90 päivän ketohaaste! Sokeri- ja rasva-arvot paranevat 90 päivän ketogeenisellä dieetillä

Sukelsin ketoosiin melkein vuosi sitten. Tähän vuoteen on mahtunut monta syrjähyppyä ja horjahdusta, mutta myös ihmeellisiä onnistumisia painon, verensokerin ja verenpaineen osalta. Kesän harkitsemattomien ruoka- ja bissejammailujen seurauksena painoni kääntyi kasvuun ja energiatasoni romahtivat. Viimeisen kuukauden aikana olen ottanut itseäni niskasta kiinni ja palannut ketogeenisen ruokavalion perusteisiin. Paino on sen jälkeen pudonnut nopeasti alle 8o kilon. Energiaa minussa on on taas kuin pienessä kylässä.

Pankkitili on yhtä tyhjä kuin tyhjyyttään ammottava jääkaappi, mutta minua se hymyilyttää, sillä taivaarannassa näy huolen häivääkään. Tällaisen mielialan voi selittää kaksi asiaa: a) olen flipannut viri-viri-tööt-tööt-maailmaan, tai

b) metabolinen muutos glukoosiaineenvaihdunnasta rasva-aineenvaihduntaan vaikuttaa fysiologisesti myös mielialaan, koska:

  • ketooosin stimuloima autofagia siivoaa neuroneita haitallisista kuona-aineista ja tehostaa hermosolujen energiantuotantoa,
  • lipolyysi vapauttaa tasaisesti vapaita rasvahappoja energiasubstraateiksi solujen käyttöön,
  • sydän työskentelee tyytyväisesti rasvahapoilla ja aivosolut betahydroksibutyraatilla,
  • metabolinen muutos syntetisoi keskushermostoa yliaktiivisena pitävästä glutamaatista keskushermostoa rauhoittavaa GABAa
  • stressihormoni-kortisolin tasot laskevat ketogeenisellä ruokavaliolla

Ketogeeninen ruokavalio parantaa tutkimusten ja omien kokemusteni perusteella veren sokeri-, insuliini- ja rasva-arvoja. Hiilihydraatteja rajoittamalla verenpaine ja paino putoavat. Oma verenpaineeni oli aamulla 111/73/78, verensokeri 5,4 mmol/l ja paino 79,0 kg.

Vähähiilihydraattiset ruokavaliot ovat tehokkaita strategioita insuliiniresistenssin parantamiseksi. Insuliiniherkkyyden heikkeneminen on merkki insuliiniresistenssistä, joka on tyypin 2 diabeteksen ja monien muiden elintapasairauksien taustalla piilotteleva kantasyy.

Tässä kuvattujen kliinisten potilaskertomusten tarkoituksena on osoittaa ne merkitykselliset muutokset, joita havaittiin 90 päivän vähähiilihydraattisten (LCHF) ketogeenisten ruokavalion noudattamisen seurauksena18-45 vuotiailla naispuolisilla tyypin 2 diabeetikoilla.

Yksitoista naista, joiden painoindeksi oli keskimäärin 36,3, ja joilla oli hiljattain diagnosoitu yli 6,5% (8,9%) HbA1c-tyypin perusteella tyypin 2 diabetes, osallistui kontrolloituun ruokavaliointerventioon, jossa ruokavalion hiilihydraatit rajoitettiin alle 30 grammaan päivässä 90 päivän ajaksi.

Glykatoitunut hemoglobiini (A1C, HbA1c, Hb1c, HGA1C) on punasoluissa esiintyvä hemoglobiinin (Hb) muoto, jonka pitoisuuden mittausta veressä käytetään arvioimaan kolmen viimeisimmän kuukauden aikaista keskimääräistä verensokeritasoa. Testin keskiarvo on rajoittunut kolmeen kuukauteen, sillä normaalia hemoglobiinia ja A1C:tä sisältävien punasolujen elinikä ihmisissä on noin 4 kuukautta.
A1C-koetta voidaan käyttää esimerkiksi diabeteksen totemiseen. A1C:tä muodostuu diabeteksessa ilmenevässä hyperglykemiassa normaalia enemmän hemoglobiinin reagoidessa hallitsemattomasti veren glukoosin kanssa ei-entsymaattisen glykaation kautta. A1C-testit mittaavat hemoglobiiniin sitoutuneen beta-N-1-deoksi fruktosyylin määrää.
A1C:n yksikkönä käytetään usein millimoolia beta-N-1-deoksi fruktosyyliä sitovaa hemoglobiini A:ta (A1C) per mooli normaalia hemoglobiini A:ta. Yksikkö on siis mmol/mol. A1C-arvon mittaus ei edellytä paastoamista.
Suomessa normaali A1C-arvo eli viitearvo on kaikille ihmisryhmille 20–42 mmol/mol. 42–482 mmol/mol voi merkitä sitä, että henkilö potee esidiabetesta. Arvo, joka on yli 482 mmol/mol, merkitsee sitä, että henkilöllä on ehkä tyypin 1 diabetes tai tyypin 2 diabetes. Diabetes voidaan tarvittaessa varmentaa esimerkiksi A1C-testistä erillisellä sokerirasituskokeella. Nieltyä diabeteslääkitystä käyttävien tulisi pyrkiä A1C-arvoon, joka on alle 532 mmol/mol ja insuliinia käyttävien arvoon, joka on 53–582 mmol/mol. 69–752 mmol/mol taas merkitsee taas sitä, että potilaan diabetes on huonosti hallinnassa. – Wikipedia

Intervention tavoitteena oli määrittää HbA1c:n muutosaste, kun taas toissijaisiin tuloksiin sisältyi muutokset painossa, verenpaineessa ja veren rasva-arvoissa.

Vapaaehtoisten paino laski 90 vuorokauden ketogeenisen ruokavalion noudattamisen aikana merkittävästi. Myös systolinen ja diastolinen verenpaine laskivat. HbA1c putosi lähtöarvosta keskimäärin terveeseen 5,6-tasoon.

Koehenkilöiden veren rasva-arvoista suurin osa, kuten HDL-kolesteroli, triglyseridit ja TG: HDL -suhde muuttuivat parempaan suuntaan. Koehenkilöiden LDL-kolesterolin pitoisuus ei muuttunut merkittävästi. Maksan terveyden markkereiden, AST:n ja ALAT:n muutoksia mitattiin kahdeksalta potilaalta, eivätkä ne osoittaneet merkittäviä muutoksia.

Nämä havainnot viittaavat siihen, että lyhytaikainen ketogeeninen interventio, joka korostaa proteiinia ja rasvaa ruokavalion hiilihydraattien kustannuksella, voi kääntää diabeteksen diagnoosin, kuten HbA1c määrittelee. Veren sokeri- ja rasva-arvojen lisäksi interventio alensi koehenkilöiden painoa ja verenpainetta.

1. Johdanto

Insuliiniresistenssi on globaalisti yleisin aineenvaihduntasairaus [1]. Hyperglykemia, hyperinsulinemia ja insuliiniresistenssi vaikuttavat lähes kaikkien elintapasairauksien taustalla. Insuliiniresistenssia sairastaa jo puolet aikuisista Yhdysvalloissa [2], Aasiassa [3] ja Lähi-idän maissa [4].

Hämmästyttävän yleisyytensä lisäksi insuliiniresistenssi lisää monien kroonisten sairauksien, kuten sydän- ja verisuonitautien [5], dementian [6] ja syövän riskiä.

Insuliiniresistenssin maailmanlaajuinen yleistyminen pitäisi pysäyttää pikaisesti. Insuliiniresistenssi on sairastuneelle inhimillinen taakka, mutta se rasittaa myös yhteiskuntaa, taloutta ja terveydenhoidon kantokykyä. On aika miettiä strategioita tämän epidemian tukahduttamiseksi.

Metabolisen oireyhtymän, aikuistyypin diabeteksen, alkoholista riippumattoman rasvamaksan sekä sydän-ja verisuonitautien ja monien muiden insuliiniresistenssiin liittyvien vaivojen vähentäminen väestötasolla säästää yhteiskunnalle pitkän pennin.

Insuliiniresistenssistä johtuvien aineenvaihduntasairauksien terapiaan käytetään laajasti erilaisia sosiaali- ja terveyspalveluja sekä farmakologisia hoitoja. Monet lääkehoidot pyrkivät estämään glukoosin imeytymistä ohutsuolesta verenkiertoon (esim. α-glukosidaasin estäjät) tai lisäämään glukoosin erittymistä munuaisin (esim. SGLT2-estäjät, jotka vähentävät glukoosin takaisinimeytymistä munuaisissa, jolloin glukoosia poistuu virtsan mukana).

Lääkehoidoilla on lähes aina sivuvaikutuksia. Niin myös α-glukosidaasilla ja SGLT2-estäjillä, jotka voivat aiheuttaa potilaille mm. osmoottista ripulia [8] ja virtsatieinfektioita [9].

Nämä lääkkeet kyllä laskevat veren sokeri- ja insuliinipitoisuutta, millä on suotuisia vaikutuksia insuliiniresistenssiin, mutta lääkkeiden sivuoireet eivät houkuta lääkekuurin täsmälliseen noudattamiseen, etenkään, jos aikuistyypin diabetes ja insuliiniresistenssi eivät oireile.

Farmakologisisesti verensokeria lasketaan estämällä glukoosin imeytymistä tai edistämällä glukoosin poistumista virtsan mukana. Järkevä tapa hoitaa insuliiniresistenssia ja siihen liittyviä sairauksia on ksinkertaisesti vähentää glukoosin saantia.

Vaihtoehto lääkehoidoille on elämäntaparemppa, jossa glukoosinlähteitä, eli hiilihydraatteja rajoitetaan tuntuvasti. Tämä lähestymistapa on tunnettu menetelmä insuliiniresistenssin hoitona [10].

Ravinnon sisältämät hiilihydraatit kohottavat verensokeria ja veren insuliinipitoisuutta. Tehokas ruokavaliostrategia rakentuu proteiinien ja rasvojen varaan. Niillä on vain vähäinen vaikutus veren sokeri- ja insuliiniitasoihin [11]. Tämän pilottitutkimuksen tarkoituksena oli selvittää, riittääkö 90 päivän vähähiilihydraattinen ruokavalion muutos parantamaan insuliiniresistenssin ja tyypin 2 diabeteksen markkereita.

2. Materiaalit ja menetelmät

2.1. Osallistujat

Koehenkilöitä rekrytoitiin Provon ja Oremin alueelta Utahin osavaltiossa. Retrospektiivisen kaavion tarkastelun hyväksyi Brigham Youngin yliopiston institutionaalinen arviointilautakunta.

Sisältökriteerit olivat ikä 18-45 vuotta ja äskettäin diagnosoitu tyypin 2 diabetes mellitus HbA1c: n perusteella (6,5% tai korkeampi), samoin kuin kaikki metabolisen oireyhtymän piirteet, mukaan lukien hypertensio ja dyslipidemia.

Poissulkemisperusteisiin sisältyivät lääkkeiden käyttö, aiemmat sairausdiagnoosit, raskaus ja hoitotyö. Lähtötason verikokeet tehtiin seulontakäynnillä. Koehenkilöt eivät saaneet rahallista korvausta.

2.2. Interventio

Koehenkilöille tarjottiin henkilökohtaista tukea ja opetusmateriaalia viikkokäynneillä koko interventiotutkimuksen ajan. Viikkokäynnit koostuivat ruokavalion noudattamisen seuraamisesta ja ketonimittauksista.

Ketogeenisen ruokavalion noudattaminen vahvistettiin viikoittaisilla testeillä sen varmistamiseksi, että plasman ketonit (Precision Xtra, Abbott, Chicago IL) olivat vähintään 0,5 mmol / l (taulukko 1; keskiarvo viikolla 1; keskiarvo viikolla 12:) .

Oppimateriaalit, kuten luettelo vältettävistä ja sallituista elintarvikkeista sekä henkilökohtaiset käynnit koehenkilöiden luona suunniteltiin lisäämään koehenkilöiden ymmärrystä vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion perusteista ja tukemaan ketogeenisen ruokavalion noudattamista.

Koehenkilöitä kannustettiin noudattamaan yksinkertaista sääntöä ”kontrolloi hiilihydraatit” (noin 5 % päivittäisestä energiasta), ”priorisoi proteiinit” (noin 20-25 % päivittäisestä energiasta) ja ”täytä rasvalla” (noin 70-75% päivittäisestä energiasta).

Ruokavalion keskeinen osa oli rajoittaa hiilihydraattien saantia enintään 30 grammaan päivässä. Koehenkilöitä kannustettiin syömään vapaasti proteiinia ja rasvaa: liha, munat ja juusto kuuluivat suositeltuihin ravintoaineisiin. Koehenkilöitä kannustettiin liikkumaan koko tutkimuksen ajan.

Taulukko 1

2.3. Mitä mitattiin?

Keskeisiä muuttujia olivat paino, verenpaine ja verilaboratoriotestit 12 tunnin paaston jälkeen. Ketonitasot arvioitiin viikoittain, kun taas kaikki muut tulokset arvioitiin tutkimusjakson alussa ja lopussa. Kaikki arvioinnit teki lääkäri ja kaikki verianalyysit suoritettiin samassa laboratoriossa.

3. Tulokset

3.1. Paino ja painoindeksi

Koehenkilöt olivat keskimäärin 38,3 +/- 2,6 -vuotiaita valkoihoisia naisia. Naiset painoivat keskimäärin 85,7 +/-3,2 kg. Naisten painoindeksi oli 90 päivän intervention alussa 36,3 +/- 1,4 kg/m2. Kaikki koehenkilöt laihtuivat 90 päivän ruokavaliointervention aikana huomattavasti: koehenkilöiden keskipaino oli kokeen loputtua 76,7 +/- 3,2 kg. Vastaavasti keskimääräinen painoindeksi oli kokeen jälkeen 32,7 +/-1,5 kg/m2. Kuvat 1 a ja b

3.2. Systolinen ja diastolinen verenpaine

Koehenkilöiden verenpaine laksi ruokavalion aikana. Intervention alussa koehenkilöiden keskimääräinen systolinen verenpaine oli 134,0 +/-1,6 ja diastolinen verenpaine 89,9 +/- 1,3 mmHg.päivän ketogeenisen ruokavaliointervention päätyttyä koehenkilöiden verenpaine oli laskenut 123,3 +/- 1,1 (p< 0,0001), 82,6 +/-1,0 mmHg (p <0,005. Kuva 2 a ja b

Glykoitunut hemoglobiini

Glykoituneen hemoglobiinin (HbA1c) tasot ovat merkityksellisiä indikaattoreita pitkäaikaisesta korkeasta verensokerista ja osoittavat siten diabeteksen vakavuutta. Koska glukoosipitoisuudet ovat jatkuvasti koholla, glukoosi voi sitoutua epäentsymaattisesti punasolujen hemoglobiiniin.

Perinteisesti diabeettinen alue HbA1c:lle on 6,5%, ja diabeettiset strategiat keskittyvät ensisijaisesti saamaan HbA1c:n lähelle tai alle kyseisen raja-arvon. Kaikilla koehenkilöillä diagnosoitiin diabetes, ja keskimääräinen HbA1c oli 8,9 +/-0,4 %. 90 päivän kuluessa LCHF-interventiosta HbA1c laski tasolle 5,6 +/-0,3 % (p < 0,0001). Kuva 3

3.4. Veren rasva-arvot (lipidit)

Verikokeilla mitataan yleensä prototyyppiset veren lipidit, joihin kuuluvat LDL-kolesteroli, HDL-kolesteroli ja triglyseridit.

Jokaisen näistä on perinteisesti uskottu muuttavan sydänsairauksien riskiä. Siltä osin kuin sydänsairaudet ovat yleisiä tyypin 2 diabeteksessa [12], glykeemisen statuksen ja veren lipidien yhteys on ymmärrettävä.

Samoin kuin HbA1c: kohdalla, ruokavalion vaikutus veren lipideihin oli huomattava. Vaikka LDL-kolesterolin lasku (kuva 4 a) ei ollut merkittävä, triglyseridit (TG: kuva 4 b) laskivat merkittävästi (p < 0,005), kun taas HDL-kolesterolin pitoisuus veressä lisääntyi (kuva 4 c). Triglyseridi : HDL-suhde laski merkittävästi tasolta 4,6 +/-0,8 tasolle 1,6 +/- 0,2 (kuva 4 d); (p<0,005). Erityisen huomionarvoista on, että Triglyseridi : HDL-suhteen ja sydänsairauksien välinen korrelaatio on vahvempi kuin LDL:n ja sydänsairauksien välinen korrelaatio Se on siis varsin hyvä indikaattori sydän- ja verisuonitautien riskistä [13].

3.5. Maksa-arvot

Insuliiniresistenssi ja tyypin 2 diabetes liittyvät moniin maksasairauksiin. ASAT- ja ALAT-pitoisuudet plasmassa mittaavat maksan terveyttä. Nämä mitattiin kahdeksalta potilaalta (kuva 5 a ja b). 90 päivän ketogeeninen ruokavaliointerventio ei vaikuttanut merkittävästi maksa-arvoihin.

4. Ajatuksia

Tämän tutkimuskatsauksen motiivina on esittää kestoltaan rajoitetun (90 päivää) ketogeenisen ruokavalion vaikutusta glykeemisiin HbA1c-arvoihin interventioryhmässä, jonka koehenkilöillä oli hiljattain diagnosoitu tyypin 2 diabetes.

Tutkimuksessa havaittiin, että vähän hiilihydraatteja sisältävä ketogeeninen ruokavalio, jossa hiilihydraattien osuus oli noin 5% päivittäisestä energiansaannista, johti merkittävään HbA1c-arvon putoamiseen diabeettiselta tasolta (8,9%) standardiin (5,6%) vain 90 päivässä.

Lisäksi interventio johti merkittäviin parannuksiin kaikissa muissa kardiometabolisissa markkereissa, mukaan lukien paino, BMI, verenpaine ja triglyseridi (TG): HDL-suhde.

Tässä tutkimuksessa on merkityksellisiä rajoituksia, jotka on huomioitava. Ensinnäkin raportin otoskoko on todella pieni (11). Toiseksi interventioon valikoitui diabeetikkoja, jotka olivat motivoituneita noudattamaan vähähiilihydraattista ruokavaliota. .

Toisaalta pidempien ja paljon suurempien tutkimusten tulokset osoittavat, että hiilihydraattirajoitus tuottaa samanlaisia, vaikkakin vähemmän dramaattisia tuloksia. Äskettäin Hallberg et al. [14] havaitsi suhteellisen merkittävän laskun HbA1c:ssä, TG: ssä ja muissa lipideissä satunnaistamattomassa tutkimuspopulaatiossa yhden vuoden aikana.

Samanlaisia havaintoja havaitsivat Westman et al. [15] vain 24 viikon keston aikana tutkimuksessa, jossa hyödynnettiin tutkimuksen kohteiden satunnaistamista. Jälleen hiilihydraatilla rajoitetulla ryhmällä oli merkittävästi suurempi HbA1c-arvon lasku (-1,5% vs. 0,5%) verrattuna korkeamman hiilihydraatin ryhmään.

Yhteistä tutkimuksille on interventioryhmän saama tuki ja opetus. Yhtä hyviin tuloksiin ei ole päästy tutkimuksissa, joissa interventioryhmä ei saa asianmukaista koulutusta ja tukea.

Hiilihydraattirajoitusten käyttö diabeteksen hoidossa on kuitenkin jo niin vakiintunut ja hyväksytty, että jopa American Diabetes Association totesi äskettäin julkaistussa diabeteshoitojen päivityksessä (Standards of Medical Care in Diabetes): ”Tutkimukset osoittavat, että vähähiilihydraattiset ruokavaliot voivat johtaa parempaan glykemiaan ja vähentää antihyperglykeemisten lääkkeiden tarvetta tyypin 2 diabetesta sairastavilla henkilöillä”[17].

Pasman insuliinipitoisuuksien puute tässä tutkimuksessa estää vetämästä lopullisia johtopäätöksiä insuliiniresistenssistä. Ryhmämme tulevat tutkimukset korjaavat tämän puutteen paneutumalla perusteellisemmin ketogeenisen intervention vaikutuksiin insuliiniherkkyyteen.

Tämän pilottitutkimuksen koehenkilöillä havaitut lipidimuutokset heijastavat kuitenkin insuliiniherkistävää vaikutusta siltä osin kuin TG: HDL-suhde, jonka uskotaan viittaavan insuliiniresistenssiin [18, 19], laski merkittävästi.

HbA1c:n vaikutus diabeteksesta johtuviin vakaviin lisäsairauksiin, kuten neuropatiaan [20], nefropatiaan [21] ja erityisesti sydän- ja verisuonitauteihin [22], pyritään farmakologisesti estämään alentamalla glukoosia ja HbA1c:tä insuliinia lisäämällä joko insuliinihoidon tai insuliinin eritystä lisäävien lääkkeiden avulla.

Keskittyminen HbA1c:hen ja glykeemiseen säätelyyn sekä intensiiviset pyrkimykset glukoosin HbA1c:n alentamiseen nostamalla keinotekoisesti insuliinia nykyisen tyypin 2 diabetekselle tyypillisen hyperinsulinemian yläpuolelle johtavat kuolleisuuden lisääntymiseen [23].

Tämä on tärkeä näkökohta. Ketogeeninen ruokavalio helppona ja turvallisena kliinisenä interventiona laskee HbA1c:tä pahentamatta hyperinsulinemiaa. Tässä mielessä hiilihydraatteja rajoittava lähestymistapa on intuitiivinen, suositeltava ja tehokas tapa saada tyypin 2 diabetes remissioon.

