahapot – triglyseridit siirtyvät ketoaineiden ja energiantuotantoon.

5. Atkinsin ruokavalio lisää hyvän HDL-kolesterolin määrää

HDL tunnetaan ns. ”hyvänä” kolesterolina: ts. mitä enemmän HDL-kolesterolia veressä on suhteessa LDL-kolesteroliin, sitä pienempi sydäntautiriski. Vastaavasti LDL-kolesterolin kasvu kasvattaa sydäntautien riskiä.

Paras tapa lisätä hyvän HDL-kolesterolin määrää, on syödä rasvaa. Atkinsin ruokavalio ja muut ketogeeniset ruokavaliot ovat runsasrasvaisia dieettejä. Lähde1, Lähde2.

6. Veren sokeri- ja insuliinipitoisuus laskee

Vähähiilihydraattiset ja ketogeeniset ruokavaliot saattavat vähentää lääkkeiden tarvetta metabolista oireyhtymää ja tyypin 2 diabetesta sairastavilla. Hiilihydraattien rajoittaminen laskee verensokeria ja veren insuliinitasoja.

Joidenkin aikuistyypin diabetesta sairastavien insuliinintarve laskee Atkinsin ruokavalion myötä jopa 50 %. Yhden tutkimuksen mukaan tyypin 2 diabetesta sairastavista 95 prosenttia vähensi lääkkeiden käyttöä 6 kuukauden sisällä Atkinsin dietiin aloittamisesta. Lähde.

Jos sairastat diabetesta ja aloitat vähähiilihydraattisen ja ketogeenisen ruokavalion, konsultoi asiasta lääkäriäs, sillä riskinä on hypglykemia.

7. Atkinsin ruokavalio voi laskea verenpainetta

Kohonnut verenpaine lisää sydän- ja verisuonitautien riskiä. Vähän hiilihydraatteja sisältävät ruokavaliot voivat joidenkin tutkimusten mukaan laskea verenpainetta.

Lähteitä:

Glykemiakuorma
Ketoosi
What to know about low-carb, high-fat diets
Atkins diet: What is it and should I try it?
Aktins.com
Atkinsin dieetti




Ravinto vaikuttaa syövän riskiin

Hilary Brueck raportoi Business Insiderissa laajasta kansainvälisestä seurantatutkimuksesta, joka osoitti yhteyden ruokatottumusten ja syövän riskin väliltä. 18.9.2018 julkaistu tutkimus seurasi 471 495 eurooppalaisen aikuisen ruokatottumusten ja syövän yhteyttä keskimäärin 15 vuoden ajan.

Tutkimus vahvisti aiempia havaintoja, joiden mukaan suuri annoskoko, runsas punaisen lihan, suolan ja lisätyn sokerin saanti, tyydyttyneitä rasvoja sisältävät ruoat, pikaruoat, snacksit ja alkoholi kasvattavat syöpien riskiä. Runsaasti tuoreita hedelmiä, vihanneksia ja palkokasveja sekä rasvaista kalaa ja vähärasvaista lihaa syövien riski sairastua syöpään oli pienempi ja yleinen terveys parempi.

PLOS Medicine-lehden julkaisema tutkimus osoitti, että runsaasti elimistön tarvitsemia ravinteita sekä vähän energiaa sisältävällä ruokavaliolla voi jonkin verran laskea yleisten syöpien riskiä. Vähän ravinteita ja runsaasti energiaa sisältävä ruokavalio puolestaan kasvatti hieman syöpään sairastumisen riskiä.

Tutkimuksen tehneet 56 tutkijaa seurasivat 471 495 ihmisen ravintotottumuksia kymmenessä Euroopan maassa keskimäärin 15 vuoden ajan.

”In this study, we observed a higher risk of cancer for people eating, on average, more foods with a high content in energy, sugar, saturated fat, or sodium,” the study’s lead author, Mélanie Deschasaux, told Business Insider in an email, giving examples such as processed meats, pastries, and cola.

Seurantatutkimuksessa ravintoarvoiltaan heikointa ruokavaliota noudattavien riski sairastua syöpiin oli 7 % korkeampi kuin niillä, jotka noudattivat kasvispainotteisempaa ja kevyempää ruokavaliota.