Viitteet

  1. M. G. Saklayen, “The global epidemic of the metabolic syndrome,” Current Hypertension Reports, vol. 20, no. 2, p. 12, 2018. View at: Publisher Site | Google Scholar
  2. A. Menke, S. Casagrande, L. Geiss, and C. C. Cowie, “Prevalence of and trends in diabetes among adults in the United States, 1988-2012,” JAMA, vol. 314, no. 10, pp. 1021–1029, 2015. View at: Publisher Site | Google Scholar
  3. C. Hu and W. Jia, “Diabetes in China: epidemiology and genetic risk factors and their clinical utility in personalized medication,” Diabetes, vol. 67, no. 1, pp. 3–11, 2018. View at: Publisher Site | Google Scholar
  4. B. Abuyassin and I. Laher, “Diabetes epidemic sweeping the Arab world,” World Journal of Diabetes, vol. 7, no. 8, pp. 165–174, 2016. View at: Publisher Site | Google Scholar
  5. C. Wang, F. Li, J. Guo, C. Li, D. Xu, and B. Wang, “Insulin resistance, blood glucose and inflammatory cytokine levels are risk factors for cardiovascular events in diabetic patients complicated with coronary heart disease,” Experimental and Therapeutic Medicine, vol. 15, no. 2, pp. 1515–1519, 2018. View at: Publisher Site | Google Scholar
  6. S. M. de la Monte and J. R. Wands, “Alzheimer’s disease is type 3 diabetes-evidence reviewed,” Journal of Diabetes Science and Technology, vol. 2, no. 6, pp. 1101–1113, 2008. View at: Publisher Site | Google Scholar
  7. J. S. Kasper and E. Giovannucci, “A meta-analysis of diabetes mellitus and the risk of prostate cancer,” Cancer Epidemiology, Biomarkers & Prevention, vol. 15, no. 11, pp. 2056–2062, 2006. View at: Publisher Site | Google Scholar
  8. R. J. Playford, C. Pither, R. Gao, and S. J. Middleton, “Use of the alpha glucosidase inhibitor acarbose in patients with ‘Middleton syndrome’: normal gastric anatomy but with accelerated gastric emptying causing postprandial reactive hypoglycemia and diarrhea,” Canadian Journal of Gastroenterology, vol. 27, no. 7, pp. 403-404, 2013. View at: Publisher Site | Google Scholar
  9. K. M. Johnsson, A. Ptaszynska, B. Schmitz, J. Sugg, S. J. Parikh, and J. F. List, “Urinary tract infections in patients with diabetes treated with dapagliflozin,” Journal of Diabetes and its Complications, vol. 27, no. 5, pp. 473–478, 2013. View at: Publisher Site | Google Scholar
  10. W. C. Knowler, E. Barrett-Connor, S. E. Fowler et al., “Reduction in the incidence of type 2 diabetes with lifestyle intervention or metformin,” The New England Journal of Medicine, vol. 346, no. 6, pp. 393–403, 2002. View at: Publisher Site | Google Scholar
  11. F. Q. Nuttall and M. C. Gannon, “Plasma glucose and insulin response to macronutrients in nondiabetic and NIDDM subjects,” Diabetes Care, vol. 14, no. 9, pp. 824–838, 1991. View at: Publisher Site | Google Scholar
  12. G. Reaven, “Intensive blood pressure/glucose control in type 2 diabetes: why is it so difficult to decrease coronary heart disease?” Journal of Human Hypertension, vol. 13, pp. S19–S23, 1999. View at: Publisher Site | Google Scholar
  13. P. L. da Luz, D. Favarato, J. R. Faria-Neto Jr., P. Lemos, and A. C. Chagas, “High ratio of triglycerides to HDL-cholesterol predicts extensive coronary disease,” Clinics, vol. 63, no. 4, pp. 427–432, 2008. View at: Publisher Site | Google Scholar
  14. S. J. Hallberg, A. L. McKenzie, P. T. Williams et al., “Effectiveness and safety of a novel care model for the management of type 2 diabetes at 1 year: an open-label, non-randomized, controlled study,” Diabetes Therary, vol. 9, no. 2, pp. 583–612, 2018. View at: Publisher Site | Google Scholar
  15. E. C. Westman, W. S. Yancy Jr., J. C. Mavropoulos, M. Marquart, and J. R. McDuffie, “The effect of a low-carbohydrate, ketogenic diet versus a low-glycemic index diet on glycemic control in type 2 diabetes mellitus,” Nutrition & Metabolism, vol. 5, no. 1, 2008. View at: Publisher Site | Google Scholar
  16. N. Iqbal, M. L. Vetter, R. H. Moore et al., “Effects of a low-intensity intervention that prescribed a low-carbohydrate vs. a low-fat diet in obese, diabetic participants,” Obesity, vol. 18, no. 9, pp. 1733–1738, 2010. View at: Publisher Site | Google Scholar
  17. American Diabetes Association, “Standards of medical care in diabetes—2019 abridged for primary care providers,” Clinical Diabetes, vol. 37, no. 1, pp. 11–34, 2019. View at: Publisher Site | Google Scholar
  18. S. J. Kim-Dorner, P. A. Deuster, S. A. Zeno, A. T. Remaley, and M. Poth, “Should triglycerides and the triglycerides to high-density lipoprotein cholesterol ratio be used as surrogates for insulin resistance?” Metabolism, vol. 59, no. 2, pp. 299–304, 2010. View at: Publisher Site | Google Scholar
  19. M. R. Salazar, H. A. Carbajal, W. G. Espeche, M. Aizpurua, C. A. Dulbecco, and G. M. Reaven, “Comparison of two surrogate estimates of insulin resistance to predict cardiovascular disease in apparently healthy individuals,” Nutrition, Metabolism, and Cardiovascular Diseases, vol. 27, no. 4, pp. 366–373, 2017. View at: Publisher Site | Google Scholar
  20. F. Xu, L. H. Zhao, J. B. Su et al., “The relationship between glycemic variability and diabetic peripheral neuropathy in type 2 diabetes with well-controlled HbA1c,” Diabetology and Metabolic Syndrome, vol. 6, no. 1, p. 139, 2014. View at: Publisher Site | Google Scholar
  21. F. Liu, M. Wu, Y. H. Feng et al., “Influence of HbA1c on short-term blood pressure variability in type 2 diabetic patients with diabetic nephropathy,” Journal of Zhejiang University Science B, vol. 14, no. 11, pp. 1033–1040, 2013. View at: Publisher Site | Google Scholar
  22. E. Selvin, K. Wattanakit, M. W. Steffes, J. Coresh, and A. R. Sharrett, “HbA1c and peripheral arterial disease in diabetes: the Atherosclerosis Risk in Communities study,” Diabetes Care, vol. 29, no. 4, pp. 877–882, 2006. View at: Publisher Site | Google Scholar
  23. Action to Control Cardiovascular Risk in Diabetes Study Group, H. C. Gerstein, M. E. Miller et al., “Effects of intensive glucose lowering in type 2 diabetes,” The New England Journal of Medicine, vol. 358, no. 24, pp. 2545–2559, 2008. View at: Publisher Site | Google Scholar
  24. R. Ness-Abramof and C. M. Apovian, “Drug-induced weight gain,” Timely Topics in Medicine. Cardiovascular Diseases, vol. 9, article E31, 2005. View at: Google Scholar
  25. C. L. Roumie, X. Liu, N. N. Choma et al., “Initiation of sulfonylureas versus metformin is associated with higher blood pressure at one year,” Pharmacoepidemiology and Drug Safety, vol. 21, no. 5, pp. 515–523, 2012. View at: Publisher Site | Google Scholar

Copyright

Copyright © 2019 Chase M. Walton et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
Chase M. Walton, Katelyn Perry, Richard H. Hart, Steven L. Berry, and Benjamin T. Bikman
Metabolism Research Lab, Department of Physiology and Developmental Biology, Brigham Young University, Provo UT, USA, Insulin IQ, Orem UT, USA, Revere Health, Orem UT, USA
https://www.hindawi.com/journals/jdr/2019/8681959/




Ketogeeninen ruokavalio: neuromuskulaarisiset ja neurodegeneratiiviset taudit

Neuromuskulaariset sairaudet ovat joukko sairauksia, jotka vaikuttavat lihaksia sääteleviin hermoihin tai heikentävät itse lihaksia. Esimerkiksi ALS.

Neurodegeneratiivinen sairaus on yleistermi useille sairauksille, jotka rappeuttavat aivojen ja keskushermoston soluja, kuten neuroneja. Neuronit eivät yleensä uusiudu tai korjaa itseään, joten jos ne surkastuvat ja kuolevat, elimistö ei voi korvata niitä. Neurodegeneratiivisia sairauksista ovat mm. Parkinsonin tauti, Alzheimerin tauti ja Huntingtonin tauti.

Johdanto

Päivä päivältä useammat tutkimukset osoittavat ketogeenisten ruokavalioiden kiistattomat hyödyt metabolisten sairauksien, kuten lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoidossa.

Olen ketoillut puolivallattomasti joulukuun alusta alkaen. Joulukuun 2. päivän ja tämän päivän väliin mahtuu useita horjahduksia olut-, makeis- ja burgeriseikkailuineen. Paino on laskenut ~13 kiloa. Verensokeri pysyy KD:llä optimaalisena ja verenpaine hyvällä tasolla. Oloni on hyvin motivoitunut ja aktiivinen. Arkista huuhailua ei haittaa nälkä tai aivosumu.

Neurologisten häiriöiden osalta ketogeeninen ruokavalio hyväksytään tehokkaaksi terapiaksi farmakoresistentin epilepsian hoidossa, mutta uudet tutkimukset viittaavat siihen, että ketogeeninen ruokavalio voi olla hyödyllinen myös amyotrofisen lateraaliskleroosin (ALS), Alzheimerin- ja Parkinsonin taudin sekä eräiden mitokondriopatioiden yhteydessä.

Esittelin Ruokasodassa aimmin tutkimuskatsauksen, jonka mukaan ketogeeninen ruokavalio voi hidastaa myös multippeliskleroosin etenemistä.

Vaikka näillä sairauksilla on erilaiset patogeneesit, on olemassa eräitä yleisiä mekanismeja, jotka voivat selittää ketogeenisten ruokavalioiden hyötyjä:

  1. ketogeenisen ruokavalion metaboliset mekanismit tarjoavat tehokkaan energianlähteen sellaisten neurodegeneratiivisten sairauksien hoidossa, joille on tunnusomaista fokaalinen aivojen hypometabolia, eli solujen energiansaannin heikkeneminen
  2. ketogeeninen ruokavalio vähentää erityyppisiin metabolisiin stresseihin liittyviä oksidatiivisia vaurioita ja inflammaatiota
  3. ketogeeninen ruokavalio lisää mitokondrioiden biogeneesireittejä
  4. ketonit ohittavat joihinkin neurologisiin sairauksiin liittyvän kompleksin I aktiivisuuteen liittyvän vian

Tässä katsauksessa tutustutaan ketogeenisen ruokavalion neuroprotektiivisiin aineenvaihduntamekanismeihin

Yksittäisillä ravintoaineilla voi olla positiivisia vaikutuksia luurankolihasten terveyteen. Lisäksi ravintoaineiden yhdistelmät voivat vaimentaa joidenkin hermo-lihassairauksien oireita. Toisaalta tiedetään myös, että laihduttamisen vaikutukset terveyteen liittyvät eri makro- ja hivenravinteiden keskinäiseen saantisuhteeseen, eikä niinkään yksittäisin ravintoaineeseen.

Ketogeeninen ruokavalio (KD) on viime vuosina herättänyt suurta kiinnostusta. 1900-luvun kolmannelta vuosikymmeneltä lähtien ketogeenistä ruokavaliota on käytetty farmakologisesti resistentin epilepsian hoitoon [1–3]. Viime aikoina KD:n on havaittu olevan toimiva terapia myös monissa täysin erilaisissa sairauksissa, kuten lihavuus [4], PCOS [5], syöpä [1, 6, 7], diabetes [8] ja muut patologiset tilat [9– 11].

Vaikka monet tutkimukset ovat osoittaneet KD:n potentiaaliset positiiviset vaikutukset moniin neurologisiin ja hermo-lihassairauksiin, vain harvat tutkimukset ovat tutkineet tämän lupaavan ravitsemuksellisen lähestymistavan mekanismeja [12].

Tämän katsauksen tarkoituksena on tarkastella KD:n roolia hermostoon ja lihasten toimintaan vaikuttavissa sairauksissa.

Ketogeenisessä ruokavaliossa

Muutaman päivän paastoamisen tai hiilihydraattien huomattavan rajoittamisen (alle 20 g päivässä) seurauksena glukoosivarastot eivät riitä:

  1. normaaliin rasvan hapettumiseen oksaloasetaatin syöttämisen kautta sitruunahappokierrossa (Krebsin syklissä, TCA-sykli) ja
  2. keskushermoston glukoositarpeen tyydyttämiseen [13, 14] (kuva 1)

Keskushermostossa glukoosia tarvitaan energia lähteeksi, sekä tuottamaan pyruvaatteja, jotka voidaan edelleen muuntaa oksaloasetaatiksi.

Oksaloasetaatin määrän tulisi pysyä tasolla, joka on riittävä sitruunahappokierron toiminnan (ts. asetyyli-CoA:n ja oksaloasetaatin välinen kondensaatio) mahdollistamiseksi.

Oksaloasetaatti on epävakaa ja se on uudelleenkoottava (tällaisia reaktioita kutsutaan anaplerooteiksi). Elimistölle helpoin tapa tuottaa oksaloasetaattia on pyruvaatista, joka saadaan glukoosista.

Oksaloetikkahappo (oksaloasetaatti) on ketodikarboksyylihappoihin kuuluva orgaaninen yhdiste. Oksaloetikkahappo on välituote useissa biokemiallisesti tärkeissä reaktioissa.

Sitruunahappokierron ensimmäisessä vaiheessa oksaloetikkahappo ja asetyylikoentsyymi-A reagoivat sitraattisyntaasientsyymin katalysoimana muodostaen sitruunahappoa. Reaktiossa asetyyliryhmä siirretään oksaloetikkahapon ketonihiileen ja karbonyyliryhmä pelkistetään hydroksyyliryhmäksi.

Oksaloetikkahappoa muodostuu sitruunahappokierron kymmenennessä vaiheessa, kun omenahappo dehydrataan malaattidehydrogenaasientsyymin avulla.

Glukoneogeneesin ensimmäisessä vaiheessa palorypälehappo muutetaan oksaloetikkahapoksi. Reaktio kuluttaa ATP-molekyylin ja sitä katalysoi pyruvaattikarboksylaasientsyymi.

Glukoneogeneesin toisessa vaiheessa oksaloetikkahappo muutetaan fosfoenolipalorypälehapoksi. Reaktiossa tarvittava energia saadaan hydrolysoimalla yksi gyanosiinitrifosfaatin korkeaenergiainen fosfaattiryhmä. Reaktiossa muodostuu lisäksi hiilidioksidia ja guanosiinidifosfaattia. Reaktiota katalysoi fosfoenolipyruvaattikarboksikinaasi.

Eliöt voivat tuottaa aminohappo asparagiinihappoa oksaloetikkahaposta. Asparagiinihappoa syntyy, kun oksaloetikkahappo ja glutamiinihappo reagoivat. Reaktio on transaminaatioreaktio ja sitä katalysoi eräs transaminaasien luokkaan kuuluva entsyymi, aspartaattiaminotransferaasi. Koentsyyminä toimii pyridoksaalifosfaatti. – Wikipedia

Nisäkkäillä pyruvaattia ei voida tuottaa asetyylikoentsyymi-A:sta, kuten kuvassa on esitetty.

(1) Oksaloasetaatti on ruumiin normaalilämmössä melko epävakaa molekyyli. Sitä ei voi varastoida mitokondrioiden matriksiin. Tässä ”glukoosinpuutos” -tilassa tarvitaan oksaloasetaattia trikarboksyylihapposyklin tehokkaan toiminnan varmistamiseksi. Oksaloasetaatti toimitetaan anapleroottisyklin kautta, joka syntetisoi oksaloasetaatin glukoosista pyruviinihapon ATP-riippuvaisen karboksyloinnin kautta pyruvaattikarboksylaasilla [15].

(2) Koska keskushermosto ei voi käyttää vapaita rasvahappoja (FFA) betaoksidaatiossa suoraan energialähteenä (vapaat rasvahapot eivät läpäise veri-aivoestettä), keskushermosto käyttää yleensä solujen energiasubstraattina glukoosia.

3-4 päivän kuluttua hiilihydraattien saannin rajoittamisesta, keskushermoston on löydettävä soluille vaihtoehtoinen energialähde, kuten Felig et al. [13, 14, 16, 17] ovat osoittaneet. Vaihtoehtoisen energianlähteen soluille tarjoavat maksan tuottamat ketoaineet (KB): asetoasetaatti (AcAc), 3-hydroksibutyraatti (3HB, beta-hydroksibutyraatti) ja asetoni [18], joita saadaan asetyylikoentsyymi-A:n ylituotannosta ilman oksaloasetaatin samanaikaista tuotantoa. Energiasubstraateiksi kelpaavia ketoaineita sytyy ketogeneesissä. Ketogeneesiä tapahtuu pääasiassa maksan mitokondrioiden matriksissa [19].

Maksa tuottaa ketoaineita, mutta ei pysty käyttämään niitä, koska maksassa ei ole sukkinyyli-CoA: 3-CoA transferaasi (SCOT) -entsyymiä, jota tarvitaan asetoasetaatin muuttamiseksi asetyylikoentsyymi-A:ksi [18]. maksan ketogeneesissä syntetisoidaan asetoasetaattia, mutta ensisijainen verenkierrossa kiertävä ketoaine on 3-hydroksibutyraatti, eli beta-hydroksibutyraatti.

Normaaleissa olosuhteissa vapaan asetoasetaatin tuotanto on vähäistä ja se voi metaboloitua useissa kudoksissa, kuten luurankolihaksessa ja sydämessä. Asetoasetaatin ylituotanto-olosuhteissa sitä syntyy normaalia enemmän, mutta osa siitä syntetisoidaan kahdeksi muuksi ketoaineeksi.

Korkea ketoaineiden taso veressä ja niiden eliminaatio virtsan kautta aiheuttaa ketonemiaa ja ketonuriaa. Normaaleissa olosuhteissa ketoaineiden pitoisuus on yleensä hyvin matala (<0,3 mmol / l) verrattuna glukoosiin (noin 4-5 mmol / l) [20, 21].

Kun ketoaineet ovat saavuttaneet noin 4 mmol / l konsentraation, keskushermosto alkaa käyttää niitä energialähteenä [21]. Kudokset käyttävät ketoaineita energialähteenä [19, 21, 23] aineenvaihduntareitin kautta, joka muuntaa ensin beta-hydroksibutyraatin (3HB) takaisin asetyyliasetaatiksi, joka sitten muutetaan asetoasetyylikoentsyymi-A:ksi. Jälkimmäinen jaetaan lopulta kahteen asetyylkoentsyymi-A-molekyyliksi, joita käytetään myöhemmin sitruunahappokierrossa (kuva 2).

On mielenkiintoista huomata, että verensokeriin verrattuna ketoaineet pystyvät tuottamaan suuremman energiamäärän johtuen niiden aiheuttamista mitokondrioiden ATP-tuotannon muutoksista [21, 24, 25].

Ruokavalion hiilihydraattien vähentynyt saatavuus johtaa lisääntyneeseen ketoaineiden tuotantoon maksassa. Maksa ei voi käyttää ketoaineita, koska siitä puuttuu mitokondrioiden tarvitsema entsyymi sukkinyyli-CoA: 3-ketohappo (oksohappo) CoA-transferaasi (SCOT), jota tarvitaan asetoasetaatin aktivaatioon asetoasetyyli-CoA:ksi. Ketoaineita hyödyntävät kudokset, erityisesti aivot. Ketoaineet siirtyvät sitruunahappokiertoon muututtuaan asetyylikoentsyymi-A:ksi sukkinyyli-CoA: 3-CoA-transferaasin (SCOT) ja metyyliasetoasetyyli-CoA-tiolaasin (MAT) avulla. Vaikka glukoosi on vähentynyt, se pysyy fysiologisilla tasoilla [26, 27] johtuen kahdesta päälähteestä:

(1) glukogeenisista aminohapoista ja
(2) triglyserideistä hajotuksen kautta vapautuneesta glyserolista [28, 29]

Fysiologisen ketoosin (nopea tai erittäin vähäkalorinen ketogeeninen ruokavalio) aikana ketonemia saavuttaa maksimiarvot 7/8 mmol / l ilman pH:n muutoksia, kun taas hallitsemattomassa diabeettisessa ketoasidoosissa ketoaineiden pitoisuus voi ylittää 20 mmol / l, kun veren pH laskee samanaikaisesti.

Terveiden ihmisten veren ketoaineiden pitoisuudet eivät ylitä 8 mmol / l, koska keskushermosto (CNS) käyttää näitä molekyylejä tehokkaasti energiasubstraatteina glukoosin sijasta [16]. Taulukossa veren ketoaineiden tasot normaalin ruokavalion ja ketogeenisen ruokavalion aikana (ts. 20 grammaa hiilihydraatteja päivässä) sekä diabeettinen ketoasidoosi [10] .

Ketogeeninen ruokavalio imitoi paastoa ja sen aineenvaihduntamekanismeja

Perinteisesti lääkärit vierastavat ketoosia, koska he yhdistävät ketoosin insuliinin puutteesta johtuvaan vaikeaan hyperketonemiaan, joka voi aiheuttaa vakavan ketoasidoosin ja kuoleman tyypin 1 diabetesta sairastavilla henkilöillä.

Hans Krebs oli ensimmäinen, joka käytti termiä ”fysiologinen ketoosi” erottaakseen paaston ja ketogeenisen ruokavalion aiheuttaman lievän (8 mmol / l ketonipitoisuuden) ketoosin metabolisesti epätasapainoisen diabeteksen ”patologisesta ketoasidoosista” [31].

Paaston tai aliravitsemuksen jaksot ovat siinä mielessä ketogeenisiä [23], että insuliinin ja glukoosin pitoisuudet laskevat, kun taas glukagonin pitoisuudet kasvavat normaalia verensokeritason ylläpitämiseksi. Kun keho siirtyy ravinnon runsauden tilasta ravinnon puutteen tilaan (ketoosiin esimerkiksi ketogeenisen ruokavalion simuloidun ravinnon puutteen kautta), veren vapaiden rasvahappojen (FFA) ja ketoaineiden pitoisuus kasvaa pienellä viiveellä.

Tästä näkökulmasta tarkasteltuna ketogeenistä ruokavaliota voidaan verrata kalorirajoitukseen, aliravitsemukseen tai paastoamiseen. Tämä ravinteiden saannin metabolisen vasteen manipulointi, sekä määrällisesti että laadullisesti, vaikuttaa sekä verensokeriin että ketoaineisiin. Sillä on myös kyky edistää aineenvaihduntareittien ja soluprosessien, kuten stressiresistenssin ja autofagian muutoksia.

Ketogeeniset ruokavaliot voivat toimia myös samalla tavalla kuin kalorirajoitus (CR) AMPK:lla ja SIRT-1:llä [33]. Jotta ymmärtäisimme ketogeenisen ruokavalion monimutkaiset vaikutukset ja mekanismit elimistössä, meidän on otettava huomioon nämä solunsisäiset molekyylitason aineenvaihduntareitit.

PGC1α aktivoituu fosforyloidussa tilassa. Fosforyloitu PGC1α siirtyy sytosolista solun tumaan, jossa se edistää rasvahappojen kuljetusta, rasvan hapettumista ja oksidatiivista fosforylaatiota sekä osallistuvien geenien transkriptiota [34].

PGC1α voidaan fosforyloida useiden eri aineenvaihduntareittien kautta, kuten AMPK, kalsium-kalmoduliinista riippuvainen proteiinikinaasi ja p38-mitogeeniaktivoitunut proteiinikinaasireitti [35]. PGC1α voidaan aktivoida myös SIRT1-välitteisellä deasetylaatiolla [36]. AMPK voi toimia joko PGC1α:n fosforyloimalla tai suoraan.

AMPK-aktivointi estää myös mTOR-signaloinnin. Vaikuttaa kuitenkin epäjohdonmukaiselta estää tärkeä kasvuvälitteinen reitti (mTOR), joka säätelee lihasmassaa, jotta luurankolihakset voivat kasvaa.

Ravinteiden manipulointi vaikuttaa näihin aineenvaihduntareitteihin; esim. hiilihydraattien puutteellinen saanti stimuloi in vivo AMPK:n ja SIRT-1:n aktivaatiota, lisäämällä AMPK:n fosforylaatiota ja PGC1α:n deasetylointia luurankolihaksissa vaikuttamatta AMPK:n, PGC1α:n tai SIRT 1: n kokonaismäärään.

Nämä mekanismit näyttävät aktivoituvan muutaman tunnin (5 tunnin) paaston jälkeen hiirillä [39]. Aktivoiduttuaan SIRT1 ja AMPK tuottavat hyödyllisiä vaikutuksia glukoosin homeostaasissa ja insuliinimetaboliassa [40].

Askel vaikeampaan: mikä helvetin AMPK?


Tämä on teknisempää settiä. 5′-AMP-aktivoitu proteiinikinaasi, AMPK tai 5′-adenosiinimonofosfaatilla aktivoitu proteiinikinaasi on entsyymi, jolla on suuri vaikutus soluenergian homeostaasissa.

AMPK vaikuttaa erityisesti aktivoimalla glukoosin ja rasvahappojen imeytymistä ja hapettumista, kun solujen energiataso on matala. AMPK:ta ei tule sekoittaa cAMP-aktivoituun proteiinikinaasiin.

AMPK koostuu kolmesta proteiinista (α, β, γ -alayksiköistä), jotka yhdessä muodostavat toiminnallisen entsyymin. AMPK ilmentyy useissa kudoksissa, kuten maksassa, aivoissa ja luurankolihaksissa.

AMPK-aktivaation nettovaikutus vasteena AMP:n ja ADP:n sitoutumiselle on maksan rasvahappojen hapettumisen stimulointi, ketogeneesi, luustolihasten rasvahappojen hapettumisen stimulointi ja glukoosin imeytymisen tehostaminen, kolesterolisynteesin esto, lipogeneesin ja triglyseridisynteesin esto sekä, rasvasolujen lipogeneesin ja lipolyysin esto ja insuliinin erityksen modulointi haiman beetasoluista.

Kullakin AMPK:n kolmella alayksiköllää on erityinen rooli AMPK:n vakaudessa ja aktiivisuudessa. Vaikka AMPK:N yleisimmät isoformit, jotka ilmentyvät useimmissa soluissa, ovat α1-, β1- ja γ1-isoformeja, on osoitettu, että α2-, β2-, γ2- ja γ3-isoformit ilmentyvät myös sydämen ja luuston lihaksissa.
Johtuen AMPK:n komponenttien isoformeista, nisäkkäillä on 12 versiota AMPK:sta, joista jokaisella voi olla erilainen kudospaikannus ja erilaiset toiminnot eri olosuhteissa. AMPK:ta säännellään allosterisesti ja translaation jälkeisillä muokkauksilla, jotka toimivat yhdessä. Jos AMPK:n alfa-alayksikön tähde T172 fosforyloidaan, AMPK aktivoituu; fosfataasien pääsy tähän jäännökseen estetään, jos AMP tai ADP voivat estää pääsyn ja ATP voi syrjäyttää AMP:n ja ADP:n.

AMPK:ta säätelee allosterisesti enimmäkseen kilpaileva sitoutuminen gamma-alayksikköön ATP:n (joka sallii fosfataasipääsyn T172: een) ja AMP:n tai ADP:n (joista kukin estää pääsyn fosfataaseihin) välillä.

Näin ollen näyttää siltä, että AMPK on AMP / ATP- tai ADP / ATP-suhteiden ja siten solujen energiatason anturi.

On eräitä aineenvaihduntamekanismeja, joilla insuliini, leptiini ja diasyyliglyseroli estävät AMPK: ta indusoimalla erilaisia muita fosforylaatioita. AMPK:ta voidaan estää tai aktivoida erilaisilla kudosspesifisillä ubikitinaatioilla. Sitä säätelevät myös useat proteiini-proteiini-vuorovaikutukset, ja hapettavat tekijät voivat joko aktivoida tai estää niitä. Kun AMPK fosforyloi asetyyli-CoA-karboksylaasi 1: tä (ACC1) tai sterolia säätelevää elementtiä sitovaa proteiinia 1c (SREBP1c), se estää rasvahappojen, kolesterolin ja triglyseridien synteesiä ja aktivoi rasvahappojen saannin ja β-oksidaation. AMPK stimuloi glukoosinottoa luurankolihassa fosforyloimalla Rab-GTPaasia aktivoivan proteiinin TBC1D1, joka lopulta indusoi GLUT1-rakkuloiden fuusion plasmamembraaniin. AMPK stimuloi glykolyysiä aktivoimalla 6-fosfofrukto-2-kinaasi / fruktoosi-2,6-bisfosfataasi 2/3: n fosforylaation ja aktivoimalla glykogeenifosforylaasin fosforylaation, ja se estää glykogeenisynteesiä estävän fosforyylin kautta

Monet luurankolihasten biokemialliset muutokset, jotka tapahtuvat yhden harjoittelun tai pitkittyneen harjoittelun aikana, kuten lisääntynyt mitokondrioiden biogeneesi ja kapasiteetti, lisääntynyt lihasten glykogeeni ja lisääntynyt entsyymien erikoistuminen glukoosinottoon soluissa, kuten GLUT4 ja heksokinaasi II, ovat todennäköisesti ainakin osittain AMPK:n aktivaation välittämiä tapahtumia.

AMPK:lla on keskeinen rooli liikunnan / treenattujen lihassolujen verenkierron lisäämisessä stimuloimalla ja vakauttamalla sekä vaskulogeneesiä että angiogeneesiä.

Yhdessä nämä muutokset ilmenevät todennäköisesti sekä väliaikaisen että ylläpidetyn AMPK-aktiivisuuden lisääntymisen seurauksena, jonka AMP : ATP-suhteen nousu aiheuttaa yksittäisten liikuntajaksojen ja pitkäaikaisen harjoittelun aikana.

Yhden akuutin harjoittelun aikana AMPK antaa supistuvien lihassolujen sopeutua energiahaasteisiin lisäämällä heksokinaasi II: n ilmentymistä, GLUT4:n translokaatiota plasmakalvoon, glukoosinottoa ja stimuloimalla glykolyysiä. Jos liikunta jatkuu pitkitettynä harjoituksena, AMPK ja muut signaalit helpottavat lihasten adaptoitumista sopeuttamalla lihassolujen aktiivisuuden aineenvaihdunnan muutokseen, mikä johtaa rasvahappojen hapettumisen kautta muodostuvaaan ATP:hen glykolyysin sijaan.

AMPK saavuttaa siirtymisen oksidatiiviseen metaboliaan säätelemällä ja aktivoimalla oksidatiivisia entsyymejä, kuten heksokinaasi II, PPARalpha, PPARdelta, PGC-1, UCP-3, sytokromi C ja TFAM. AMPK-aktiivisuus kasvaa liikunnan seurauksena ja LKB1 / MO25 / STRAD-kompleksia pidetään 5′-AMP-aktivoidun proteiinikinaasin tärkeimpänä ylävirran AMPKK:na. Tämä on hämmentävä ilmiö, kun otetaan huomioon, että vaikka AMPK-proteiinien määrä kasvaa luukudoksessa kestävyysharjoittelun vaikutuksesta, niiden aktiivisuus vastaavasti laskee kestävyysharjoittelun seurauksena.

On mahdollista, että on olemassa suora yhteys kestävyysharjoitettujen luurankolihasten havaitun AMPK-aktiivisuuden vähenemisen ja kestävyysharjoitteluun liittyvän AMPK-vasteen ilmeisen vähenemisen välillä.

Yksi keskeisistä reiteistä AMPK:n rasvahappojen hapettumisen säätelyssä on asetyyli-CoA-karboksylaasin fosforylaatio ja inaktivaatio. Asetyyli-CoA-karboksylaasi (ACC) muuntaa asetyyli-CoA n malonyyli-CoA:ksi, joka on karnitiinipalmmityylitransferaasi 1:n (CPT-1) estäjä. CPT-1 kuljettaa rasvahapot mitokondrioihin hapetusta varten. ACC: n inaktivointi johtaa siis lisääntyneeseen rasvahappokuljetukseen ja sitä seuraavaan hapettumiseen.

Todennäköisesti malonyyli-CoA:n väheneminen tapahtuu malonyyli-CoA-dekarboksylaasin (MCD) vaikutuksesta, jota AMPK voi säätää. MCD on ACC:n antagonisti dekarboksyloimalla malonyyli-CoA:ta asetyyli-CoA:ksi, mikä johtaa vähentyneeseen malonyyli-CoA:han ja lisääntyneeseen CPT-1:een ja rasvahappojen hapettumiseen.

AMPK: lla on myös tärkeä rooli maksan lipidien aineenvaihdunnassa. On pitkään tiedetty, että maksan ACC:tä on säännelty maksassa fosforylaatiolla. AMPK fosforyloi ja inaktivoi myös 3-hydroksi-3-metyyliglutaryyli-CoA-reduktaasin (HMGCR), joka on kolesterolisynteesin avainentsyymi. HMGR muuntaa 3-hydroksi-3-metyyliglutaryyli-CoA:n, joka on valmistettu asetyylikoentsyymi-A:sta, mevalonihapoksi, joka sitten kulkee useita muita metabolisia vaiheita kolesteroliksi.

AMPK auttaa säätelemään rasvahappojen hapettumista ja kolesterolisynteesiä. Insuliini on hormoni, joka auttaa säätelemään elimistön glukoosipitoisuutta. Kun verensokeri on korkea, insuliinia vapautuu Langerhansin saarekkeiden beetasoluista. Insuliini muun muassa helpottaa glukoosin imeytymistä soluihin lisäämällä glukoosinkuljettaja GLUT-4:n ilmentymistä ja siirtymistä.

AMPK ja kilpirauhashormoni säätelevät eräitä samanlaisia prosesseja. Nämä yhtäläisyydet tuntien Winder ja Hardie et al. suunnittelivat kokeen selvittääkseen, vaikuttiko kilpirauhashormoni AMPK: hon. He havaitsivat, että kaikki AMPK:n alayksiköt lisääntyivät luurankolihaksissa kilpirauhashormonihoidolla. Myös fosfo-ACC: n, AMPK-aktiivisuuden markkerin, määrä lisääntyi.

AMPK:n häviämisen on raportoitu muuttavan glukoosia tunnistavien solujen herkkyyttä huonosti tunnettujen mekanismien kautta. AMPKα2-alayksikön menetys haiman beetasoluissa ja hypotalamuksen neuroneissa vähentää näiden solujen herkkyyttä solunulkoisen glukoosipitoisuuden muutoksille.

Altistuminen toistuville insuliinin aiheuttamille hypoglykemioille laski AMPK:n aktivaatiota hypotalamuksessa ja samalla esti hypoglykemian vasta-ainevasteen rottakokeissa.

AMPK säätyy lysosomeissa useiden kliinisesti merkittävien järjestelmien kautta. Näihin sisältyy AXIN – LKB1 -kompleksi, joka toimii vasteena AMP-tunnistuksesta riippumatta toimiviin glukoosirajoituksiin, joka tunnistavat matalan glukoosin fruktoosi-1,6-bisfosfaatin puuttumisena dynaamisen vuorovaikutussarjan kautta kosketuksissa olevien lysosomaalisesti lokalisoidun V-ATPaasi-aldolaasin välillä.

Toinen lysosomeihin lokalisoitu AMPK-ohjausjärjestelmä riippuu Galectin-9-TAK1-järjestelmästä ja ubikvitinaatiovasteista kontrolloiduilla deubikitinoivilla entsyymeillä, kuten USP9X, mikä johtaa AMPK:n aktivaatioon vasteena lysosomaalisille vaurioille.

Nämä lysosomaaliset vauriot voivat ilmentyä biokemiallisesti ja fyysisesti proteiiniaggregaattien, kuten proteopaattisten tau-proteiinien kautta Alzheimerin taudissa, kiteisinä piidioksideina, jotka aiheuttavat silikoosia, kolesterolikiteinä, jotka aiheuttavat inflammaatiota NLRP3-tulehduksen kautta ja kihtiin liittyvinä uraattikiteinä, tai mikrobien hyökkäyksen aikana, kuten Mycobacterium tuberculosis-infektiossa ja koronavirus-infektiossa.

[62] Molemmat yllä mainitut lysosomaalisesti lokalisoidut AMPK:ta säätelevät järjestelmät aktivoivat vasteena metformiinille, laajalti määrätylle diabeteslääkkeelle. Jotkut todisteet osoittavat, että AMPK:lla voi olla rooli kasvaimen tukahduttamisessa. Tutkimukset ovat osoittaneet, että AMPK voi käyttää suurinta osaa tai jopa kaikkia maksakinaasi B1:n (LKB1) tuumoria tukahduttavista ominaisuuksista. Lisäksi tutkimuksissa, joissa AMPK-aktivaattori metformiinia käytettiin diabeteksen hoitoon, havaittiin korrelaatio vähentyneeseen syöpäriskiin verrattuna muihin lääkkeisiin.

Hiirillä, joilla ei ollut AMPK:ta ilmentävää geeniä, oli kasvanut riski lymfoomien kehittymiselle. Toisaalta jotkut tutkimukset ovat tulkinneet AMPK:n kasvaimen promoottorina, joka suojaa pahanlaatuisia syöpäsoluja. Vaikuttaa siltä, että AMPK voi kääntää takkia syöpäsolujen kohdalla. Kun syöpäsolut ovat muodostuneet organismiin, AMPK alkaakin suojaamaan organismin solujen sijaan pahanlaatuisia syöpäsoluja.

Ei ole suoraa näyttöä siitä, että AMPK:n estäminen olisi tehokas syöpähoito ihmisillä. AMPK:n näennäisesti paradoksaalinen rooli syövän puolustajana/promoottorina toteutuu, kun tarkastelemme lähemmin energiaa tunnistavaa entsyymiä suhteessa liikuntaan ja pitkäaikaiseen harjoitteluun.

Lyhytaikaisen akuutin harjoitusasteikon tavoin pitkäaikaiset kestävyysharjoittelututkimukset paljastavat myös oksidatiivisten metabolisten entsyymien, GLUT-4:n, mitokondrioiden koon ja määrän lisääntymisen ja lisääntyneen riippuvuuden rasvahappojen hapettumisesta. – Wikipedia

4. Ketogeeninen ruokavalio ja amyotrofinen lateraaliskleroosi

Amyotrofinen lateraaliskleroosi, ALS ( sclerosis lateralis amyotrophica) eli Lou Gehrigin tauti tai motoneuronitauti (engl. Motor neuron disease, MND) on etenevä motoneuronisairaus, joka rappeuttaa sekä ylempiä että alempia liikehermoja.

ALS aiheuttaa etenevää rappeutumista liikehermosoluissa, jotka ohjaavat tahdosta riippuvien lihasten toimintaa. ALS:n pääasiallisia oireita ovat lihasten jäykkyys, lihasnykäykset ja asteittain pahentuva lihasten heikentyminen niiden koon pienentyessä.

Tämä johtaa vaikeuksiin puhumisessa, nielemisessä, liikkumisessa ja lopulta hengittämisessä. Sairaus ei vaikuta näköön tai kuuloon eikä haju-, maku- tai tuntoaisteihin. Myös sydän, verenkierto sekä ruoansulatus ja eritysjärjestelmät säilyvät vahingoittumattomina.

Kun sairaus on pitkälle edennyt, potilas ei kykene tekemään juuri mitään ilman ulkopuolista apua; jossain vaiheessa joudutaan tukeutumaan hengityskoneeseen, tarjoamaan potilaalle pillillä imettävää nestemäistä ruokaa tai antamaan ruoka PEG-letkun kautta ja auttamaan tätä kaikissa arkipäivän toimissa. Kuoleman aiheuttaa hengityslihasten heikkous.

Sairaus on harvinainen ja parantumaton. Sairauden aiheuttajaa ei toistaiseksi tunneta. Sairausprosessia on todennäköisesti käynnistämässä usean tekijän vuorovaikutus. – Wikipedia

ALS

Amyotrofinen lateraaliskleroosi (ALS) on progressiivinen neurodegeneratiivinen sairaus, joka vaikuttaa selkärangan ja aivokuoren motorisiin hermosoluihin, mikä johtaa lihasten progressiiviseen heikkenemiseen ja luurankolihasten toimintakyvyn menetykseen.

Tautiin sairastuvat henkilöt kuolevat keskimäärin 2–5 vuoden kuluessa oireiden ilmaantumisesta. Kuolema tapahtuu yleensä hengityshalvauksesta. Tällä hetkellä ALS:lle ei tunneta tehokasta hoitoa.

Ainoa Yhdysvaltain FDA:n hyväksymä farmakologinen hoito rajoittuu rilutsoliin, joka vaikuttaa vain vähän taudin etenemisen ja pidentää elinaikaa vain 2-3 kuukaudella [41]. ALS:n syyt ovat monimutkaisia ja monitekijäisiä. Niihin sisältyy geneettiset tekijät ja ympäristömuuttujat:

  • elimistön oksidatiiviset vauriot,
  • neurofilamenttien kertyminen soluihin,
  • eksitotoksisuus, joka liittyy glutamaattimetabolian häiriöön ja
  • mitokondrioiden kalvojen toimintahäiriöt

ovat eräitä oletettuja taudin kehittymiseen vaikuttavia tekijöitä [42–44]. Muiden hermosoluja rappeuttavien neurodegeneratiivisten häiriöiden tapaan mitokondrioiden todennäköinen vaikutus ALS:n patogeneesiin tekee ketogeenisestä ruokavaliosta lupaavan synergisen työkalun ALS: n hoitoon [45].

Mitokondrioiden yhteys

Noin 10%:lla ALS-potilaista sairaus on perinnöllinen (familiaalinen amyotrofinen skleroosi FALS) ja joka viidennellä FALSia sairastavalla on mutaatio geenissä, joka koodaa entsyymiä Cu / Zn superoksididismutaasi 1 (SOD1) [46]. Tämä mutaatio liittyy mitokondrioiden aktiivisuuteen; itse asiassa juuri mutantti SOD1 on lokalisoitu mitokondrioita sitovaan bcl2:een (solun antiapoptoottinen proteiini) [47].

Lisäksi mitokondrioiden kompleksin I aktiivisuuden heikkeneminen on mitattu ALS-potilaiden luurankolihaksissa ja selkäytimissä [48]. Tulokset osoittavat, että ketoaineet voivat vaikuttaa mitokondrioiden toimintaan palauttamalla esimerkiksi kompleksin I toiminnan farmakologisen eston jälkeen. Lisäksi viljellyissä hermosoluissa, joita hoidetaan farmakologisilla aineilla, jotka estävät kompleksin I, ketoaineiden lisäys palauttaa kompleksin toiminnan [49].

Tutkijat osoittivat hiljattain, että ALS-hiirimallissa ketogeeninen ruokavalio johti korkeampaan motoristen hermosolujen eloonjäämiseen ja parempaan motoriseen toimintaan verrattuna hiiriin, jotka eivät saaneet KD-ruokaa [50]. Tutkimuksissa on myös havaittu, että ketoaineiden lisäys (kapryylihappo) paransi mitokondrioiden toimintaa ja motoristen hermosolujen määrää ALS-hiirimallissa [51].

Tutkijat selittivät nämä tulokset DHB:n neuroprotektiivisella vaikutuksella. Lisäksi he arvelivat, että hyperketonemia saattaa parantaa mitokondrioiden vikoja lisäämällä mitokondrioiden energian ja ATP-molekyylien tuotantoa (mitattuna puhdistetuissa mitokondrioissa ALS-hiirimallista). On huomattava, että kummassakaan tutkimuksessa hiirien eloonjääminen ei lisääntynyt merkittävästi.

Ketogeenisen ruokavalion aikana ruokavalion rasvojen prosenttiosuus oli erittäin korkea (60%). Tämä voi selittää energia-aineenvaihdunnan havaitut ja mitatut parannukset.

Kolesteroli ja fosfolipidit ovat välttämättömiä aksonikalvojen terveydelle ja perifeeristen hermokalvojen vamman korjauksille. Erityisen tärkeitä ovat pienitiheyksiset lipoproteiinit [52].

Eräät epidemiologiset havainnot viittaavat siihen, että hyperlipidemia on merkittävä ALS-potilaiden elinajanodotetta lisäävä tekijä [53]. Paganoni et al. [54], osoitti kuitenkin UI-muotoisen yhteyden painoindeksin ja kuolleisuuden välillä, sekä suuremman eloonjäämistodennäköisyyden potilailla, joilla oli korkeampi painoindeksi (BMI: 30–35). Tässä tutkimuksessa dyslipidemia ei osoittanut riippumattomasti potilaan parempaa ennustetta.

Wills et al. [55] osoittivat äskettäin, että potilailla, jotka saivat runsaasti energiaa / runsaasti hiilihydraatteja sisältävää ravintoa, oli vähemmän haittatapahtumia ja kuolemantapauksia kuin runsaasti rasvaa / paljon kaloreita sisältävässä ryhmässä tai kontrolliryhmässä.

Nämä ilmeisen ristiriitaiset tulokset kuvaavat ALS:n monimutkaista luonnetta. Taudin ennusteessa on tosin joitain yhteisiä piirteitä: suurempi kalorien saanti näyttää parantavan selviytymistä ALS-potilailla, vaikka kolesterolin ja parempien olosuhteiden välillä ei ole löydetty täsmällisiä suhteita.

Insuliini lisää ndogeenisen kolesterolin tuotantoa, mikä vähentää eksogeenistä kolesterolia [4]. Siten runsaasti hiilihydraatteja sisältävä ruokavalio voi olla hyödyllinen kolesterolin tuotannon lisäämiseksi. Korkean energiapitoisuuden hiilihydraattipainotteisen ruokavalion positiivisia vaikutuksia voitaisiin soveltaa vuorotellen korkean rasvapitoisuuden (runsaasti voita [56]) ketogeenisen ruokavalion kanssa joissakin ALS-tyypeissä (SOD1), mutta ei RNA-prosessointihäiriöihin liittyvissä. (TDP43, FUS ja C9orf72).

Lisää kontrolloituja satunnaistettuja tutkimuksia tarvitaan ravitsemuksen ja ketogeenisen ruokavalion täsmällisempien menetelmien tutkimiseksi ALS-terapiana.

5. Mitokondrioiden häiriöt ja ketogeeninen ruokavalio

Edellisessä osassa viittasimme mitokondrioiden rooliin neurologisessa sairaudessa, kuten ALS. On yhä enemmän todisteita siitä, että ketogeeninen ruokavalio voi parantaa mitokondrioiden toimintaa ja stimuloida mitokondriogeneesiä [57–60].

Kuten Wallace ja hänen kollegansa ovat todenneet,

”Ironista kyllä, yksi vanhimmista terapeuttisista lähestymistavoista – paasto ja ketogeeninen ruokavalio – on edelleen lupaavin hoito mitokondrioiden häiriöissä” [61].

Itse asiassa, vaikka ketogeeninen ruokavalio on terapeuttinen työkalu, joka tunnetaan 20-luvulta lähtien, sen vaikutukset mitokondrioihin ovat suhteellisen tuore tutkimushavainto.

Jotkut mitokondrioiden häiriöt voivat aiheuttaa kohtauksia, joilla on erilaisia epileptisia fenotyyppejä [62]. Ketogeenisen ruokavalion vaikutuksista mitokondriopatioihin on joitain rohkaisevia tietoja.

Kang et al. [63] osoitti, että ketogeeninen ruokavalio voisi olla turvallinen ja tehokas hoito, joka vähentää kohtauksia lapsilla, joilla on vaikeasti hoidettava epilepsia ja erilaisia hengityskompleksihäiriöitä (kompleksi I, II, IV tai yhdistetty).

Ahola-Erkkilä ym. [64] ovat hoitaneet ketogeenisellä ruokavaliolla myöhään alkavan mitokondrioiden myopatian hiirimallia. Mitokondrioiden myopatian tiedetään aiheuttavan ihmisillä autosomaalisesti hallitsevaa progressiivista oftalmoplegiaa, lisäävän lihasheikkoutta ja mitokondrioiden mtDNA-vaurioita sekä sytokromi c-oksidaasi-negatiivisia lihaskuiduituja.

Ketogeeninen ruokavalio vähensi sytokromi c-oksidaasi-negatiivisten lihaskuitujen määrää ja esti mitokondrioiden ultrastruktuuristen poikkeavuuksien muodostumisen lihaksessa. Ruokavalio paransi suurimman osan metabolisista ja lipidoomisista poikkeavuuksista, mutta ei vaikuttamalla mtDNA:han, vaan lisäämällä mitokondrioiden biogeneesiä.

Kolikolla on kaksi puolta

Vaikka ketogeeninen ruokavalio voi olla terapeuttinen työkalu monissa mitokondriopohjaisissa sairauksissa, se on kontraindikatorinen (vasta-aiheinen; kontraindikatorinen menetelmä estää jonkin hoidon tai tutkimuksen soveltamisen, koska voi laukaista toisen häiriön tai sairauden).

Rasva-aineenvaihduntasairaudesta kärsivät potilaat saattavat kokea ketogeenisellä ruokavaliolla vakavan katabolisen kriisin. Synnynnäiset virheet lipidien aineenvaihduntaan liittyvissä entsyymeissä: mitokondrioiden kalvon pitkäketjuisten rasvahappojen kuljetusmekanismista beeta-hapetukseen ja Krebsin sykliin voivat olla kohtalokkaita paaston tai ketogeenisen ruokavalion aikana. Potilaan karnitiinipuutos, karnitiinipalmitoyylitransferaasin (CPT) I tai II puutos, karnitiinitransokaasipuutos, beta-oksidaation virheet tai pyruvaattikarboksylaasipuutos tulisi seuloa ennen ketogeenisen ruokavalio-terapian aloittamista. Ketogeeninen ruokavalio voi pahentaa myös akuuttia ajoittaista porfyriaa sairastavien potilaiden tilaa [65].

6. Alzheimerin tauti (AD) ja ketogeeninen ruokavalio

Alzheimerin tauti (AD) on yleisin neurodegeneratiivinen sairaus ja ikääntyneen väestön johtava dementian syy. AD-oireet ovat yleensä kognitiivisia häiriöitä, joihin liittyy progressiivisia muistivajeita ja persoonallisuuden muutoksia.