Vahvin korrelaatio ravintotottumusten ja syöpien välillä havaittiin seuraavien syöpien kohdalla:

  • Paksusuolen syöpä
  • Vatsasyöpä
  • Suun syövät (huulisyöpä, kielisyöpä)
  • Keuhkosyöpä (miehillä)
  • Maksa- ja rintasyöpä (naisilla)

Tutkimus

Tutkimuksessa kontrolloitiin syövän riskiin vaikuttavia muita muuttujia, kuten seurattujen perinnöllinen alttius sairastua johonkin syöpään, fyysinen aktiivisuus, tutkittavan painoindeksi ja tupakointi.

Näistä yleisistä syöpien riskiä kasvattavista muuttujista riippumatta epäterveellisen ruokavalion osoitettiin kasvattavan eräiden syöpien riskiä. Henkilöt, jotka söivät paljon pikaruokaa, lisättyjä sokereita, runsaasti suolaa, tyydyttyneitä rasvoja ja punaista lihaa sairastuvat todennäköisemmin syöpään kuin ravintoarvoiltaan rikkaampaa runsaasti hedelmiä ja kasviksia syövät henkilöt.

Ravinteiltaan heikoimpia ruokia syötiin runsaimmin Isossa-Britanniassa, Saksassa ja Ranskassa. Välimeren maissa ja Norjassa ihmiset olivat tutkimuksen mukaan keskimäärin terveempiä.

Tutkimus tukee kasvavaa näyttöä siitä, että kasvispainotteinen ja paljon kuituja sisältävä ravinto korreloi pitkän iän ja terveyden kanssa. Prosessoidut ruoat näyttävät sen sijaan kasvattavan erilaisten sairauksien riskiä ja lyhentävän odotettavissa olevaa elinaikaa.

Yleinen havainto ravitsemusta käsittelevissä tutkimuksissa on ollut, että paljon tuoreita hedelmiä ja vihanneksia, terveellisiä rasvoja kuten oliiviöljyä, avokadoja ja pähkinöitä sekä terveellisiä kuituja sisältävä Välimeren ruokavalio assosioituu pidempään ja terveempään elämään.

Helmikuussa julkaistu 100 000 aikuisen ruokatottumuksia analysoinut ranskalaistutkimus osoitti, että eniten prosessoituja ja pakattuja valmisruokia, sipsejä ja keksejä, sokeroituja muroja, pakasteaterioita ja makeutettuja virvoitusjuomia syövillä oli kasvanut riski sairastua mihin tahansa syöpään verrattuna niihin, jotka söivät vähemmän prosessoituja ja vähemmän sokereita sisältävää ruokia.

Lisäämällä ruokavalioon hyviä kuituja sisältäviä täysjyväviljoja sekä kasviksia, hedelmiä, hyviä rasvanlähteitä ja kasviproteiineja syövän ja erityisesti paksusuolen syövän riskiä voi hieman laskea. Prosessoitujen, runsaasti sokeria, suolaa ja huonoja rasvoja sisältävän ravinnon yleistymisen (”pikaruokakulttuurin”) vaikutus on havaittavissa paksusuolen syövän yleistymisenä erityisesti nuorilla.

Ruoansulatus ei voi pilkkoa sulamattomia ravintokuituja elimistön ravinnoksi, mutta ne parantavat suoliston hyvinvointia nopeuttamalla ruokamassan kulkua suolistossa. Samalla kuidut ja resistentti tärkkelys hyödyntävät suoliston mikrobiomia, joka vaikuttaa elimistön hyvinvointiin monin tavoin.

Ravintokuidut pienentävät suolistosyöpien riskiä. Tämä perustuu ainakin osittain siihen, että kuituja pilkkovat suoliston mikrobit tuottavat lyhytketjuisia rasvahappoja, kuten butyraattia, joka ehkäisee kasvainten kehittymistä paksusuoleen.

” Lyhytketjuisia terveydelle tärkeitä suolistossa syntyviä rasvahappoja, tai tarkemmin niiden suoloja, ovat asetaatti, propionaatti ja erityisesti butyraatti. Lyhytketjuisilla rasvahapoilla on kokeellisissa tutkimuksissa syöpää, infektioita ja suolistoinflammaatiota estävää vaikutusta. Ne myös auttavat suoliston pintaa uusiutumaan ja pysymään terveenä.” – Lähde: Pronutritionist

Täysjyväviljoista saatavat kuidut ovat erityisen hyviä suoliston terveydelle, koska viljan kuoriosat ja alkiot (bran & germ) stimuloivat hapetusstressiä vähentävien antioksidanttien toimintaa ja sisältävät useita hyviä ravinteita, kuten sinkkiä, kuparia ja E-vitamiinia.

Lähde: Business Insider