Alzheimer-potilaiden kognitiivisen taantumisen syyt johtuvat etenevästä synaptisesta toimintahäiriöstä ja sen aiheuttamasta hermosolujen surkastumisesta. Hermosolujen atrofiaa tapahtuu monilla aivojen alueilla: lähinnä neokorteksissa, limbisessä järjestelmässä ja aivokuoren alapuolisilla alueilla [66].

Hippokampus on ketogeenisen ruokavalion spesifinen kohde

McDaniel et al. osoitti, että kainihappo-indusoidussa status epilepticus -rottamallissa ketogeeninen ruokavalio esti mTOR-reitin signalointia aivoissa estäen hippokampuksen myöhäisen mTOR-aktivaation kainihappo-indusoidun status epilepticuksen jälkeen [59].

Kaiinihappo on voimakas neurotoksinen aminohapon agonisti , joka toimii aktivoimalla glutamaatti-reseptoreita. Glutamaatti on pääasiallinen eksitatorinen välittäjäaine keskushermostossa. Glutamaattireseptoreihin on neljä pääluokkaa:

– NMDA-reseptorit,
– AMPA-reseptorit,
– kainaattireseptorit ja
– metabotrooppiset glutamaattireseptorit

Kainiinihappo on kainaattireseptoreiden agonisti. Kainaattireseptorit kontrolloivat todennäköisesti natriumkanavaa, joka tuottaa viritystä aiheuttavia postsynaptisia potentiaaleja (EPSP), kun glutamaatti sitoutuu.

Hippokampuksen neuroneilla on kriittinen rooli oppimisessa ja muistin toiminnassa. Ne ovat erityisen alttiita Alzheimerin taudin aiheuttamille häiriöille ja rappeutumiselle.

AD on luokiteltu kahteen päämuotoon: familiaalinen AD (FAD) ja satunnainen AD (SAD) tai myöhään alkava ikääntymiseen liittyvä AD (LOAD); jälkimmäinen on dementian johtava syy, joka selittää yli puolet kaikista tapauksista. Melkein kaikki FAD-tapaukset johtuvat mutaatiosta kolmessa geenissä (amyloidin esiasteproteiini APP, preseniliini 1 PSEN1 ja preseniliini 2 PSEN2 [67]),

SAD:n tarkkaa etiologiaa ei ymmärretä vielä täysin. Tiedetään, että ikä on suurin riskitekijä. Alzheimerin taudin riski kasvaa eksponentiaalisesti iän myötä 65-vuotiailla tai sitä vanhemmilla ihmisillä [68].

Ikääntymisen tiedetään vaikuttavan yhdessä muiden tekijöiden kanssa. Näitä ovat:

(1) apolipoproteiini E:n (Apo E) alleelivaihtelut
(2) anatomisten reittien rappeutuminen,
(3) mitokondrioiden toimintahäiriöt,
(4) vaurioitunut veri-aivoeste,
(5) immuunijärjestelmän toimintahäiriöt,
(6) tartuntataudit ja muut ympäristötekijät, kuten altistuminen alumiinille,
(7) toistuvaT pään vammat ja
(8) aliravitsemus [69]

Kuten monissa muissakin kroonisissa sairauksissa, myös Alzheimerin taudissa hoidot voidaan jakaa kahteen luokkaan:

(A) oireenmukaiset hoidot (jotka tarjoavat tilapäistä oireiden lieventämistä muuttamatta taudin etenemistä) ja

(B) hoidot, jotka voivat mahdollisesti muuttaa taudin patogeneesiä (hidastaa tai pysäyttää taudin etenemiseen liittyviä neurologisia vaurioita)

Huolimatta joistakin FDA:n hyväksymistä lääkkeistä, kuten asetyylikoliiniesteraasin estäjistä ja memantiinista (glutamaattiantagonisti, jota käytetään käyttäytymisoireiden lieventämiseen taudin kohtalaisessa vaiheessa), tällä hetkellä ei ole olemassa tehokasta hoitoa AD:n estämiseksi, hidastamiseksi tai parantamiseksi. Suurin osa hyväksytyistä lääkkeistä tarjoaa vain kohtalaisen oireellisen vaikutuksen [70, 71].

Muiden sairauksien osalta tehokkaiden hoitojen kehittämistä vaikeuttaa AD-etiologian puutteellinen tuntemus [71] siitäkin huolimatta, että ”amyloidikaskadin” hypoteesia on tutkittu laajasti. Tämä patogeneettinen hypoteesi perustuu β-amyloidin (Aβ) neurotoksisiin ominaisuuksiin ja sen soluihin kumuloitumiseen liittyvään neurotoksisten tapahtumien kaskadin käynnistämiseen. Neurodegeneratiiviseen prosessiin lukeutuvat tunnettujen neurofibrillaaristen vyyhtien (NFT) muodostumisen lisäksi myös krooniset tulehdusreaktiot, oksidatiivisen stressin lisääntyminen ja lopuksi mitokondrioiden toimintahäiriö [71].

Alzheimerin taudin kaksi päätyyppiä johtuvat erillisistä proteiineista: tau neurofibrillaaristen vyyhtien aiheuttajana on tau-proteiini ja amyloidiplakkien tapauksessa aiheuttajana on amyloidi-β-proteiini.

Kuten edellä mainittiin, FAD:lle ja SAD:lle ei tunneta yhtenäistä etiopatogeenista mekanismia. Jälkimmäisestä on saatu havaintoja, jotka viittaavat siihen, että amyloidi-β-proteiinin ja NFT:n väheneminen toimivat yhdessä aiheuttaen mitokondrioiden toiminnan heikkenemistä ja muuttaen aivojen metabolista aktiivisuutta ikääntymisprosesseihin liittyen.

Ottaen huomioon ikääntymisprosessin ja Alzheimerin taudin välisen vahvan yhteyden ja ketogeenisen ruokavalion positiiviset vaikutukset ikääntyvissä aivoissa [72], sekä Alzheimerin taudin monitekijäisen luonteen (mitokondrioiden ja aineenvaihdunnan toimintahäiriöt), on vakuuttavaa näyttöä hypoteesille, jonka mukaan ketogeenisen ruokavalion noudattaminen AD-terapiana tuottaa myönteisiä fysiologisia, metabolisia ja kognitiivisa hoitovasteita potilailla [73, 74].
Esimerkiksi in vitro -tutkimus on osoittanut, että beeta-hydroksibutyraatin (ketoaine) lisääminen suojaa hippokampuksen hermosoluja Aβ -toksisuudelta. Tämä viittaa ketogeenisen ruokavalion mahdollisiin terapeuttisiin hyötyihin Alzheimerin tautiin liittyvissä mitokondrioiden toimintahäiriöissä [75].

Toisaalta eläinkokeet ovat antaneet osin ristiriitaisia tuloksia:

Van der Auwera et al. [76] osoitti Aβ: n vähenemistä nuorten 1,5 kk KD:lla syötettyjen siirtogeenisten AD-hiirten aivoissa, kun taas ikääntyneille koirille KD:n vaikutus näytti rajoittuneen aivojen parietaaliseen lohkoon [77].

Eläinkokeissa ketoniestereitä sisältävä pitkäaikainen (8 kuukautta) ruokinta keski-ikäisillä (8,5 kuukauden ikäisillä) hiirillä paransi hiirten kognitiota ja Aβ- ja tau-patologiaa [75]. Beckett et al. [78] osoitti, että AD-hiirimalli, jossa hiiriä ruokittiin runsaasti rasvaa ja vähän hiilihydraatteja sisältävällä ketogeenisellä ruokavaliolla, johti AD-hiirten parantuneisiin motorisin toimintoihin ilman muutoksia Aβ:ssä.

Eläinkokeiden keskenään ristiriitaiset tulokset voivat johtua eläinten iästä: hiiret ovat useimmiten nuoria tai keski-ikäisiä, mutta aineenvaihdunnan muutoksia esiintyy toistuvasti pääasiassa vanhuksilla.

Alzheimerin tauti liittyy myös metaboliseen dysregulaatioon ja insuliiniresistenssiin [79]. Monet tutkijat ovat osoittaneet, että ketogeeninen ruokavalio voi merkittävästi parantaa glukoosin homeostaasia vähentämällä aineenvaihdunnan häiriöitä ja insuliiniresistenssiä [80–82].

AD:ssä on toinen patofysiologinen mekanismi, joka johtuu muuttuneesta mitokondrioiden toiminnasta ja glukoosimetaboliasta: edistyneiden glykaation lopputuotteiden (AGE) kertyminen [83].

Huolimatta siitä, että AGE:n kertyminen soluihin ja kudoksiin on normaali ikääntymisen ominaisuus, tämä prosessi kiihtyy Alzheimerin taudissa. Glykaation lopputuotteita löytyy myös amyloidiplakeista ja neurofibrillaarisista punoksista. AGE-arvojen nousu voi selittää Alzheimerin taudin monia neuropatologisia muutoksia (proteiinien silloittuminen, oksidatiivisen stressin gliaalinen induktio ja hermosolujen surkastuminen ja kuolema).

Voidaan spekuloida, että ketogeenisen ruokavalion hermosoluja suojaavat neuroprotektiiviset vaikutukset ja ketogeeniseen ruokavalioon liittyvä glykeemisen kuorman väheneminen vaikuttavat suotuisasti Alzheimerin taudissa. Toinen mielenkiintoinen hypoteesi on ketogeenisen ruokavalion arvioidut vaikutukset mitokondriogeneesiin yhdessä mitokondriokoneiston parantamisen kanssa [61, 72, 74, 84–86].

Kuten aiemmin todettiin, mitokondrioiden toimintahäiriöiden uskotaan liittyvän Alzheimerin taudin etiologiaan [72]. Iäkkäillä potilailla on havaittu selvää hermo- ja gliasolujen mitokondrioiden metabolian heikkenemistä verrattuna terveisiin nuoriin koehenkilöihin [87]. Tämä toimintahäiriö, joka liittyy mitokondrioiden glukoosi / pyruvaattihapetuksen heikentyneeseen energiantuotantoon, voi parantaa Aβ :n ja tau:n patologista kerrostumista. Heikentynyttä mitokondrioiden toimintaa voi edustaa lisääntynyt superoksidituotanto hapettumisvaurioiden vasteena, oksidatiivisen fosforylaation väheneminen ja näin ollen mitokondrioiden elektronikuljetusketjun heikkeneminen.

Muut AD: lle ominaiset glukoosimetaboliset häiriöt aivojen tietyissä osissa liittyvät mitokondrioiden toimintahäiriöihin [88]. On mielenkiintoista huomata, että aikaisempi vähentynyt glukoosin hyödyntäminen energiasubstraattina voidaan havaita FDG-PET:llä kognitioon liittyvissä kokeissa henkilöillä, joilla on tunnettu AD-historia [89].

On luultavaa, että alentunut aivojen glukoosin käyttö (hermosolujen heikentynyt glukoosinotto) edistää AD-neuropatologian kehittymistä. Aivojen glukoosimetabolian varhainen heikkeneminen voidaan havaita ennen mitattavissa olevaa kognitiivista heikkenemistä [90]. Muut todisteet tukevat tätä teoriaa, kuten alentunut pitoisuus glukoosin kuljettajia (GLUT 1 ja 2, mutta myös hermosolujen glukoosi kuljettaja GLUT 3). Alzheimerin taudissa aivoissa todettava tau-taudin hyperfosforylaatio liittyy tähän ilmiöön [91].

Aivojen aineenvaihdunnan muutos glukoosista ketogeenisen ruokavalion tuottamiin ketoaineisiin [17] on tehokas hoitomuoto tyypin I glukoosinkuljettajapuutosoireyhtymässä [92]. Ketogeeninen ruokavalio voi olla toimiva terapiavaihtoehto myös GLUT-kuljettajien puutteen aiheuttamaan hermosolujen rappeutumiseen Alzheimerin taudissa [73].

Lopuksi: vaikka suoraa näyttöä ketogeenisen ruokavalion terapeuttisista hyödyistä Alzheimerin taudin hoidossa ei ole, tämä ravitsemuksellinen lähestymistapa näyttää lupaavalta ja ansaitsee siten laajemmat kliiniset tutkimukset.


7. Parkinsonin tauti ja ketogeeninen ruokavalio


Sporadisen Parkinsonin taudin (PD) patogeneesi on yhä ratkaisematta. Tutkimukset viittaavat siihen, että ensisijainen syy on dopaminergisten* hermosolujen eksitotoksinen rappeutuminen
substantia nigrassa, mikä johtaa motoriikan heikentymiseen ja lisääntyvässä määrin kognition alentumiseen sekä muihin kortikaalisen toiminnan häiriöihin.

*Dopaminerginen: autonomisen hermoston hermosoluista dopamiinia erittävä tai sen välityksellä stimuloituva; 2. (aineista) dopamiinin tavoin vaikuttava

Dopamiinia sisältäviä neuroneja on runsaasti erityisesti keskiaivoissa substantia nigran ja tegmentumin tienoilla. Näiden aksonit haarautuvat laajalle alueelle. Aivoissa on neljä dopaminergista päärataa: mesokortikaalinen, mesolimbinen, nigrostriataalinen ja tuberoinfundibulaarinen.

Nigrostriataalisen radan tuhoutuessa ilmentyy Parkinsonin tauti. Skitsofrenian ajatellaan johtuvan mesokortikaalisen ja mesolimbisen radan dopamiinin D2-reseptorien ylistimuloitumisesta.

Mitokondrioiden toiminnan heikentymisellä, johon liittyy substantia nigra (mustatumake), on merkittävä rooli Parkinsonin taudin kehittymisessä ja etenemisessä [94].

Kashiwaya et al. käytti heroiinianalogia 1-metyyli-4-fenyylipyridiniumia, MPP (+), joka tuottaa dopaminergisten substantia nigran eli mustatumakkeen -solujen kuoleman estämällä mitokondrioiden NADH-dehydrogenaasien monientsyymikompleksin. Tämä aiheuttaa samanlaisen oireyhtymän kuin Parkinsonin tauti viljellyissä mesenkefaalisissa neuroneissa. β-hydroksibutyraatti suojasi näitä hermosoluja MPP (+) – toksisuuden aiheuttamalta neurodegeneraatiolta [74].

Eläinmalleissa 1-metyyli-4-fenoli-1,2,5,6-tetrahydropyridiiniä (MPTP) käytetään tuottamaan ihmisen Parkinsonin taudin kaltaista oireyhtymää jäljittelevä dopaminergisten hermosolujen selektiivinen tuhoaminen mustatumakkeessa. Kuten edellä mainituissa sairauksissa, ketogeenisen ruokavalion positiiviset vaikutukset mitokondrioiden toimintaan voivat olla avaintekijä tällaisen ruokavalion terapiakäytössä, koska ketonit voivat ohittaa Parkinsonin taudin aiheuttaman kompleksin I aktiivisuuden puutteen.

Hiirikokeissa β-hydroksibutyraatin infuusio suojasi hiiriä MPTP:n aiheuttamalta dopaminergiseltä hermoston rappeutumiselta ja motorisilta häiriöiltä [49]. Lisäksi ketogeeninen ruokavalio suojasi mustatumakkeen dopaminergisiä neuroneja 6-hydroksidopamiinin neurotoksisuudelta Parkinsonin taudin rottamallissa [95].

VanItaille et al. [96] osoitti, että ihmisillä, jotka pystyvät valmistamaan ”hyperketogeenisen” ruokavalion kotona ja noudattamaan sitä 28 päivän ajan, korkea ketoaineiden pitoisuus assosioitui taudin oireiden paranemiseen yhtenäisellä Parkinsonin taudin luokitusasteikolla Unified Parkinson’s Disease Rating Scale).

8. Glykogenoosit ja ketogeeninen ruokavalio

Glykogenoosit (glykogeenin varastointisairaudet, GSD) ovat entsyymivirheistä johtuvia perinnöllisiä häiriöitä, jotka vaikuttavat glykogeenimetaboliaan ja johtavat normaalin tai epänormaalin rakenteen glykogeenin solunsisäiseen kertymiseen erilaisiin solutyyppeihin.

Klassisesti GSD numeroitiin I – VIII niiden löytämisen ja erityisen entsyymivian mukaan [97]. Viime vuosina on tunnistettu muita primaarisia glykogenooseja (GSD 0, GSD IX – XV) [98].

GSD välittyy autosomaalisena resessiivisenä, lukuun ottamatta GSD VIII, joka on X-kytketty. Toiminnallisesta näkökulmasta GSD I, III, IV, VI ja VIII / IXa voidaan ryhmitellä maksan GSD:ksi [99], koska puutteelliset entsyymit ilmentyvät enimmäkseen maksasoluissa. Kun otetaan huomioon maksan keskeinen rooli glykemian säätelyssä glykogenolyysin avulla, ei ole yllättävää, että hypoglykemia on maksan GSD:n pääasiallinen ilmenemismuoto [97, 100]. Tämä puolestaan aiheuttaa neurologisia oireita, jotka vaihtelevat kouristuksista kohtauksiin, varsinkin sairauden alkuvaiheessa. Pitkällä aikavälillä uusiutuva vaikea hypoglykemia voi aiheuttaa aivovaurioita erityisesti GSD I:ssä (von Gierken tauti, G-6-P-fosfataasin puutos), joka on yleisin maksan GSD.

GSD-hoito perustuu ruokavaliohoitoon hypoglykemian estämiseksi. Potilaita ruokitaan tärkkelyspitoisilla elintarvikkeilla ympäri vuorokauden [100, 101]. Tieteellinen perustelu ketogeenisen ruokavalion (KD) mahdolliselle käytölle johtuu varhaisesta havainnosta, jonka mukaan hypoglykemiaan liittyvät oireet paranivat iän myötä GSD:ssä [102] sekä GSD III:ssa [100].
On tunnettua, että tämä sopeutuminen tapahtuu aivoissa sekä paastotilassa että kuumeen aikana [102]. Tämä havainto tulkittiin klassisesti aivoissa tapahtuvien sopeutumisten seurauksena, joka sallii ketoaineiden lisääntyneen käytön polttoainesubstraateina glukoosin sijasta. Sama mekanismi selittää kalorirajoituksen [100] vaikutusta, joka johtaa myös mataliin verensokeritasoihin.

Mekanistinen tulkinta olisi se, että ketogeeninen ruokavalio lisää aivojen energia-aineenvaihdunnan reittien käyttöä riippumatta glykogeenin hajoamisesta. Näiden näkökohtien perusteella ketogeenistä ruokavaliota on käytetty tehokkaasti lihassolujen GSD V:n (McArdlen tauti) hoidossa [103, 104].

Ketogeenisen ruokavalion kouristuksia estävät vaikutukset ovat tunnustetaan yleisesti, vaikka mekanismeja ei ole vielä täysin selvitetty [105]. Ketogeenisen ruokavalion mahdollista käyttöä patologisissa olosuhteissa, joille on tunnusomaista krooninen hypoglykemia, tukee edelleen se, että ketogeeninen ruokavalio on standardi GLUT1-puutosoireyhtymän hoidossa [106]. Tätä voidaan pitää maksan GSD:n metabolisena fenokopiana, koska siinä verensokeria ei voida kuljettaa hermosoluihin.

Tuore tutkimus [107] arveli, että ketogeenistä ruokavaliota voidaan käyttää menestyksekkäästi vakavan GSD III:een liittyvän kardiomyopatian hoidossa. Kaiken kaikkiaan nämä havainnot saattavat kannustaa jatkotutkimuksiin ketogeenisen ruokavalion käytöstä valittujen GSD-muotojen hoidossa.

9. Loppupäätelmä

Ketogeenisen ruokavalion aiheuttamaa erikoista metabolista tilaa on tutkittu laajalti viime vuosina. Ketoaineiden pitoisuuden nousu, verensokerin aleneminen yhdessä monien tärkeiden aineenvaihduntareittien (esim. IGF-1 / AKT / mTor, AMPK / PGC1α) kanssa on osoittautunut potentiaaliseksi terapeuttiseksi aseeksi monia neurologisia ja neuromuskulaarisia sairauksia vastaan.

Nämä tutkimukset tarjoavat teoreettisen perustan ketogeenisen ruokavalion vaikutukselle useissa hermo-lihassairauksissa. Monia korkeita esteitä on kavuttava, ennen kuin näitä löydöksiä voidaan soveltaa laajasti kliiniseen käytäntöön tai kansanterveyden parantamiseen.

Ensinnäkin ketogeenisen ruokavalion tarkasta mekanismista hermo-lihassairauksien terapiana tiedetään edelleen liian vähän, ja toiseksi tällaisen ruokavalion pitkäaikaisia vaikutuksia tulisi tutkia näillä potilailla, huolimatta siitä, että meillä on vain alustavia todisteita ja todisteita, jotka perustuvat lähinnä eläinmalleihin. Saatavilla olevat tiedot osoittavat, että KD:n aineenvaihduntamekanismi joillakin neurologisilla ja hermo-lihassairauksilla voisi olla seuraava:

(1) Tehokas energialähde tietyntyyppisten hermostoa rappeuttavien sairauksien hoidolle, joille on tunnusomaista aivojen fokaalinen hypometabolia. Tällaisia ovat esimerkiksi Parkinsonin ja Alzheimerin taudit. Neuronaaliset solut pystyvät metabolisoimaan ketoaineita glukoosipuutoksen aikana.

(2) Ketonit voivat lisätä ATP-hydrolyysin vaikutusta ja korvata asetyyli-CoA:lla Alzheimerin taudille ominaisen asetyylikoliinin vähenemisen. Glukoosimetaboliaan verrattuna ketonit tuottavat alhaisempia oksidatiivisen stressin tasoja aivoissa yhdessä suuremman soluenergiantuoton ja antioksidanttikapasiteetin kanssa. Lisäksi ketoosi voi lisätä glutationiperoksidaasia hippokampussoluissa ja yleensä vähentää mitokondrioiden ROS-tuotantoa.

(3) Lisää mitokondrioiden biogeneesireittejä (AMPK:n ja PGC1a-reitin aktivoinnin kautta). Mitokondrioiden reittien parantaminen voi auttaa parantamaan aivojen ja hermosolujen aineenvaihduntaa.

(4) Ketoaineet ohittavat ALS:n luurankolihakseen ja selkäytimeen perustuvan mitokondrioiden kompleksin I aktiivisuuden vian. Viljellyissä hermosoluissa, joita hoidetaan farmakologisilla aineilla, jotka estävät kompleksin I, ketoaineiden lisäys palauttaa kompleksin toiminnan.

(5) Vähentää sytokromi-c-oksidaasi-negatiivisten lihassyiden määrää joissakin mitokondrioiden myopatioissa ja estää mitokondrioiden ultrastruktuuristen poikkeavuuksien muodostumisen.

Lopuksi uskomme, että ketogeenistä ruokavaliota tulisi tutkia syvällisemmin sen rohkaisevan potentiaalisen terapiavaikutuksen vuoksi monien hermo-lihas- ja neurodegeneratiivisten sairauksien hoidossa.

Tutkimuskatsauksen irjoittajat toteavat, ettei heillä ole omia lehmiä ojassa tai mitään taloudellisia intressejä. Minulla ketofiilistelevänä multippelisklerootikkona on, mutta tässä toimin lähinnä editorina. Artikkelin julkaisu voi tuottaa mainostuloja joitain senttejä.

Ketogeeninen ruokavalio ei paranna syntyneitä neurologisia ja neuromotorisia vaurioita, mutta on perusteltua uskoa, että se ainakin hidastaa, ellei jopa ehkäise, uusien vaurioiden syntyä. KD ei lupaa ihmettä, mutta se lupaa parempaa kuin mitä tähän asti on ollut tarjolla. Tieto lisääntyy koko ajan. Ketogeenisen ruokavalion stimuloima autofagosytoosi yhdessä neurogeneesin ja neuroplastisuuden kanssa voi ehkä korjata joitain syntyneitä vaurioita pitkällä aikavälillä. Näín toivon.

Viitteet

  1. N. N. Danial, A. L. Hartman, C. E. Stafstrom, and L. L. Thio, “How does the ketogenic diet work? Four potential mechanisms,” Journal of Child Neurology, vol. 28, no. 8, pp. 1027–1033, 2013. View at: Publisher Site | Google Scholar
  2. E. Kossoff, “The fat is in the fire: ketogenic diet for refractory status epilepticus,” Epilepsy Currents, vol. 11, no. 3, pp. 88–89, 2011. View at: Publisher Site | Google Scholar
  3. R. G. Levy, P. N. Cooper, and P. Giri, “Ketogenic diet and other dietary treatments for epilepsy,” Cochrane Database of Systematic Reviews, vol. 3, 2012. View at: Google Scholar
  4. A. Paoli, “Ketogenic diet for obesity: friend or foe?” International Journal of Environmental Research and Public Health, vol. 11, pp. 2092–2107, 2014. View at: Google Scholar
  5. J. C. Mavropoulos, W. S. Yancy, J. Hepburn, and E. C. Westman, “The effects of a low-carbohydrate, ketogenic diet on the polycystic ovary syndrome: a pilot study,” Nutrition and Metabolism, vol. 2, article 35, 2005. View at: Publisher Site | Google Scholar
  6. R. J. Klement and U. Kämmerer, “Is there a role for carbohydrate restriction in the treatment and prevention of cancer?” Nutrition & Metabolism, vol. 8, article 75, 2011. View at: Publisher Site | Google Scholar
  7. T. N. Seyfried, J. Marsh, L. M. Shelton, L. C. Huysentruyt, and P. Mukherjee, “Is the restricted ketogenic diet a viable alternative to the standard of care for managing malignant brain cancer?” Epilepsy Research, vol. 100, no. 3, pp. 310–326, 2012. View at: Publisher Site | Google Scholar
  8. A. Accurso, R. K. Bernstein, A. Dahlqvist et al., “Dietary carbohydrate restriction in type 2 diabetes mellitus and metabolic syndrome: time for a critical appraisal,” Nutrition and Metabolism, vol. 5, no. 1, article 9, 2008. View at: Publisher Site | Google Scholar
  9. A. Paoli, A. Rubini, J. S. Volek, and K. A. Grimaldi, “Beyond weight loss: a review of the therapeutic uses of very-low-carbohydrate (ketogenic) diets,” European Journal of Clinical Nutrition, vol. 67, no. 8, pp. 789–796, 2013. View at: Publisher Site | Google Scholar
  10. A. Paoli, K. Grimaldi, L. Toniolo, M. Canato, A. Bianco, and A. Fratter, “Nutrition and acne: therapeutic potential of ketogenic diets,” Skin Pharmacology and Physiology, vol. 25, no. 3, pp. 111–117, 2012. View at: Publisher Site | Google Scholar
  11. A. Paoli, M. Canato, L. Toniolo et al., “The ketogenic diet: an underappreciated therapeutic option?” La Clinica Terapeutica, vol. 162, no. 5, pp. e145–e153, 2011. View at: Google Scholar
  12. C. E. Stafstrom and J. M. Rho, “The ketogenic diet as a treatment paradigm for diverse neurological disorders,” Frontiers in Pharmacology, vol. 3, article 59, 2012. View at: Publisher Site | Google Scholar
  13. P. Felig, O. E. Owen, J. Wahren, and G. F. Cahill Jr., “Amino acid metabolism during prolonged starvation,” Journal of Clinical Investigation, vol. 48, no. 3, pp. 584–594, 1969. View at: Publisher Site | Google Scholar
  14. O. E. Owen, P. Felig, A. P. Morgan, J. Wahren, and G. F. Cahill Jr., “Liver and kidney metabolism during prolonged starvation,” The Journal of Clinical Investigation, vol. 48, no. 3, pp. 574–583, 1969. View at: Publisher Site | Google Scholar
  15. S. Jitrapakdee, A. Vidal-Puig, and J. C. Wallace, “Anaplerotic roles of pyruvate carboxylase in mammalian tissues,” Cellular and Molecular Life Sciences, vol. 63, no. 7-8, pp. 843–854, 2006. View at: Publisher Site | Google Scholar
  16. F. C. George, “Fuel metabolism in starvation,” Annual Review of Nutrition, vol. 26, pp. 1–22, 2006. View at: Publisher Site | Google Scholar
  17. O. E. Owen, A. P. Morgan, H. G. Kemp, J. M. Sullivan, M. G. Herrera, and G. F. Cahill Jr., “Brain metabolism during fasting,” Journal of Clinical Investigation, vol. 46, no. 10, pp. 1589–1595, 1967. View at: Publisher Site | Google Scholar
  18. T. Fukao, G. Mitchell, J. O. Sass, T. Hori, K. Orii, and Y. Aoyama, “Ketone body metabolism and its defects,” Journal of Inherited Metabolic Disease, 2014. View at: Publisher Site | Google Scholar
  19. T. Fukao, G. D. Lopaschuk, and G. A. Mitchell, “Pathways and control of ketone body metabolism: on the fringe of lipid biochemistry,” Prostaglandins Leukotrienes and Essential Fatty Acids, vol. 70, no. 3, pp. 243–251, 2004. View at: Publisher Site | Google Scholar
  20. A. Paoli, L. Cenci, M. Fancelli et al., “Ketogenic diet and phytoextracts comparison of the efficacy of mediterranean, zone and tisanoreica diet on some health risk factors,” Agro Food Industry Hi-Tech, vol. 21, no. 4, pp. 24–29, 2010. View at: Google Scholar
  21. R. L. Veech, “The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism,” Prostaglandins Leukotrienes and Essential Fatty Acids, vol. 70, no. 3, pp. 309–319, 2004. View at: Publisher Site | Google Scholar
  22. R. L. Leino, D. Z. Gerhart, R. Duelli, B. E. Enerson, and L. R. Drewes, “Diet-induced ketosis increases monocarboxylate transporter (MCT1) levels in rat brain,” Neurochemistry International, vol. 38, no. 6, pp. 519–527, 2001. View at: Publisher Site | Google Scholar
  23. M. D. McCue, “Starvation physiology: reviewing the different strategies animals use to survive a common challenge,” Comparative Biochemistry and Physiology A: Molecular & Integrative Physiology, vol. 156, no. 1, pp. 1–18, 2010. View at: Publisher Site | Google Scholar
  24. K. Sato, Y. Kashiwaya, C. A. Keon et al., “Insulin, ketone bodies, and mitochondrial energy transduction,” The FASEB Journal, vol. 9, no. 8, pp. 651–658, 1995. View at: Google Scholar
  25. Y. Kashiwaya, K. Sato, N. Tsuchiya et al., “Control of glucose utilization in working perfused rat heart,” The Journal of Biological Chemistry, vol. 269, no. 41, pp. 25502–25514, 1994. View at: Google Scholar
  26. A. Paoli, L. Cenci, and K. A. Grimaldi, “Effect of ketogenic mediterranean diet with phytoextracts and low carbohydrates/high-protein meals on weight, cardiovascular risk factors, body composition and diet compliance in Italian council employees,” Nutrition Journal, vol. 10, no. 1, article 112, 2011. View at: Publisher Site | Google Scholar
  27. T. N. Seyfried and P. Mukherjee, “Targeting energy metabolism in brain cancer: review and hypothesis,” Nutrition and Metabolism, vol. 2, article 30, 2005. View at: Publisher Site | Google Scholar
  28. J. A. Vazquez and U. Kazi, “Lipolysis and gluconeogenesis from glycerol during weight reduction with very-low-calorie diets,” Metabolism: Clinical and Experimental, vol. 43, no. 10, pp. 1293–1299, 1994. View at: Publisher Site | Google Scholar
  29. M. A. B. Veldhorst, M. S. Westerterp-Plantenga, and K. R. Westerterp, “Gluconeogenesis and energy expenditure after a high-protein, carbohydrate-free diet,” The American Journal of Clinical Nutrition, vol. 90, no. 3, pp. 519–526, 2009. View at: Publisher Site | Google Scholar
  30. A. M. Robinson and D. H. Williamson, “Physiological roles of ketone bodies as substrates and signals in mammalian tissues,” Physiological Reviews, vol. 60, no. 1, pp. 143–187, 1980. View at: Google Scholar
  31. H. A. Krebs, “The regulation of the release of ketone bodies by the liver,” Advances in Enzyme Regulation, vol. 4, pp. 339–353, 1966. View at: Publisher Site | Google Scholar
  32. N. Amen-Ra, “Humans are evolutionarily adapted to caloric restriction resulting from ecologically dictated dietary deprivation imposed during the Plio-Pleistocene period,” Medical Hypotheses, vol. 66, no. 5, pp. 978–984, 2006. View at: Publisher Site | Google Scholar
  33. J. C. Newman and E. Verdin, “Ketone bodies as signaling metabolites,” Trends in Endocrinology and Metabolism, vol. 25, no. 1, pp. 42–52, 2014. View at: Publisher Site | Google Scholar
  34. S. Jäer, C. Handschin, J. St-Pierre, and B. M. Spiegelman, “AMP-activated protein kinase (AMPK) action in skeletal muscle via direct phosphorylation of PGC-1α,” Proceedings of the National Academy of Sciences of the United States of America, vol. 104, no. 29, pp. 12017–12022, 2007. View at: Publisher Site | Google Scholar
  35. C. R. Benton, D. C. Wright, and A. Bonen, “PGC-1alpha-mediated regulation of gene expression and metabolism: implications for nutrition and exercise prescriptions,” Applied Physiology, Nutrition and Metabolism, vol. 33, no. 5, pp. 843–862, 2008. View at: Publisher Site | Google Scholar
  36. J. Yu and J. Auwerx, “Protein deacetylation by SIRT1: an emerging key post-translational modification in metabolic regulation,” Pharmacological Research, vol. 62, no. 1, pp. 35–41, 2010. View at: Publisher Site | Google Scholar
  37. D. L. Williamson, “Normalizing a hyperactive mTOR initiates muscle growth during obesity,” Aging, vol. 3, no. 2, pp. 83–84, 2011. View at: Google Scholar
  38. B. Draznin, C. Wang, R. Adochio, J. W. Leitner, and M.-A. Cornier, “Effect of dietary macronutrient composition on AMPK and SIRT1 expression and activity in human skeletal muscle,” Hormone and Metabolic Research, vol. 44, no. 9, pp. 650–655, 2012. View at: Publisher Site | Google Scholar
  39. J. C. Yoon, P. Puigserver, G. Chen et al., “Control of hepatic gluconeogenesis through the transcriptional coaotivator PGC-1,” Nature, vol. 413, no. 6852, pp. 131–138, 2001. View at: Publisher Site | Google Scholar
  40. N. B. Ruderman, X. J. Xu, L. Nelson et al., “AMPK and SIRT1: a long-standing partnership?” The American Journal of Physiology: Endocrinology and Metabolism, vol. 298, no. 4, pp. E751–E760, 2010. View at: Publisher Site | Google Scholar
  41. R. G. Miller, J. D. Mitchell, M. Lyon, and D. H. Moore, “Riluzole for amyotrophic lateral sclerosis (ALS)/motor neuron disease (MND),” Cochrane Database of Systematic Reviews, no. 2, Article ID CD001447, 2002. View at: Google Scholar
  42. L. I. Bruijn, T. M. Miller, and D. W. Cleveland, “Unraveling the mechanisms involved in motor neuron degeneration in ALS,” Annual Review of Neuroscience, vol. 27, pp. 723–749, 2004. View at: Publisher Site | Google Scholar
  43. L. P. Rowland and N. A. Shneider, “Amyotrophic lateral sclerosis,” The New England Journal of Medicine, vol. 344, no. 22, pp. 1688–1700, 2001. View at: Publisher Site | Google Scholar
  44. M. Strong and J. Rosenfeld, “Amyotrophic lateral sclerosis: a review of current concepts,” Amyotrophic Lateral Sclerosis and Other Motor Neuron Disorders, vol. 4, no. 3, pp. 136–143, 2003. View at: Publisher Site | Google Scholar
  45. N. Siva, “Can ketogenic diet slow progression of ALS?” The Lancet Neurology, vol. 5, no. 6, article 476, 2006. View at: Google Scholar
  46. D. R. Rosen, T. Siddique, D. Patterson et al., “Mutations in Cu/Zn superoxide dismutase gene are associated with familial amyotrophic lateral sclerosis,” Nature, vol. 362, no. 6415, pp. 59–62, 1993. View at: Publisher Site | Google Scholar
  47. P. Pasinelli, M. E. Belford, N. Lennon et al., “Amyotrophic lateral sclerosis-associated SOD1 mutant proteins bind and aggregate with Bcl-2 in spinal cord mitochondria,” Neuron, vol. 43, no. 1, pp. 19–30, 2004. View at: Publisher Site | Google Scholar
  48. S. Vielhaber, D. Kunz, K. Winkler et al., “Mitochondrial DNA abnormalities in skeletal muscle of patients with sporadic amyotrophic lateral sclerosis,” Brain, vol. 123, no. 7, pp. 1339–1348, 2000. View at: Publisher Site | Google Scholar
  49. K. Tieu, C. Perier, C. Caspersen et al., “D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease,” Journal of Clinical Investigation, vol. 112, no. 6, pp. 892–901, 2003. View at: Publisher Site | Google Scholar
  50. Z. Zhao, D. J. Lange, A. Voustianiouk et al., “A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral sclerosis,” BMC Neuroscience, vol. 7, article 29, 2006. View at: Publisher Site | Google Scholar
  51. W. Zhao, M. Varghese, P. Vempati et al., “Caprylic triglyceride as a novel therapeutic approach to effectively improve the performance and attenuate the symptoms due to the motor neuron loss in ALS disease,” PLoS ONE, vol. 7, no. 11, Article ID e49191, 2012. View at: Publisher Site | Google Scholar
  52. E. I. Posse de Chaves, A. E. Rusinol, D. E. Vance, R. B. Campenot, and J. E. Vance, “Role of lipoproteins in the delivery of lipids to axons during axonal regeneration,” Journal of Biological Chemistry, vol. 272, no. 49, pp. 30766–30773, 1997. View at: Publisher Site | Google Scholar
  53. L. Dupuis, P. Corcia, A. Fergani et al., “Dyslipidemia is a protective factor in amyotrophic lateral sclerosis,” Neurology, vol. 70, no. 13, pp. 1004–1009, 2008. View at: Publisher Site | Google Scholar
  54. S. Paganoni, J. Deng, M. Jaffa, M. E. Cudkowicz, and A. Wills, “Body mass index, not dyslipidemia, is an independent predictor of survival in amyotrophic lateral sclerosis,” Muscle and Nerve, vol. 44, no. 1, pp. 20–24, 2011. View at: Publisher Site | Google Scholar
  55. A. M. Wills, J. Hubbard, E. A. Macklin et al., “Hypercaloric enteral nutrition in patients with amyotrophic lateral sclerosis: a randomised, double-blind, placebo-controlled phase 2 trial,” The Lancet, vol. 383, no. 9934, pp. 2065–2072, 2014. View at: Google Scholar
  56. A. Fergani, H. Oudart, J. G. De Aguilar et al., “Increased peripheral lipid clearance in an animal model of amyotrophic lateral sclerosis,” Journal of Lipid Research, vol. 48, no. 7, pp. 1571–1580, 2007. View at: Publisher Site | Google Scholar
  57. K. J. Bough, J. Wetherington, B. Hassel et al., “Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet,” Annals of Neurology, vol. 60, no. 2, pp. 223–235, 2006. View at: Publisher Site | Google Scholar
  58. D. Y. Kim, J. Vallejo, and J. M. Rho, “Ketones prevent synaptic dysfunction induced by mitochondrial respiratory complex inhibitors,” Journal of Neurochemistry, vol. 114, no. 1, pp. 130–141, 2010. View at: Publisher Site | Google Scholar
  59. S. S. McDaniel, N. R. Rensing, L. L. Thio, K. A. Yamada, and M. Wong, “The ketogenic diet inhibits the mammalian target of rapamycin (mTOR) pathway,” Epilepsia, vol. 52, no. 3, pp. e7–e11, 2011. View at: Publisher Site | Google Scholar
  60. S. Srivastava, Y. Kashiwaya, M. T. King et al., “Mitochondrial biogenesis and increased uncoupling protein 1 in brown adipose tissue of mice fed a ketone ester diet,” FASEB Journal, vol. 26, no. 6, pp. 2351–2362, 2012. View at: Publisher Site | Google Scholar
  61. D. C. Wallace, W. Fan, and V. Procaccio, “Mitochondrial energetics and therapeutics,” Annual Review of Pathology, vol. 5, pp. 297–348, 2010. View at: Publisher Site | Google Scholar
  62. H. Kang, Y. Lee, and H. D. Kim, “Mitochondrial disease and epilepsy,” Brain and Development, vol. 35, no. 8, pp. 757–761, 2013. View at: Publisher Site | Google Scholar
  63. H. Kang, Y. Lee, H. D. Kim, J. S. Lee, and A. Slama, “Safe and effective use of the ketogenic diet in children with epilepsy and mitochondrial respiratory chain complex defects,” Epilepsia, vol. 48, no. 1, pp. 82–88, 2007. View at: Publisher Site | Google Scholar
  64. S. Ahola-Erkkilä, C. J. Carroll, K. Peltola-Mjösund et al., “Ketogenic diet slows down mitochondrial myopathy progression in mice,” Human Molecular Genetics, vol. 19, no. 10, Article ID ddq076, pp. 1974–1984, 2010. View at: Publisher Site | Google Scholar
  65. E. H. Kossoff, B. A. Zupec-Kania, P. E. Amark et al., “Optimal clinical management of children receiving the ketogenic diet: recommendations of the International Ketogenic Diet Study Group,” Epilepsia, vol. 50, no. 2, pp. 304–317, 2009. View at: Publisher Site | Google Scholar
  66. A. Serrano-Pozo, M. P. Frosch, E. Masliah, and B. T. Hyman, “Neuropathological alterations in Alzheimer disease,” Cold Spring Harbor perspectives in Medicine, vol. 1, no. 1, Article ID a006189, 2011. View at: Google Scholar
  67. P. G. Ridge, M. T. W. Ebbert, and J. S. K. Kauwe, “Genetics of alzheimer’s disease,” BioMed Research International, vol. 2013, Article ID 254954, 13 pages, 2013. View at: Publisher Site | Google Scholar
  68. J. Weuve, L. E. Hebert, P. A. Scherr, and D. A. Evans, “Deaths in the United States among persons with Alzheimer’s disease (2010–2050),” Alzheimer’s & Dementia, vol. 10, no. 2, pp. e40–e46, 2014. View at: Publisher Site | Google Scholar
  69. B. J. Balin and A. P. Hudson, “Etiology and pathogenesis of late-onset Alzheimer’s disease,” Current Allergy and Asthma Reports, vol. 14, article 417, 2014. View at: Publisher Site | Google Scholar
  70. D. M. Holtzman, E. Mandelkow, and D. J. Selkoe, “Alzheimer disease in 2020,” Cold Spring Harbor Perspectives in Medicine, vol. 2, no. 11, 2012. View at: Google Scholar
  71. D. Selkoe, E. Mandelkow, and D. Holtzman, “Deciphering Alzheimer disease,” Cold Spring Harbor perspectives in Medicine, vol. 2, no. 1, Article ID a011460, 2012. View at: Google Scholar
  72. J. Yao and R. D. Brinton, “Targeting mitochondrial bioenergetics for Alzheimer’s prevention and treatment,” Current Pharmaceutical Design, vol. 17, no. 31, pp. 3474–3479, 2011. View at: Publisher Site | Google Scholar
  73. S. A. Hashim and T. B. Vanitallie, “Ketone Body Therapy: from ketogenic diet to oral administration of ketone ester,” Journal of Lipid Research, 2014. View at: Publisher Site | Google Scholar
  74. Y. Kashiwaya, T. Takeshima, N. Mori, K. Nakashima, K. Clarke, and R. L. Veech, “D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease,” Proceedings of the National Academy of Sciences of the United States of America, vol. 97, no. 10, pp. 5440–5444, 2000. View at: Publisher Site | Google Scholar
  75. Y. Kashiwaya, C. Bergman, J. Lee et al., “A ketone ester diet exhibits anxiolytic and cognition-sparing properties, and lessens amyloid and tau pathologies in a mouse model of Alzheimer’s disease,” Neurobiology of Aging, vol. 34, no. 6, pp. 1530–1539, 2013. View at: Publisher Site | Google Scholar
  76. I. Van Der Auwera, S. Wera, F. Van Leuven, and S. T. Henderson, “A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease,” Nutrition and Metabolism, vol. 2, article 28, 2005. View at: Publisher Site | Google Scholar
  77. C. M. Studzinski, W. A. MacKay, T. L. Beckett et al., “Induction of ketosis may improve mitochondrial function and decrease steady-state amyloid-β precursor protein (APP) levels in the aged dog,” Brain Research, vol. 1226, pp. 209–217, 2008. View at: Publisher Site | Google Scholar
  78. T. L. Beckett, C. M. Studzinski, J. N. Keller, M. Paul Murphy, and D. M. Niedowicz, “A ketogenic diet improves motor performance but does not affect β-amyloid levels in a mouse model of Alzheimer’s disease,” Brain Research, vol. 1505, pp. 61–67, 2013. View at: Publisher Site | Google Scholar
  79. K. Akter, E. A. Lanza, S. A. Martin, N. Myronyuk, M. Rua, and R. B. Raffa, “Diabetes mellitus and Alzheimer’s disease: shared pathology and treatment?” British Journal of Clinical Pharmacology, vol. 71, no. 3, pp. 365–376, 2011. View at: Publisher Site | Google Scholar
  80. H. M. Dashti, T. C. Mathew, M. Khadada et al., “Beneficial effects of ketogenic diet in obese diabetic subjects,” Molecular and Cellular Biochemistry, vol. 302, no. 1-2, pp. 249–256, 2007. View at: Publisher Site | Google Scholar
  81. A. Paoli, A. Bianco, K. A. Grimaldi, A. Lodi, and G. Bosco, “Long term successful weight loss with a combination biphasic ketogenic mediterranean diet and mediterranean diet maintenance protocol,” Nutrients, vol. 5, no. 12, pp. 5205–5217, 2013. View at: Publisher Site | Google Scholar
  82. E. C. Westman, W. S. Yancy Jr., J. C. Mavropoulos, M. Marquart, and J. R. McDuffie, “The effect of a low-carbohydrate, ketogenic diet versus a low-glycemic index diet on glycemic control in type 2 diabetes mellitus,” Nutrition and Metabolism, vol. 5, no. 1, article 36, 2008. View at: Publisher Site | Google Scholar
  83. V. Srikanth, A. Maczurek, T. Phan et al., “Advanced glycation endproducts and their receptor RAGE in Alzheimer’s disease,” Neurobiology of Aging, vol. 32, no. 5, pp. 763–777, 2011. View at: Publisher Site | Google Scholar
  84. M. Balietti, B. Giorgetti, G. Di Stefano et al., “A ketogenic diet increases succinic dehydrogenase (SDH) activity and recovers age-related decrease in numeric density of SDH-positive mitochondria in cerebellar Purkinje cells of late-adult rats,” Micron, vol. 41, no. 2, pp. 143–148, 2010. View at: Publisher Site | Google Scholar
  85. M. Balietti, P. Fattoretti, B. Giorgetti et al., “A ketogenic diet increases succinic dehydrogenase activity in aging cardiomyocytes,” Annals of the New York Academy of Sciences, vol. 1171, pp. 377–384, 2009. View at: Publisher Site | Google Scholar
  86. M. Maalouf, J. M. Rho, and M. P. Mattson, “The neuroprotective properties of calorie restriction, the ketogenic diet, and ketone bodies,” Brain Research Reviews, vol. 59, no. 2, pp. 293–315, 2009. View at: Publisher Site | Google Scholar
  87. F. Boumezbeur, G. F. Mason, R. A. de Graaf et al., “Altered brain mitochondrial metabolism in healthy aging as assessed by in vivo magnetic resonance spectroscopy,” Journal of Cerebral Blood Flow & Metabolism, vol. 30, no. 1, pp. 211–221, 2010. View at: Publisher Site | Google Scholar
  88. S. Hoyer, “Causes and consequences of disturbances of cerebral glucose metabolism in sporadic alzheimer disease: therapeutic Implications,” Advances in Experimental Medicine and Biology, vol. 541, pp. 135–152, 2003. View at: Google Scholar
  89. L. Mosconi, R. Mistur, R. Switalski et al., “Declining brain glucose metabolism in normal individuals with a maternal history of Alzheimer disease,” Neurology, vol. 72, no. 6, pp. 513–520, 2009. View at: Publisher Site | Google Scholar
  90. T. B. Vanitallie, “Preclinical sporadic Alzheimer’s disease: target for personalized diagnosis and preventive intervention,” Metabolism: Clinical and Experimental, vol. 62, supplement 1, pp. S30–S33, 2013. View at: Publisher Site | Google Scholar
  91. Y. Liu, F. Liu, K. Iqbal, I. Grundke-Iqbal, and C. Gong, “Decreased glucose transporters correlate to abnormal hyperphosphorylation of tau in Alzheimer disease,” FEBS Letters, vol. 582, no. 2, pp. 359–364, 2008. View at: Publisher Site | Google Scholar
  92. P. Veggiotti, F. Teutonico, E. Alfei et al., “Glucose transporter type 1 deficiency: Ketogenic diet in three patients with atypical phenotype,” Brain and Development, vol. 32, no. 5, pp. 404–408, 2010. View at: Publisher Site | Google Scholar
  93. M. A. Reger, S. T. Henderson, C. Hale et al., “Effects of β-hydroxybutyrate on cognition in memory-impaired adults,” Neurobiology of Aging, vol. 25, no. 3, pp. 311–314, 2004. View at: Publisher Site | Google Scholar
  94. A. Camilleri and N. Vassallo, “The centrality of mitochondria in the pathogenesis and treatment of Parkinson’s disease,” CNS Neuroscience & Therapeutics, vol. 20, no. 7, pp. 591–602, 2014. View at: Google Scholar
  95. B. Cheng, X. Yang, L. An, B. Gao, X. Liu, and S. Liu, “Ketogenic diet protects dopaminergic neurons against 6-OHDA neurotoxicity via up-regulating glutathione in a rat model of Parkinson’s disease,” Brain Research, vol. 1286, pp. 25–31, 2009. View at: Publisher Site | Google Scholar
  96. T. B. VanItallie, C. Nonas, A. Di Rocco, K. Boyar, K. Hyams, and S. B. Heymsfield, “Treatment of Parkinson disease with diet-induced hyperketonemia: a feasibility study,” Neurology, vol. 64, no. 4, pp. 728–730, 2005. View at: Publisher Site | Google Scholar
  97. Y. S. Shin, “Glycogen storage disease: clinical, biochemical, and molecular heterogeneity,” Seminars in Pediatric Neurology, vol. 13, no. 2, pp. 115–120, 2006. View at: Publisher Site | Google Scholar
  98. E. Gazzerro, A. L. Andreu, and C. Bruno, “Neuromuscular disorders of glycogen metabolism,” Current Neurology and Neuroscience Reports, vol. 13, article 333, 2013. View at: Publisher Site | Google Scholar
  99. T. Goldberg and A. E. Slonim, “Nutrition therapy for hepatic glycogen storage diseases,” Journal of the American Dietetic Association, vol. 93, no. 12, pp. 1423–1430, 1993. View at: Publisher Site | Google Scholar
  100. S. Heller, L. Worona, and A. Consuelo, “Nutritional therapy for glycogen storage diseases,” Journal of Pediatric Gastroenterology and Nutrition, vol. 47, pp. S15–S21, 2008. View at: Publisher Site | Google Scholar
  101. T. J. Triomphe, “Glycogen storage disease: a basic understanding and guide to nursing care.,” Journal of pediatric nursing, vol. 12, no. 4, pp. 238–249, 1997. View at: Publisher Site | Google Scholar
  102. J. B. Walter, General Pathology, 1987.
  103. V. Busch, K. Gempel, A. Hack et al., “Treatment of glycogenosis type V with ketogenic diet,” Annals of Neurology, vol. 58, no. 2, article 341, 2005. View at: Google Scholar
  104. M. Vorgerd and J. Zange, “Treatment of glycogenosys type V (McArdle disease) with creatine and ketogenic diet with clinical scores and with 31P-MRS on working leg muscle,” Acta Myologica, vol. 26, no. 1, pp. 61–63, 2007. View at: Google Scholar
  105. J. M. Rho and R. Sankar, “The ketogenic diet in a pill: is this possible?” Epilepsia, vol. 49, supplement 8, pp. 127–133, 2008. View at: Publisher Site | Google Scholar
  106. P. Veggiotti and V. De Giorgis, “Dietary treatments and new therapeutic perspective in GLUT1 deficiency syndrome,” Current Treatment Options in Neurology, vol. 16, no. 5, p. 291, 2014. View at: Publisher Site | Google Scholar
  107. V. Valayannopoulos, F. Bajolle, J. Arnoux et al., “Successful treatment of severe cardiomyopathy in glycogen storage disease type III with d,l-3-hydroxybutyrate, ketogenic and high-protein diet,” Pediatric Research, vol. 70, no. 6, pp. 638–641, 2011. View at: Publisher Site | Google Scholar

Antonio Paoli, Antonino Bianco, Ernesto Damiani, and Gerardo Bosco
Department of Biomedical Sciences, University of Padova, Via Marzolo 3, 35031 Padova, ItalySport and Exercise Sciences Research Unit, University of Palermo, Via Eleonora Duse 2, 90146 Palermo, Italy
Academic Editor: Giuseppe D’Antona
Received24 Apr 2014
Accepted30 May 2014
Published03 Jul 2014
Copyright © 2014 Antonio Paoli et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.



Ketogeeninen ruokavalio ja epilepsia

Ketogeenisen ruokavalion neuroprotektiiviset ominaisuudet on tunnettu pitkään. Jo vuosisadan ajan lasten lääkeresistenttia epilepsiaa on hoidettu ketogeenisellä ruokavaliolla. Kuva ketogeenisen ruokavalion neuroprotektiivisista vaikutuksista tarkentuu jatkuvasti.

Ketogeenisen ruokavalion (KD) hyöty epilepsian ja eräiden muiden neurologisten häiriöiden terapiana hyväksytään laajalti, mutta sen kaikkia toimintamekanismeja ei täysin tunneta.

KD:n noudattaminen johtaa merkittäviin metabolisiin muutoksiin. Eräs tärkeimmistä metabolisista muutoksista on ketoosi. Toisaalta ketogeeninen ruokavalio lisää myös monityydyttämättömien rasvahappojen pitoisuutta ja laukaisee solujen puhdistusjärjestelmän, eli autofagian, joka hidastaa solujen ikääntymistä ja siivoaa soluista erilaisia kuona-aineita.

Nämä ”primaariset” vaikutukset johtavat ”toissijaisiin”, osittain adaptiivisiin vaikutuksiin, esimerkiksi muutoksiin mitokondrioiden tiheydessä ja geeniekspressiossa. Kliinisesti ruokavalion vaikutuksia pidetään epileptisiä kouristuksia estävinä ja neuroprotektiivisina.

Ketogeenisen ruokavalion aineenvaihduntamekanismien mahdollisiä kliinisiä, neuroprotektiivisia ja kognitiivisia vaikutuksia tutkitaan laajasti NASA:a ja Yhdysvaltojen puolustusministeriötä myöten.

1. Ketogeenisen ruokavalion metabolia

Ketogeenisen ruokavalion (KD) arvo epilepsian hoidossa tunnustetaan, vaikka tarkat mekanismit, joilla se vaikuttaa, ovat edelleen osin selvittämättä [1]. Ketogeenisen ruokavalion tuottamat metaboliset muutokset ovat kuitenkin erilaisia kuin epilepsialääkkeiden (AED) [2] vaikutusmekanismit. Näiden mekanismien selvittäminen voi johtaa ketogeenisen ruokavalion hyödyntämiseen myös muiden neurologisten sairauksien terapiana [3].

KD koostuu neljästä elementistä, joista minkä tahansa muutokset voivat selittää sen kouristuksia ehkäiseviä eli antikonvulsantteja vaikutuksia:

  1. lisääntynyt rasvan määrä, yleensä suhteessa 3-4 grammaa rasvaa kutakin proteiini- ja hiilihydraattigrammaa kohti
  2. mahdollisimman pieni glukoosin kulutus
  3. kalorirajoitus
  4. nesterajoitus

[1] Vaikka viimeisestä elementistä (4) on esitetty jonkin verran kritiikkiä, kliininen käytäntö on osoittanut, että nesteen rajoittamisen lopettaminen voi johtaa kohtausten uusiutumiseen hyvin samalla tavalla kuin lopetettaessa glukoosirajoitus.

KD: n noudattaminen johtaa krooniseen ketoosiin [5]. Ruokavalion noudattamisen tärkein tulos on vapaiden rasvahappojen (FFA) pitoisuuden lisääntyminen veressä. Vapaat rasvahapot (FFA) kuljetetaan mitokondrioihin, jossa ne päätyvät β -oksidatiiviseen prosessiin. Tämä β-oksidaatio, jossa vapaat rasvahapot hajotetaan ketoneiksi, edellyttää karnitiinia.

Kuva: Ketogeenisen ruokavalion metaboliset muutokset

Ketoaineisiin kuuluvat β-hydroksibutyraatti, asetoasetaatti ja asetoni [5]

1.1. Ketoaineiden merkitys

Ketoneiden (asetonin, asetoasetaatin ja beta-hydroksibutyraatin) lisääntynyt pitoisuus veressä voi olla ketogeenisen ruokavalion merkittävin epileptisiä kohtauksia hillitsevistä metabolisista vaikutuksista.

Ketoaineiden hajoaminen toimittaa asetyyli-CoA:n suoraan trikarboksyylihapposykliin, mikä tehostaa energia-aineenvaihduntaa. Samalla tämä aineenvaihduntakanava kiertää glykolyysissä syntyvän asetyylikoentsyymi-A:n tarpeen ATP:n tuotannossa.

Toisin kuin glukoosi, joka vaatii kuljettajan läpäistäkseen veri-aivoesteen, ketoaineet läpäisevät veri-aivoesteen helposti. Kun kuljetusmolekyyleistä, kuten glut 1, on puutetta, KD on suositeltava epilepsiaterapia, koska sen avulla on mahdollista kiertää solujen glukoosin tarve [1]. Lapset, joilla pyruvaatin muuntuminen asetyyli-CoA:ksi on estynyt esimerkiksi pyruvaattidehydrogenaasin (PDH) puutteessa, hyötyvät glukoosin aineenvaihduntareitin ohittamisesta [3].

β-hydroksibutyraatti on veressä mitattavista ketoneista hallitseva ketoaine, ja sitä käytetään ketoosin asteen seuraamiseen terapian aikana. Beta-hydroksibutyraatin hajoaminen johtaa lisääntyneeseen asetonin tuotantoon [6].

Asetoni on yksi ketoaineista, joilla on kouristuksia hillitsevä, eli antikonvulsanttinen vaikutus erilaisissa hiirien kliinisissä kohtausmalleissa [7]. Tämän vaikutusmekanismia ei tunneta, vaikka vaikutusta K2p-kanaviin pidetään mahdollisena [5]. TCA-syklin (sitruunahappokierron) avulla asetyyli-CoA lisää hermovälittäjäaineiden glutamaatin ja gamma-aminovoihapon (GABA) ja vastaavasti tärkeimpien aivojen eksitatoristen ja estävien välittäjäaineiden määrää aivoissa.

Gamma-aminovoihappo eli GABA on tärkein aivojen ja muun keskushermoston hermosolujen toimintaa jarruttava välittäjäaine. GABA:n välittämä viesti on luonteeltaan inhibitorinen eli vaimentava tai lamaava: GABA välittää hermosolulle käskyn vähentää toimintaa tai lopettaa toimintansa. Noin 40 % aivosoluista reagoi gamma-aminovoihapon inhibitoriseen vaikutukseen. Yksittäisissä neuroneissa GABAn vaikutus voi olla myös eksitoiva eli kiihdyttävä. Elimistön tärkein kiihottava välittäjäaine, GABA:n vastavaikuttaja, on glutamaatti.
GABA:n nauttiminen lisää kasvuhormonin ja prolaktiinin synteesiä. GABA voi auttaa nukahtamisvaikeuksista kärsiviä ja parantaa unen laatua.
GABA- eli gamma-aminovoihapporeseptoreita on kahta päätyyppiä; GABAA ionikanavareseptori ja GABAB G-proteiinikytkentäinen reseptori. GABAC tunnetaan nykyään GABAA-rho reseptorina. Myös reseptorien alatyyppejä tunnetaan.
Monet rauhoittavat lääkeaineet kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta aiheuttaen hermoratojen toiminnan epäspesifiä, yleistynyttä hidastumista. Bentsodiatsepiiniryhmään kuuluvat lääkeaineet sitoutuvat bentsodiatsepiinireseptoreihin, GABAA-reseptorin alatyyppiin aiheuttaen positiivisen allosteerisen modulaation johtaen kloridikavanan avautumistaajuuden kiihtymiseen. Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön. Tässä on syy barbituraattien myrkyllisyyteen bentsodiatsepiineihin verrattuna yliannostustapauksissa. Näitä reseptoreita on sekä aivoissa että sisäelimissä.
Myös monet epilepsialääkkeet (esimerkiksi valproaatti, vigabatriini, gabapentiini ja topiramaatti) tehostavat elimistön oman GABA:n vaikutusta.
Baklofeeni (Baclon, Baclopar, Lioresal) on GABAB-agonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat. Baklofeenista voi olla apua dystoniaan.
GABA:n puute voi aiheuttaa ahdistuneisuutta, masentuneisuutta ja epileptisiä kohtauksia.
GABA transaminaasi entsyymi katalysoi gamma-aminovoihapon ja 2-oksoglutaraatin muuntumista sukkiinisemialdehydiksi ja glutamaatiksi. Sukkiinisemialdehydin taas hapettaa sukkiinihapoksi sukkiinisemialdehydi dehydrogenaasientsyymi, ja sen jälkeen se on käypä energianlähde sitruunahappokierrossa. – Wikipedia

GABAn lisääntynyt vaikutus keskushermostossa voi selittää ketogeenisen ruokavalion kouristuksia hillitsevää vaikutusta[5].

1.2. Monityydyttymättömien rasvahappojen (PUFA) merkitys

Vapaiden rasvahappojen lisääntymisen seurauksena on monityydyttymättömien rasvahappojen (PUFA) pitoisuuden kasvu.

PUFA:n potentiaalinen kyky estää kohtauksia aivoissa saattaa liittyä melko monimutkaisiin mekanismeihin, kuten:

  1. sähköisen jännitteen rajoittamien natrium- ja kalsiumkanavien estäminen
  2. lipidille herkän kaliumkanavan aktivointi
  3. hermosolujen stimulaatiota rajoittavan natriumpumpun aktiivisuuden tehostaminen
  4. peroksisomiproliferaattorilla aktivoituvan reseptori-a:n (PPARa) aktivoiminen
  5. PUFA indusoi aivospesifisten irrotusproteiinien ilmentymistä ja aktiivisuutta mitokondrioissa, vaikuttaen siten neuroprotektiivisesti

[5]. Tämä viimeinen vaikutus toimii rajoittamalla reaktiivisten happiradikaalien (ROS) syntymistä.

1.3. Bioenergetiikka ja neuroprotektiivinen

Ketogeenistä ruokavaliota on ensisijaisesti pidetty epileptisia kouristuksia ehkäisevänä. KD-ruokavalion tutkimukset viittaavat paljon laajempiin ja monimutkaisempiin nuroprotektiivisiin vaikutuksiin.

Neuroprotektiivisuus voi vaikuttaa antikonvulsanttisesti (kouristuksia ehkäisevästi), mutta sillä on myös muita merkittäviä metabolisia vaikutuksia [3]. Kaiken kaikkiaan KD:n noudattaminen lisää ja tehostaa energian tuotantoa aivoissa. Appleton ja De vivo [8] kertoivat, että KD lisäsi bioenergeettisten substraattien (adenosiinitrifosfaatti (ATP)) kokonaismäärää ja nosti energian varausta rottien aivoissa.

Asetoasetaatti, beta-hydroksibutyraatin dehydraustuote, muutetaan asetyylikoentsyymi-A:ksi, joka kulkeutuu trikarboksyylihapposykliin (TCA), eli sitruunahappokiertoon.

Asetyylikoentsyymi-A eli aktiivinen etikkahappo on kaikille ravintoaineille yhteinen välituote solun valmistaessa energiaa. Asetyylikoentsyymi-A:ta saadaan monosakkarideista, triglyserideistä sekä aminohapoista erilaisten reaktiovaiheiden kautta.

Asetyylikoentsyymi-A:n asetyyliryhmän hiilet (C) hapettuvat hiilidioksidiksi TCA-syklissä ja vedyt (H) siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, esimerkiksi ATP:ksi.

Solujen energialähteinä toimivat ensi sijassa hiilihydraatit ja rasvahapot, mutta muitakin molekyylejä esimerkiksi aminohappoja voidaan käyttää. Aminohappojen käyttö energialähteenä on tosin normaalitilanteissa vähäistä.

Glukoosi hajoaa glykolyysissä kahdeksi pyruvaatiksi, joista edelleen molemmista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta. Jos taas happea (O) ja mitokondrioita ei ole tarpeeksi saatavilla, pyruvaatti pelkistyy edelleen maitohapon anioniksi laktaatiksi. Rasvahapot hajoavat pääasiassa hapettumalla β-oksidaatiossa niin, että rasvahappoketjusta irtoaa kahden hiilen asetyyliryhmiä, jotka ovat kiinnittyneenä reaktioon osallistuvaan koentsyymi-A:han.

TCA-syklin lisääntynyt energiatuotanto tuottaa protoneja ja elektroneja, jotka kanavoituvat elektronien siirtoketjuun. Tämä puolestaan lisää ATP:n muodostumista adenosiinidifosfaatista (ADP) ATP-syntaasin avulla.

ATP voidaan joko muuttaa fosfokreatiiniksi energian varastointia varten tai hajottaa adenosiiniksi. Lisääntyneet ATP-tasot tarjoavat energiavaroja hermosolun toiminnan ylläpitämiseksi myös silloin, kun solun glukoosinotto on häiriintynyt. Lisääntynyt solunulkoinen adenosiini toimii eräänlaisena neuroprotektiivisena puskurina laskemalla jännitettä ja estämällä siten paikallisia kohtauksia [6].

On myös arveltu, että KD vaikuttaa energiametaboliaentsyymejä koodaavien transkriptiotekijöiden säätelyyn (ylösregulointiin) ja mitokondrioiden tiheyden lisääntymiseen hermosoluissa, mikä johtaa kasvaneisiin energiavarastoihin.

Energian saannin helpottuminen voi tukea kohtausten ehkäisemistä esimerkiksi tukemalla GABAergistä estoa [9].

Wikipedia:Aivojen välittäjäaineet ovat kemiallisia välittäjämolekyylejä, jotka välittävät (eksitoivat, inhiboivat tai moduloivat) signaaleja aivojen hermosolujen eli neuronien välillä. Eksitoiva välittäjäaine kiihdyttää, inhiboiva välittäjäaine jarruttaa aivotoimintaa. Välittäjäaineet eli neurotransmitterit siirtyvät neuronien välillä synapseissa.

Keskushermoston eli aivojen ja selkäytimen tärkeimpiä neurotransmittereita ovat aminohapot. Noin 80–90 prosentissa keskushermoston synapseista välittäjäaineena toimii aminohappo, 5–10 prosentissa amiini ja 1–2 prosentissa peptidi.

Aivoissa tärkeitä aminohappotransmittereita ovat muun muassa glutamaatti ja glysiini, joista edellinen saattaa olla aivojen tärkein kiihdyttävä välittäjäaine. Glutamaatilla on kolmentyyppisiä reseptoreita. Ne on nimetty niille suhteellisen spesifien agonistien mukaan N-metyylidekstroaspartaatti (NMDA)-, kainaatti- ja 1-amino-3-hydroksi-5-metyyli-iso-oksatsoli-4-propionaatti (AMPA)-reseptoreiksi; mahdollisesti on olemassa muunkin tyyppisiä reseptoreita.

Gamma-aminovoihappo eli γ-aminovoihappo eli GABA on tärkein aivojen toimintaa jarruttava välittäjäaine. Jopa yli kolmasosa aivojen synapseista on GABAergisiä. GABA:lla on monia reseptoreita, esimerkiksi GABAA ja GABAB. Glutamaatti ja GABA muodostavat ikään kuin eksitoiva/inhiboiva välittäjäaineparin aivoissa.

Aminohapoista yksinkertaisin eli glysiini toimii inhibitorisena välittäjäaineena keskushermostossa. Sen reseptoreita löytyy etupäässä selkäytimestä. Glysiinin välittäjäaineparina etupäässä selkäytimen alueella toimii eksitoiva aminohappo aspartaatti. Asetyylikoliinin vaikutus aivokuorella ja hippokampuksessa on pääosin eksitoiva; myös inhibitiota saattaa esiintyä, mutta se on liitetty viereisten inhiboivien GABAergisten solujen aktivaatioon.

Alzheimerin taudissa asetyylikoliiniradat isoaivokuorelle ja hippokampukseen vaurioituvat, mikä aiheuttaa dementian. Noradrenaliinia on runsaasti aivorungon pienissä locus coeruleus -tumakkeissa, joista lähtevät aksonit haarautuvat eri tahoille, muun muassa hypotalamukseen, pikkuaivoihin ja isoaivokuorelle. Noradrenaliini osallistuu muun muassa vireystilan säätelyyn.

Dopamiinia sisältäviä neuroneja on runsaasti erityisesti keskiaivoissa substantia nigran ja tegmentumin tienoilla. Näiden aksonit haarautuvat laajalle alueelle. Aivoissa on neljä dopaminergista päärataa: mesokortikaalinen, mesolimbinen, nigrostriataalinen ja tuberoinfundibulaarinen. Nigrostriataalisen radan tuhoutuessa ilmentyy Parkinsonin tauti.

Skitsofrenian ajatellaan johtuvan mesokortikaalisen ja mesolimbisen radan dopamiinin D2-reseptorien ylistimuloitumisesta. Serotoniinia eli 5-hydroksitryptamiinia sisältävien hermosolujen soomaosista suurin osa sijaitsee ydinjatkoksen keskiviivalla olevassa raphe-tumakkeessa. Näiden neuronien aksonit ulottuvat aivojen kaikkiin osiin. Serotoniini osallistuu muun muassa tunne-elämän, muistin, syömiskäyttäytymisen ja ruumiinlämmön säätelyyn.

Histamiinia on ennen muuta hypotalamuksen corpora mamillare -alueella olevissa neuroneissa, jotka projisoituvat useimpiin aivojen osiin. Keskushermostossa histamiini osallistuu muun muassa neuroendokriiniseen säätelyyn, uni-valverytmin, vireystilan ja ruokahalun säätelyyn. Edellä mainittujen välittäjäaineiden lisäksi aivoissa vaikuttaa muun muassa suuri määrä erilaisia neuropeptidejä.

Merkittävimmät

Muut

On esitetty hypoteesi, jonka mukaan metaboliset sopeutumisprosessit ruokavalion aiheuttamiin muutoksiin aiheuttaa muutoksia geeniekspressiossa, mikä puolestaan johtaa joihinkin edellä mainituista muutoksista. Muu neuroprotektiivinen polku moduloidaan vähentämällä reaktiivisten happiradikaalien muodostumista, jonka katsotaan liittyvän monityydyttämättömien rasvahappojen vaikutukseen solujen irrotettavissa proteiineissa [5].

1.4. Ketogeenisen ruokavalion muita kliinisiä etuja

Ketogeenistä ruokavaliota pidetään todistetusti toimivana terapiamuotona, jolla on hyvin vähän haitallisia vaikutuksia. Laaja KD-terapiaa tukeva kliininen näyttö erityisesti lapsilla esiintyvän epilepsian hoitona on johtanut viimeaikaisiin laajempiin tutkimuksiin ketogeenisen ruokavalion metabolisista hyödyistä esimerkiksi neurodegeneratiivisten sairauksien hoidossa[3].

Eräs mielenkiintoisimmista ja aktiivisimmista tutkimusalueista on runsaasti rasvaa sisältävän kaloripitoisen ruokavalion vaikutus aivokasvainsolujen selviytymiseen. Aivosyöpäsoluilla on rajoitettu metabolinen joustavuus. Ne ovat hyvin riippuvaisia glukoosimetaboliasta.

Mitokondrioiden poikkeavuudet heikentävät aivokasvainten kykyä tuottaa energiaa ketoaineista. Toisin kuin normaaleissa soluissa, pahanlaatuisilla kasvainsoluilla on heikentynyt geneettinen sopeutumiskyky muuttuviin energiasubstraatteihin. Niiden energiansaanti rajoittuu lähinnä glukoosiin, minkä vuoksi paasto, niukkaenerginen ruoka ja ketogeeninen ruokavalio heikentävät syöpäsoluja. Näitä samoja aivokasvainten kehittymiseen liittyviä geneettisiä vikoja voidaan hyödyntää pahanlaatuisten solujen tuhoamisessa [3, 10, 11].

Vuonna 1995 Nebeling et al. [12] raportoi kahdesta nuoresta tytöstä, joilla oli pitkälle edennyt aivokasvain. Tyttöjen syövät reagoivat heikosti sädehoitoon ja kemoterapiaan. Lopulta tyttöjä päätettiin hoitaa ketogeenisella ruokavaliolla. Heidän vasteensa KD-hoidolle oli merkittävä sekä kliinisesti että positroniemissiotomografian seurantatutkimusten mukaan.

Zuccoli et al. [13] kuvasi potilasta, jolla oli erittäin pahanlaatuinen multippeli glioblastoma ( kasvain), joka parani ketogeenisella ruokavaliolla. Hullua kyllä, hoidon houkuttelevasta tehokkuudesta ja hyvistä alustavista tuloksista huolimatta aivokasvainten hoitoa ketogeenisellä ruokavaliolla ei ole sittemmin kliinisesti tutkittu ihmisillä. Miksi?

Useat hiiri- ja rotamalleilla tehdyt laboratoriotutkimukset ovat äskettäin vahvistaneet, että aivokasvaimen kasvun estyminen liittyy suoraan alentuneisiin glukoosipitoisuuksiin ja kohonneisiin ketoaineiden pitoisuuksiin. Lisäksi KD:n osoitettiin vähentävän aivojen reaktiivisia happiradikaaleja (ROS) [5].

Syöpäsolut tarvitsevat korkeita ROS-tasoja angiogeneesin indusoimiseksi ja kasvainten kasvutekijöiden tuottamiseksi [11], joten tämä mekanismi selittää KD:n vaikutusta.

Esimerkki:

12-vuotiaalla tytöllä todettiin keskushermostoon vaikuttava neurokutaaninen melanoosi Kasvain oli erittäin pahanlaatuinen ja eteni nopeasti. Kliiniset oireet olivat pääasiassa vaikeita kohtauksia, jotka edellyttivät toistuvaa pääsyä tehohoitoyksikköön sekä kohtausten lisäksi vakavia kognitiivisia ja valppauteen liittyviä oireita. Kun onkologit päättivät, että kasvainten vastainen hoito olisi tehotonta, tyttöä ryhdyttiin hoitamaan ketogeenisella ruokavaliolla. Neljän viikon kokeilun jälkeen KD:llä ei ollut mitään vaikutusta kasvaimen etenemiseen. Kohtausten taajuus ja vakavuus parani, mutta häntä hoidettiin samanaikaisesti AED:n kanssa. Ketogeenisellä ruokavaliolla oli kuitenkin huomattava parantava vaikutus tytön kognitioon, valppauteen ja mielialaan sairauden vakavuudesta ja etenemisestä huolimatta.

KD:n myönteinen vaikutus kognitioon, valppauteen ja mielialaan tunnetaan hyvin [1]. Tämä voi olla erityisen tärkeää nuorten vakavien kasvainten etenevissä vaiheissa. KD:n mahdollinen neuroprotektiivinen vaikutus motivoi tutkimuksia sen potentiaalista hoitovaihtoehtona muissa neurologisissa häiriöissä [3].

Yhä useammat eläintutkimukset osoittavat, että paastolla ja ketogeenisellä ruokavaliolla saavutetulla ketoosilla on selkä ja johdonmukainen neuroprotektiivinen vaikutus erilaisisten aivovaurioiden jälkeen.

Yksi ihmisillä toteutettu pienimuotoinen pilottitutkimus ja useat eläinmallitutkimukset ovat osoittaneet autististen käyttäytymisparametrien parantuneen KD-hoidolla. Vielä on selvitettävä, liittyykö tämä vähentyneeseen epileptiseen aktiivisuuteen, jota havaitaan jopa 30%: lla näistä potilaista, vai KD:n ensisijaiseen vaikutukseen [3]. Tämä tekijä, joka voi olla ratkaiseva KD:n soveltamiselle muiden neurologisten häiriöiden hoitoon, kuin kuin vaikeasti hoidettava epilepsia [14].

Yhteenvetona voidaan todeta, että ketogeenisen ruokavalion pääasiallinen metabolinen vaikutus on aivojen energiansaannin turvaaminen vapailla rasvahapoilla. Niiden hajoaminen ketoaineiksi yhdessä PUFA-yhdisteiden lisääntymisen kanssa johtaa merkittäviin muutoksiin aineenvaihdunnan, bioenergian, mitokondrioiden ja jopa geenien toiminnassa. Näillä primaarisilla ja sekundaarisillä muutoksilla on kouristuksia estäviä ja neuroprotektiivisia vaikutuksia. KD on merkittävä osa lasten epileptologien terapiavaihtoehtoja. Onko ketogeeninen ruokavalio yhtä tehokas hoitoväline myös neurodegeneratiivisten tautien, kuten Parkinsonin ja Alzheimerin taudin hoidossa ja muissa patologioissa, kuten pahanlaatuisten kasvainten hoidossa? Tätä tutktitaan. Tulokset tämän artikkelin julkaisun (2011) jälkeen ovat olleet hyvin lupaavia.

Viitteet

  1. A. L. Hartman and E. P. G. Vining, “Clinical aspects of the ketogenic diet,” Epilepsia, vol. 48, no. 1, pp. 31–42, 2007. View at: Publisher Site | Google Scholar
  2. A. L. Hartman and J. M. Freeman, “Does the effectiveness of the ketogenic diet in different epilepsies yield insights into its mechanisms?” Epilepsia, vol. 49, supplement 8, pp. 53–56, 2008. View at: Publisher Site | Google Scholar
  3. K. W. Barañano and A. L. Hartman, “The ketogenic diet: uses in epilepsy and other neurologic illnesses,” Current Treatment Options in Neurology, vol. 10, no. 6, pp. 410–419, 2008. View at: Publisher Site | Google Scholar
  4. E. C. Wirrell, “Ketogenic ratio, calories, and fluids: do they matter?” Epilepsia, vol. 49, supplement 8, pp. 17–19, 2008. View at: Publisher Site | Google Scholar
  5. K. J. Bough and J. M. Rho, “Anticonvulsant mechanisms of the ketogenic diet,” Epilepsia, vol. 48, no. 1, pp. 43–58, 2007. View at: Publisher Site | Google Scholar
  6. S. A. Masino, M. Kawamura, C. A. Wasser, L. T. Pomeroy, and D. N. Ruskin, “Adenosine, ketogenic diet and epilepsy: the emerging therapeutic relationship between metabolism and brain activity,” Current Neuropharmacology, vol. 7, no. 3, pp. 257–268, 2009. View at: Publisher Site | Google Scholar
  7. N. Hasebe, K. Abe, E. Sugiyama, R. Hosoi, and O. Inoue, “Anticonvulsant effects of methyl ethyl ketone and diethyl ketone in several types of mouse seizure models,” European Journal of Pharmacology, vol. 642, pp. 66–71, 2010. View at: Publisher Site | Google Scholar
  8. D. B. Appleton and D. C. De Vivo, “An experimental animal model for the effect of ketogenic diet on epilepsy,” Proceedings of the Australian Association of Neurologists, vol. 10, pp. 75–80, 1973. View at: Google Scholar
  9. K. Bough, “Energy metabolism as part of the anticonvulsant mechanism of the ketogenic diet,” Epilepsia, vol. 49, supplement 8, pp. 91–93, 2008. View at: Publisher Site | Google Scholar
  10. B. T. Seyfried, M. Kiebish, J. Marsh, and P. Mukherjee, “Targeting energy metabolism in brain cancer through calorie restriction and the ketogenic diet,” Journal of Cancer Research and Therapeutics, vol. 5, supplement 1, pp. S7–15, 2009. View at: Google Scholar
  11. P. Stafford, M. G. Abdelwahab, D. Y. Kim, M. C. Preul, J. M. Rho, and A. C. Scheck, “The ketogenic diet reverses gene expression patterns and reduces reactive oxygen species levels when used as an adjuvant therapy for glioma,” Nutrition and Metabolism, vol. 7, article 74, 2010. View at: Publisher Site | Google Scholar
  12. L. C. Nebeling, F. Miraldi, S. B. Shurin, and E. Lerner, “Effects of a ketogenic diet on tumor metabolism and nutritional status in pediatric oncology patients: two case reports,” Journal of the American College of Nutrition, vol. 14, no. 2, pp. 202–208, 1995. View at: Google Scholar
  13. G. Zuccoli, N. Marcello, A. Pisanello et al., “Metabolic management of glioblastoma multiforme using standard therapy together with a restricted ketogenic diet: case report,” Nutrition & Metabolism, p. 33, 2010. View at: Publisher Site | Google Scholar
  14. J. H. Cross, A. Mclellan, E. G. Neal, S. Philip, E. Williams, and R. E. Williams, “The ketogenic diet in childhood epilepsy: where are we now?” Archives of Disease in Childhood, vol. 95, no. 7, pp. 550–553, 2010. View at: Publisher Site | Google Scholar

Keren Politi, Lilach Shemer-Meiri, Avinoam Shuper, and S. Aharoni, Department of Pediatric and Adolescent Neurology, Schneider Children’s Medical Center of Israel, Faculty of Medicine, Tel Aviv University, Tel Aviv, Israel

Copyright © 2011 Keren Politi et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

https://www.hindawi.com/journals/ert/2011/963637/




Solujen puhdistusjärjestelmä – autofagosytoosi

Virtuaalisessa rinnakkaistodellisuudessa kierot käärmeöljykauppiaat kauppaavat pitkää ikää ja terveitä elinvuosia erilaisilla detox-kuureilla, jotka voivat perustua mihin tahansa parsa- tai hopeaveden ja tislatun veden välillä. Jotkin näistä ovat parhaimmillaankin terveyden kannalta neutraaleja, mutta osa kuureista on hengenvaarallisia.

Vaikeisiin ongelmiin ei ole helppoja ratkaisuja. On kuitenkin menetelmä, joka kasvavan tieteellisen tutkimusaineiston perusteella puhdistaa elimistöstä haitallisia ja myrkyllisiä partikkeleita. Se on tehokas ja vieläpä täysin maksuton.

Autofagosytoosi on prosessi, jossa solut kierrättävät vaurioituneita, sairastuneita ja ikääntyneitä solujen osia energiaksi ja uusiksi soluelimiksi.

Toimiva autofagosytoosi on avainasemassa hyvän terveyden ja pitkäikäisyyden kannalta. Kun solut vaurioituvat pysyvästi esimerkiksi tulehduksissa ja ikääntyessään, elimistöön kertyy nopeasti toimimattomia ja haitallisia solunosia, jotka pitää korjata tai siivota elimistöstä.

Autofagosytoosi on soluissa tarkasti säädelty prosessi, jossa lysosomaaliset entsyymit hajottavat solun omia rakenneosia, solulimaa ja soluelimiä (esim. mitokondrioita) kalvon ympäröimissä autofagosomeiksi kutsutuissa rakenteissa.

Autofagosomi


Autofagosomi on pallomainen rakenne, jossa on kaksikerroksiset kalvot. Se on avainrakenne
makroautofagiassa, solunsisäisessä hajoamisjärjestelmässä sytoplasman sisällölle, jossa:

  • epänormaalit solunsisäiset proteiinit
  • ylimääräiset tai vaurioituneet organellit
  • mikro-organismit

kierrätetään soluissa ja käytetään solujen uusien rakenteiden osiksi tai ravinnoksi.

Muodostumisen jälkeen autofagosomit toimittavat sytoplasman komponentit lysosomeihin. Autofagosomin ulkokalvo sulautuu lysosomiin muodostaen autolysosomin. Lysosomin hydrolaasit hajottavat autofagosomista vapautuneen sisällön ja sen sisemmän kalvon.

Autofagosomien muodostumista säätelevät eräät geeniperheet, jotka aiemmin tunnettiin nimellä APG, AUT, CVT, GSA, PAZ ja PDD. Geeniperheet on yhdistetty ATG-perheeksi (AuTophaGy related).

Joissakin soluissa, kuten alkion kantasoluuissa, alkion fibroblasteissa ja maksasoluissa, autofagosomit voidaan nähdä renkaanmuotoisina rakenteina valomikroskopialla.

Aluksi autofagosomit sulautuvat endosomeihin tai endosomista peräisin oleviin rakkuloihin. Näitä rakenteita kutsutaan sitten amfisomeiksi tai välituotteiksi autofagisiksi vakuoleiksi. Nämä rakenteet sisältävät endosyyttisiä markkereita, jopa pieniä lysosomaalisia proteiineja, kuten katepsiini D.

Tutkimuksissa on saatu vahvaa näyttöä siitä, että autofagosytoosin virheellinen toiminta on yksi vanhenemisen tärkeimmistä mekanismeista. Tämän järjestelmän löytäminen on johtanut täysin uuteen biologian tutkimusalaan. Autofagosytoosin virheellisen toiminnan korjaaminen on esimerkiksi pidentänyt koe-eläinten elinikää huomattavasti.

Jo 1930-luvulla havaittiin, että normaalia vähemmän energiaa saaneiden rottien elinikä venyi kolmanneksen pidemmäksi kuin normaalin energiamäärän saaneilla lajitovereilla. Vähemmän energiaa saaneet rotat osoittautuivat uteliaammiksi, oppimiskykyisemmiksi ja aktiivisemmiksi kuin normaalisti tai runsaasti ravintoa saaneet rotat. Syytä ilmiölle ei kuitenkaan osattu selittää.

Autofagosytoosin tunnisti japanilainen Joshinori Osumi vasta 1990-luvulla. Vuonna1996 hänet palkittiin löydöstä Nobelin lääketieteen palkinnolla.

Autofagosytoosi yhdessä muiden selviytymismekanismien, ketogeneesin, glukoneogeneesin ja perusaineenvaihdunnan energiankulutuksen vähentämisen kanssa mahdollistaa ihmisen selviytymisen hengissä pitkään ilman ravintoa. Autofagosytoosissa elimistö ”kannibalisoi” sairastuneita soluja ja jäännösproteiineja” tyydyttääkseen solujen energiatarpeen.

Monet sairaudet, kuten Parkinsonin tauti ja jotkut syövät aiheutuvat autofagosytoosin puutteellisesta toiminnasta. Vaikka solujen oli jo aiemmin tiedetty kierrättävän omaa materiaaliaan, vasta Yoshinori Osumi 1990-luvulla määritteli tarkasti geenit ja metaboliareitit, joiden kautta kierrätys tapahtuu. Osumin työstä lähti kokonaan uusi biologian haara, joka selvittää, miten elimistömme käyttää ”itse-kannibalismia” terveenä pysymiseen.

Mitä autofagiasta (autofagosytoosista) pitäisi tietää?


Columbian yliopiston tohtori Priya Khoronan mukaan autofagosytoosi on kehon tapa puhdistaa vahingoittuneet solut uudempien, terveempien solujen regeneroimiseksi.

”Auto” tarkoittaa itseä ja ”phagy” tarkoittaa syödä. Joten autofagian kirjaimellinen merkitys on ”itse syöminen”.

Vaikka itsensä kannibalisoiminen voi kuulostaa pelottavalta, autofagosytoosi on todella hyödyllistä yleiselle terveydelle. Tämä johtuu siitä, että autofagia on evoluution kehittämä suojamekanismi, jonka avulla keho voi poistaa sairastuneet solut ja kierrättää niiden osat kohti solujen korjaamista ja puhdistamista, kertoo kardiologin tohtori Luiza Petre.

Petre kertoo, että autofagian tarkoitus on kierrättää roskat ja säädellä solujen toiminta optimaaliseksi. ”Se on kierrätystä ja puhdistusta samaan aikaan. Lisäksi se siivoaa erilaisia soluihimme kertyneitä stressitekijöijöitä ja toksiineita”.

Autofagosytoosin terveysvaikutukset


Autofagosytoosin tärkein etu näyttää olevan
anti-aging, eli solujen ikääntymisen hidastaminen. Petre kertoo, että tämä mekanismi tunnetaan parhaiten kehon tapana kääntää kelloa ikään kuin taaksepäin rakentamalla nuorempia ja terveempiä soluja.

Khorana huomauttaa, että kun solumme ovat stressaantuneita, autofagia tehostuu, mikä suojelee soluja ja auttaa pidentämään elinikää. Rekisteröity ravitsemusterapeutti, Scott Keatley, RD, CDN, kertoo, että nälässä ja paastotilassa autofagia pitää kehon toiminnassa hajottamalla solumateriaalia ja kierrättämällä sitä solujen uusiutumiseen ja energiantarpeen tyydyttämiseen.

Solutasolla autofagian (autofagosytoosin) etuja ovat erityisesti:

  • myrkyllisten proteiinien poistaminen soluista (tällaiset myrkyllisten proteiinien kasaumat keskushermoston soluissa aiheuttavat neurodegeneratiivisia sairauksia, kuten Parkinsonin ja Alzheimerin tautia).
  • jäännösproteiinien kierrätys
  • energiaa ja rakennuspalikoita soluille
  • vanhojen ja sairaiden solujen uusiminen ja korvaaminen terveillä soluilla

Autofagia on viime aikoina saanut paljon huomiota erityisesti siksi, että virheellisesti toimiva autofagosytoosi näyttelee keskeistä osaa pahanlaatuisten syöpäkasvainten kehittymisessä. Autofagosytoosin korjaaminen voi osoittautua syövän ehkäisyssä ja hoidossa merkittäväksi terapiavaihtoehdoksi.

Autofagosytoosi heikkenee ikääntymisen seurauksena. Soluihin kerääntyy enemmän kuona-ainetta, jota solut eivät pysty siivoamaan, mikä johtaa sairastuneisiin ja puutteellisesti toimiviin soluihin. Toimimattomat ja vahingolliset solut pääsevät rauhassa lisääntymään, mikä on syöpäsolujen modus operandi (MO)”.

Kaikki syövät alkavat jonkinlaisista viallisista soluista. Kehon tulisi tunnistaa ja poistaa nämä viallisesti toimivat solut käyttämällä autofagisia prosesseja. Tällä hetkellä tutkitaan, voiko autofagosytoosi vähentää syöpäriskiä tai jopa auttaa ehkäisemään syövän leviämistä.

Vaikka tästä ei ole vielä riittävästi tieteellistä näyttöä, Jotkut tutkimukset viittaavat siihen, että monet syöpäsolut voidaan poistaa autofagosytoosissa. Virheellisesti toimivien solujen tunnistaminen ja tuhoaminen sekä korjausmekanismin käynnistäminen auttavat vähentämään syöpäriskiä. Tutkijat uskovat, että uudet tutkimukset johtavat terapiaan, joka auttaa lääkäreitä kohdentamaan autofagosytoosia syöpähoitona.

Tutkimuksissa autofagosytoosi on yhdistetty moniin terveysvaikutuksiin. Autofagosytoosi tunnetaan kuitenkin vielä sen verran huonosti, että liian pitkälle meneviä johtopäätöksiä ei kannata tehdä. Autofagosytoosin soluprosessit ovat monimutkaisia ja vaikeasti havainnoitavia.

Vuonna 2019 tehdyssä tutkimuksessa seurattiin autofagosytoosin vaikutuksia syöpäsoluihin. Tutkimus osoitti, että vaikka autofagosytoosi voi estää syöpäsolujen kehittymisen, se voi myös edistää niiden kasvua kasvaimen vaiheesta riippuen.

Tutkijoita kiinnostaa myös autofagian ja maksan terveyden yhteys. Tänä vuonna ilmestyneessä tutkimuskatsauksessa tutkittiin tapoja, joilla autofagosytoosi voi auttaa suojaamaan maksasoluja lääkkeiden ja alkoholin aiheuttamilta maksavaurioilta.

Muissa tutkimuksissa on havaittu, että autofagosytoosi vaikuttaa monissa maksan toiminnoissa. Se voi estää useiden maksasairauksien, kuten Wilsonin taudin, akuutin maksavaurion, alkoholista riippumattoman rasvamaksan ja kroonisen alkoholiin liittyvän maksasairauden etenemisen.

Suurin osa autofagiaa koskevista tutkimuksista on kuitenkin tehty laboratorioissa in vitro (kirjaimellisesti ”lasissa”; in vitro on tutkimustekniikka, jossa koe suoritetaan koeputkessa, lasimaljassa tai yleisesti eliön tai solun ulkopuolella) tai eläinkokeissa.

Autofagosytoosilla näyttää olevan keskeinen rooli immuunijärjestelmän toiminnassa. Autofagosytoosi puhdistaa soluista toksiineja ja tartuntatauteja. On todisteita siitä, että autofagosytoosi voi parantaa infektio- ja neurodegeneratiivisia sairauksia sairastavien solujen terveyttä kontrolloimalla tulehdusta.

Toinen tutkimuskatsaus havaitsi, että autofagosytoosi auttaa suojaamaan soluja soluun tunkeutuvilta mikrobeilta. Vaikka autofagosytoosin vaikutusta soluihin on tutkittu paljon, tutkijat eivät ole vielä varmoja siitä, voisiko autofagosytoosi toimia hoitona erilaisille sairauksille. Eläinmalleista saadun näytön perusteella ketoosin indusoima autofagosytoosi yhdessä sädehoidon kanssa poisti täysin hiiren syöpäkasvaimen. On kuitenkin liian varhaista sanoa, toimiiko sama ihmisillä.

Ruokavalion muutokset, jotka voivat tehostaa autofagosytoosia

Autofagosytoosi tarkoittaa kirjaimellisesti ”itsensä syömistä”. Tämän kannibalistisen prosessin voi käynnistää helposti pätkäpaastolla, paastolla ja ketogeenisellä ruokavaliolla.

”Paasto on tehokkain tapa autofagosytoosin käynnistämiseksi.”, Petre kertoo. ”Ketogeeninen, eli runsasrasvainen ja vähän hiilihydraatteja sisältävä ruokavalio tuottaa samat edut kuin paasto ilman ravinnon välttelyä, koska ketoosi imitoi paastoa aineenvaihdunnan tasolla.

Kun kehoa ei rasiteta ulkoisella kuormituksella kellon ympäri, keholle jää aikaa korjata viallisia soluja. Esimerkiksi jatkuvan syömisen aiheuttama glukoosi-insuliini-glukagoni-glukoosi-insuliini-glukagoni-kierre pitää elimistön ylikierroksilla lähes ympäri vuorokauden.

Korkea verensokeri ja hyperinsulinemia vaurioittavat verisuonia ja elimiä. Vähitellen hyperglykemia ja hyperinsulinemia johtavat solujen insuliiniherkkyyden heikentymiseen, eli insuliiniresistenssiin, joka on käytännössä kaikkien elintapasairauksien yhteinen nimittäjä.

Insuliiniresistentit solut eivät saa riittävästi energiaa veren korkeasta glukoosipitoisuudesta huolimatta, joten solut alkavat surkastua ja kuolla. Kun luurankolihasten ja elinten solut eivät ota glukoosia riittävästi vastaan, glukoosi ohjataan rasvasoluihin, jossa se muutetaan triglyserideiksi, eli läskiksi. Osa glukoosista voi glykatoitua proteiinien ja rasvahappojen kanssa, jolloin verisuoniin muodostuu siirappimaisia glykaation lopputuotteita (AGE), jotka edelleen kasvattavat sairastumisen riskiä.

Hyperglykemia, hyperinsulinemia, viallisesti toimiva autofagosytoosi ja glykaatio kietoutuvat vahvasti toisiinsa erityisesti glukoosin välityksellä. Korkea verensokeri on yhteinen nimittäjä, joka luo metabolisesti suotuisan ympäristön monille elintapasairauksille sydän- ja verisuonitaudeista syöpiin. Korkea verensokeri ylläpitää korkeaa insuliinitasoa, estää autofagosytoosia ja altistaa glykaatiolle. Hyperinsulinemia altistaa insuliiniresistenssille ja estää laihtumista. Autofagosytoosin estyminen altistaa tulehduksille ja pahanlaatuisille kasvaimille. Kaikki nämä yhdessä ovat sydän- ja verisuonitautien riskitekijöitä. Jos autofagosytoosi ei toimi, elimistöön kerääntyy haitallista solujätettä, joka pitäisi siivota ja/tai korjata.

Keto-ruokavaliossa noin 70-75 prosenttia päivittäisistä energiasta saadaan rasvasta, 15-20 % proteiineista ja vain 5-10 prosenttia kaloreista hiilihydraateista. Tämä muutos kalorilähteissä saa elimistön muuttamaan aineenvaihduntareittiään. Solut alkavat käyttää rasvaa polttoaineena hiilihydraateista saatavan glukoosin sijaan.

Glukoosin rajoittamisen seurauksena verenkiertoon vapautuu lipolyyttisiä hormoneja (glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia), jotka käynnisävät rasvasolujen lipolyysin.

Lipolyysissä rasvasoluihin varastoituja triglyseridejä pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi. Vapaat rasvahapot kulkeutuvat maksaan, jossa niistä tuotetaan ketogeneesissä ketoaineita (asetonia, asetoasetaattia ja betahydroksibutyraattia). Glyserolia käytetään glukoneogeneesissä. Sydänlihaksen solut voivat hapettaa vapaita rasvahappoja energiaksi betaoksidaatiossa. Ketoaineet laskevat vapaiden happi- ja typpiradikaalien (ROS ja RNS) määrää, mikä vähentää oksidatiivista stressiä ja inflammaatiota. Ketoaineilla on myös syto- ja neuroprotektiivisia ominaisuuksia.

Tutkimukset viittaavat Khoranan mukaan siihen, että ketoosi voi myös tuottaa nälän indusoimana autofagosytoosin, jolla on neuroprotektiivisia vaikutuksia. Alhainen glukoosipitoisuus toteutuu ketogeenisellä ruokavaliolla ja paastolla. Ruokavalioita yhdistää matalat insuliinitasot ja korkeat glukagonitasot. Tämä metabolinen ympäristö on autofagosytoosin avaintekijä.

Glukagonitaso on se tekijä, joka laukaisee autofagosytoosin. Niin kuin tiedämme, insuliini on anabolinen hormoni ja sen vastavaikuttajana glukagoni on katabolinen hormoni. Tämä tarkoittaa, että insuliinia tarvitaan uusien rakenteiden muodostamiseen yhtä hyvin proteiinisynteesissä kuin rasvasynteesissä (lipogeneesissä). Sen sijaan katabolisissa aineenvaihduntatapahtumissa olemassaolevia rakenteita glykogeeneistä adiposyytteihin (rasvasoluihin) puretaan energiakäyttöön. Katabolisia aineenvaihduntatapahtumia ovat esimerkiksi: glykogenolyysi, lipolyysi ja autofagosytoosi.

Kun elimistössä on vähän sokeria paaston tai ketoosin seurauksena, elimistössä kehittyy positiivinen stressi, jonka vasteena on korjaustilan käynnistyminen. Myös intensiivinen ja raskas liikunta käynnistää autofagosytoosin. Erään eläintutkimuksen mukaan fyysinen harjoittelu voi indusoida autofagosytoosia elimissä, jotka osallistuvat aineenvaihdunnan säätelyprosesseihin. Näihin voivat kuulua luurankolihakset, maksa, haima ja rasvakudos.

https://www.healthline.com/health/autophagy

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2990190/

https://www.medicalnewstoday.com/articles/autophagy

http://genesdev.cshlp.org/content/21/22/2861.full.html

https://www.hindawi.com/journals/isrn/2012/927064/

https://en.wikipedia.org/wiki/Autophagy

https://fi.wikipedia.org/wiki/Autofagosytoosi

https://oppimis-ja-muistitekniikat.fi/elimiston-puhdistusjarjestelma/

https://en.wikipedia.org/wiki/Phagosome

https://en.wikipedia.org/wiki/Autophagosome




β-hydroksibutyraatin oksidaatio edistää immunometaboliittien kertymistä aktivoituneisiin mikroglia-soluihin

Adrian Beniton, Nabil Hajjin, Kevin O’Neill’n, Hector C. Keunin, & Nelofer Syedin tutkimus on julkaistu elokuun 26. päivänä 2020: 10.3390/metabo10090346

Sairastan etenevää MS-tautia. Olen aiemmissa artikkeleissa useita kertoja viitannut ketogeeniseen ruokavalioon yhtenä MS-taudin progressiota hidastavana terapiavaihtoehtona. Lisääntyvä kliininen näyttö osoittaa, että solujen glukoosinoton troofinen häiriö vaikuttaa neurodegeneraatioon Parkinsonin ja Alzheimerin tautien lisäksi myös mm. progressiivisessa multippeliskleroosissa.

Tässä katsauksessa kummastellaan mihin ketogeenisen ruokavalion vaikutus hermosoluja suojaavana, eli neuroprotektiivisena terapiana perustuu. Lets go!

Laajennan ja yritän parhaani mukaan myös selventää Beniton, Haijin et. al. tutkimusta

Saatteeksi: Neurologi ja kirjailija: Dr. Sophie Christoph kirjoittaa ketogeenisesta ruokavaliosta MS-taudin terapiana:

Ketogeeninen ruokavalio voi muuttaa immuunivastetta ja siten vaikuttaa MS-taudin etenemiseen. Eläinkokeet vahvistavat tämän havainnon.

Lihavuus on MS-taudin oireita pahentava riskitekijä. Ketogeeninen ruokavalio voi hillitä taudin etenemistä ja siihen liittyviä tulehdustiloja laihtumisen seurauksena. Viimeaikaiset tutkimukset viittaavat ruokailutottumusten ja sairauden tai oireiden vakavuuden väliseen vahvaan korrelaatioon.

Suuressa poikkileikkaustutkimuksessa ruokavalion laatuun ja aktiiviseen elämäntapaan liittyi kohentunut vireys, alhaisempi väsymys, ahdistuksen ja masennuksen lieveneminen, kognitiivisten kykyjen paraneminen ja neurologisten särkyjen helpottuminen.

Ketogeeninen ruokavalio tarjoaa vaihtoehtoisen energialähteen hermosoluille. Koska solujen rappeutuminen on ainakin osittain seurausta solujen glukoosinoton heikkenemisestä, betahydroksibutyraatti energiasubstraattina turvaa solujen energiansaannin.

Ketogeeniset ruokavaliot imitoivat aineevaihdunnan tasolla paastotilaa. Aineenvaihdunta siirtyy pois glykolyysin tuottamasta energiantuotannosta ja kohti rasvahappojen beeta-oksidaatiota ensisijaisena energialähteenä.

Ketogeeninen ruokavalio voi olla hyödyllinen MS-potilaille, koska:

  • ROS:ia ja RNS:iä (reaktiivisia happi- ja typpiradikaaleja) muodostuu vähemmän
  • veri-aivoesteen läpi kulkeutuvat ketoaineet säätelevät antioksidanttien signalointireittejä
  • ketoaineet lisäävät energiantuotantoa aivokudoksessa
  • eläimillä ja ihmisillä tehdyt tutkimukset vahvistavat, että ketogeeniset ruokavaliot vähentävät tulehduksellisia biomarkkereita veressä ja aivo-selkäydinnesteessä
  • kokeellisen autoimmuunisen enkefaliitin (EAE) hiirimallissa ketogeeninen ruokavalio johti motorisen vamman korjaantumiseen, parempaan oppimiseen ja muistiin, suurempiin hippokampuksen tilavuuksiin ja periventrikulaaristen vaurioiden remyelinaatioon
  • tulehduksellisten sytokiinien tukahdutettuun tuotantoon
  • lisääntyneisiin hermosolujen korjausprosesseihin
  • ketogeeninen ruokavalio parantaa MS-potilaiden väsymystä, masennusta ja laskee painoa
  • ketogeeninen ruokavalio ehkäisee ja parantaa MS:n aiheuttamaa neurodegeneraatiota ja neuroinflammaatiota

Mitokondrioiden toimintahäiriöt näyttävät olevan keskeisiä MS-patogeneesin neurodegeneratiivisessa vaikutuksessa. Tämä johtaa ATP:n heikompaan saatavuuteen, mikä voi edistää aksonin atrofiaa ja rappeutumista.

In vitro– ja eläintutkimusten mukaan ketogeenisen ruokavalion on osoitettu parantavan mitokondrioiden toimintaa ja edistävän siten aksonien terveyttä edistämällä ATP-tuotantoa ja mitokondrioiden biogeneesiä, ohittamalla mitokondrioiden häiriintyneet prosessit, lisäämällä antioksidanttien määrää ja vähentämällä oksidatiivisia vaurioita.

Tutkimukset ovat raportoineet merkittäviä eroja suolistobakteerien pitoisuudessa, monimuotoisuudessa ja koostumuksessa MS-potilailla ja niiden vaikutuksessa immuunijärjestelmän säätelyyn. Noin 3 kuukauden ketogeenisen ruokavalion jälkeen tämä tila parani myös MS-potilailla.

Tietoa kertyy jatkuvasti. Tälläkin hetkellä on käynnissä useita tutkimuksia, joissa selvitetään ketoosin vaikutuksia aivojen rappeutumista aiheuttaviin neurodegeneratiivisiin tauteihin, kuten Parkinsonin tauti, Alzheimerin tauti ja primaaristi progressiivinen MS.

Immuunisolujen metabolinen säätely on keskeinen vaikuttaja immunologisissa tapahtumissa

Julkaisin Ruokasodassa hiljattin kaksi tätä aihetta syventävää pitkää tutkimuskatsausta (Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa: 1 & 2). Ketogeenisen ruokavalion myönteisiä vaikutuksia primaaristi progressiivisessa multippeliskleroosissa on kuvattu tässä: Ketogeeninen ruokavalio ja PPMS.

Pidemmittä puheitta, mennään asiaan

Tieto leukosyyttien metabolisesta säätelystä on lisääntynyt valtavasti, mutta keskushermoston mikroglia-solujen metabolisesta säätelystä tiedetään yhä paljon vähemmän. Tässä tutkimuksessa osoitetaan, että muiden hermoston solujen tapaan, myös mikroglia-solut pystyvät hapettamaan betahydroksibutyraatista energiaa sitruunahappokierrossa.

Vaihtoehtoisten ravintoaineiden rooli hermosolujen energiasubstraattina tunnetaan huonosti. Vielä vuosituhannen alkupuolella lähtökohtainen oletus oli, että aivojen solut eivät toimi ilman glukoosia. Tämä käsitys kuitenkin kumottiin virheellisenä viimeistään 1960-luvulla. Tieto ei saavuttanut laajemmin lääketieteellistä yhteisöä ja tutkimus jäi pienen piirin kuriositeetiksi.

Ongelmana ovat pitkään olleet tutkimusmenetelmien rajoitukset. Aineenvaihdunnan määrittelyssä on pitänyt tuvautua kovien faktojen lisäksi arvauksiin ja valistuneisiin mielipiteisiin.

Uusilla kehittyneemmillä tutkimusmenetelmillä nähdään tarkemmin ja syvemmälle. Aineenvaihdunnan mekanismeja voidaan korjata siellä, missä on veikattu väärää hevosta. Tämä selittää sen, että tieto aineenvaihdunnan mekanismeista täsmentyy nopeasti.

Glukoosin uskottiin olevan välttämätöntä aivoille, vaikka glukoosin saantia rajoittavaa ketogeenista ruokavaliota on käytetty lääkeresistentin epilepsian kohtausten hillitsemiseen noin sadan vuoden ajan. Hiilihydraattien (glukoosin) rajoittamista sovellettiin menestyksellisesti diabeteksen hoitoon jo 1700 ja 1800 lukujen vaihteessa. Ketogeenisen ruokavalion hyödyt eivät ole uusi ilmiö. Ne tunnettiin vuosituhansia ennen, kuin hiilihydraattien rajoittamisen terveyshyödyt unohdettiin viime vuosisadan puolenvälin jälkeen.

Ketogeeninen ruokavalio, aivan kuten paasto, olisi käytännössä mahdotonta, jos elimistöllä ei olisi mekanismeja korvata glukoosin saantia aivosolujen energianlähteenä muilla energiasubstraateilla.

β-hydroksibutyraatin oksidaatio edistää immunometaboliittien kertymistä aktivoituneisiin mikroglia-soluihin

Tässä tutkimuksessa käytettiin stabiilien isotooppien (13C) jäljitysstrategioita ja metabolomiikkaa* hahmottamaan β-hydroksibutyraatin (BHB) oksidatiivista metaboliaa ihmisen (HMC3) ja hiiren (BV2) mikroglia-soluissa sekä β-hydroksibutyraatin vuorovaikutusta glukoosin kanssa lepo- ja LPS- elli lipopolysakkaridi-aktivoidussa BV2:ssa.

Lipopolysakkarideja esiintyy gramnegatiivisten bakteerien ulkokalvon pinnalla, jossa ne toimivat endotoksiineina ja aktivoivat elimistön immuunijärjestelmän.

*Metabolomiikka on uusi menetelmä, jolla tutkitaan pienimolekyylisten metaboliittien rakennetta, toimintaa ja yhteisvaikutuksia elimistön soluissa, kudoksissa, veressä ja eritteissä.

β-hydroksibutyraatti tuodaan ja hapetetaan TCA-syklissä eli sitruunahappokierrossa molemmissa solulinjoissa, minkä jälkeen sytosolinen NADH : NAD+ -suhde muuttuu.

Nikotiiniamidiadeniinidinukleotidi (NAD+)

NAD+ eli nikotiiniamidiadeniinidinukleotidi on kaikissa elävissä soluissa esiintyvä tärkeä koentsyymi. Rakenteeltaan se on dinukleotidi, jossa nikotiiniamidiemäksen sisältävä nukleotidi ja adeniininukleotidi ovat liittyneet toisiinsa fosfaattiryhmiensä välityksellä.

NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa tärkeissä biologisissa hapetus-pelkistysreaktioissa. NAD+ muistuttaa rakenteeltaan toista tärkeää koentsyymiä NADP+:a eli nikotiiniamidiadeniinidinukleotidifosfaattia, jossa lisäksi on adenosiiniin liittynyt fosfaattiryhmä.NAD+ osallistuu lähinnä katabolisiin reaktioihin, kun taas NADP+:lla on tärkeä rooli anabolisissa reaktioissa.

Eliöt tuottavat NAD+:a kahdella eri tavalla. Niin sanotussa de novo -synteesissä, jota säätelevät BNA-geenit, eliöt valmistavat aminohappo tryptofaanista kinoliinihappoa. Kinoliinihappo muutetaan nikotiinihappomononukleotidiksi, joka muutetaan nikotinaattinukleotidiadenylyylitransferaasientsyymin avulla desamino-NAD+:ksi. NAD+-syntaasientsyymi muuttaa desamino-NAD+:n NAD+:ksi.

Eliöt biosyntetisoivat NAD+:a myös sen hajoamisessa syntyvästä nikotiiniamidista. Nikotiiniamidi muutetaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

NAD+ on bioreaktioissa hapetin ja NADH pelkistin. NAD+ kiinnittyy entsyymeihin, jotka katalysoivat dehydrausreaktioita. Tällaisia ovat esimerkiksi glykolyysin yhteydessä tapahtuva glyseraldehydi-3-fosfaatin muuttaminen 1,3-bisfosfoglyseraatiksi, alkoholien hapettaminen aldehydeiksi, jota katalysoi alkoholidehydrogenaasi sekä glutamaatin hajotus.

Muita entsyymejä, joille NAD+ toimii koentsyyminä, ovat muun muassa UDP-galaktoosiepimeraasi, adenosyylihomokysteinaasi, 3-dehydrokinaattisyntaasi, ornitiinisyklodeaminaasi ja urokanaasi.- Wikipedia

BV2-soluissa stimulaatio lipopolysakkaridilla sääteli glykolyyttistä virtausta, lisäsi sytosolista NADH : NAD+ -suhdetta ja edisti glykolyyttisen dihydroksiasetonifosfaatin (DHAP) välituotetta.

β-hydroksibutyraatin lisääminen lisäsi LPS:n aiheuttamaa DHAP:n kertymistä ja edisti glukoosista johdetun laktaatin vientiä.

β-hydroksibutyraatti (BHB) lisäsi myös synergistisesti sukkinaatin ja muiden keskeisten immunometaboliittien, kuten sitruunahappokierron tuottamien a-ketoglutaraatin ja fumaraatin, LPS:n aiheuttamaa kertymistä. Lopuksi BHB sääteli avaintulehdusta edistävän (M1-polarisaatio) markkerigeenin, NOS2:n, ilmentymistä LPS:llä aktivoiduissa BV2-soluissa.

Yhteenvetona: havaitsimme β-hydroksibutyraatin mahdollisesti immunomoduloivaksi metaboliseksi substraatiksi, joka säätelee metabolista uudelleenohjelmointia tulehdusta edistävän vasteen aikana.

Betahydroksibutyraatti, β-hydroksibutyraatti eli betahydroksivoihappo tai BHB

Rakkaalla lapsella on monta nimeä. β-hydroksibutyraatti eli β-hydroksivoihappo on energia–aineenvaihdunnassa syntyvä ketoniyhdiste eli ns. ketoaine. Muita elimistön ketoaineita ovat asetoni ja asetoasetaatti.

Ketoaineita muodostuu elimistön energiatilan mukaisesti joko vapaista eli esteröitymättömistä rasvahapoista (free fatty acids eli FFA/non-esterified fatty acids eli NEFA) tai haihtuvista rasva-hapoista (volatile fatty acids eli VFA).

Ketoaineet erittyvät vapaasti munuaisissa virtsaan, joten virtsasta voidaan havaita ketoaineita melko pian ketoottisen tilanteen alkamisen jälkeen. On kuitenkin hyvä muistaa, että virtsaliuskojen ketoainemääritys havaitsee vain asetoasetaatin (ja vähemmässä määrin asetonin), muttei β-hydroksibutyraattia. β-hydroksibutyraatti on se ketoaine, jota syntyy eniten ketoosissa.

Ihmisillä β-hydroksibutyraatti voidaan syntetisoida maksassa rasvahappojen (esim. Butyraatti), β-hydroksi-β-metyylibutyraatin ja ketogeenisten aminohappojen aineenvaihdunnan reaktioiden avulla. Aineenvaihdunta muuttaa nämä yhdisteet asetoasetaatiksi, joka on ensimmäinen ketoaine, joka tuotetaan paastotilassa.

β-hydroksibutyraatin biosynteesiä asetoasetaatista katalysoi β-hydroksibutyraattidehydrogenaasientsyymi. Butyraatti voidaan myös metaboloida β-hydroksibutyraatiksi toisen metaboliareitin kautta, joka ei sisällä asetoasetaattia metabolisena välituotteena.

Tämä metabolinen reitti on seuraava β-hydroksibutyraatin pitoisuus ihmisen veriplasmassa, kuten muissakin ketoelimissä, kasvaa ketoosin kautta. Tämä kohonnut β-hydroksibutyraattitaso on luonnollisesti odotettavissa, koska p-hydroksibutyraatti muodostuu asetoasetaatista.

Aivot voivat käyttää β-hydroksibutyraattia energialähteenä, kun verensokeri on alhainen.

Diabetesta sairastavien potilaiden ketonitasot voidaan mitata virtsan tai veren kautta diabeettisen ketoasidoosin (happomyrkytys) osoittamiseksi.

Ketogeneesi tapahtuu, kun maksasolujen oksaloasetaatti ehtyy, mikä johtuu vähentyneestä hiilihydraattien saannista (ruokavalion tai paaston seurauksena).

Koska oksaloasetaatti on ratkaisevan tärkeä tekijä asetyyli-CoA:n (asetyylikoentsyymi-A on kaikkien energiaravinteiden välimuoto sitruunahaoppokierrossa) pääsemiseksi TCA-sykliin (trikarboksyylihappokeirto) eli sitruunahappokiertoon, asetyyli-CoA:n nopea tuotanto rasvahappohapetuksesta runsaan oksaloasetaatin puuttuessa ylittää TCA-syklin heikentyneen kapasiteetin ja tuloksena oleva ylimäärä asetyyli-CoA siirtyy kohti ketoaineiden tuotantoa.

β-hydroksibutyraatti pystyy läpäisemään keskushermostoa suojaavan veri-aivoesteen

Näin se pääsee ravitsemaan keskushermoston soluja. β-hydroksibutyyrihappotaso kasvaa maksassa, sydämessä, luurankolihaksissa, aivoissa ja muissa kudoksissa liikunnan, kalorien rajoittamisen, paaston ja ketogeenisten ruokavalioiden seurauksena.

Yhdisteen on havaittu toimivan histonideasetylaasin (HDAC) estäjänä. Estämällä HDAC-luokan I isoentsyymien HDAC2 ja HDAC3, β-hydroksibutyraatin on havaittu lisäävän aivoperäisen neurotroofisen tekijän (BDNF) pitoisuutta ja TrkB-signalointia hippokampuksessa.

Jyrsijätutkimuksissa on havaittu, että pitkäaikainen liikunta lisää plasman β-hydroksibutyraattipitoisuuksia, mikä indusoi BDNF-geenin promoottoreita hippokampuksessa.

Näillä havainnoilla voi olla kliininen merkitys masennuksen, ahdistuneisuuden ja kognitiivisten vajaatoimintojen hoidossa. Ketogeenistä ruokavaliota käyttävillä epilepsiapotilailla veren β-hydroksibutyraattitasot korreloivat parhaiten kohtausten hallinnan asteen kanssa. Optimaalisen antikonvulsanttivaikutuksen kynnys näyttää olevan noin 4 mmol / l.

Tutkimus

Mikroglia-solut ovat keskushermoston (CNS) immuunisoluja. Arviolta 10% kaikista keskushermoston soluista on mikroglia-soluja.

Nämä solut ovat viime aikoina herättäneet runsaasti kiinnostusta, koska niillä on kriittinen rooli yleisimmissä aivosairauksissa, kuten dementia, aivohalvaus ja aivokasvaimet. Aivosairaudessa tai immuunialtistuksessa levossa oleva mikroglia hyväksyy ohjelmalliset muutokset, jotka liittyvät sytokiinien ja kemokiinien vapautumiseen.

Sytokiinit ja kemokiinit

Sytokiini on proteiinirakenteinen solujen välisen viestinnän välittäjäaine, joka on löydetty immunologisen tutkimustyön yhteydessä. Sytokiinin ja kasvutekijän, joka on toinen paikallisesti vaikuttava kudoshormonityyppi, välinen ero on lähinnä löytöhistoriasta, eikä toimintatavasta tai muista ominaisuuksista johtuva. Valkosolut tuottavat suurimman osan sytokiineista. Immuunijärjestelmän ohjaus on niiden keskeisin tehtävä.

Immuunijärjestelmää ohjailevat sytokiinit voidaan jakaa toimintansa pääasiallisen luonteen perusteella viiteen pääryhmään: tuumorinekroositekijät, interferonit, interleukiinit, hematopoieettiset kasvutekijät ja muut kasvutekijät. Sytokiineja voidaan luokitella myös tuottajasolujensa mukaan. Esimerkiksi lymfosyyttien tuottamia sytokiineja kutsutaan lymfokiineiksi ja monosyyttien monokiineiksi.

Tuumorinekroositekijät (TNF) ovat ehkä keskeisimpiä ensisijaisia aktivoivia välittäjäaineita immunovasteen käynnistyksessä. Tuumorinekroositekijän nimi juontuu sen löytöhistoriasta, kun joidenkin syöpäpotilaiden kasvainten havaittiin surkastuvan bakteeritulehduksen yhteydessä. Myöhemmin saatiin selville, että kasvainten tuhoutumiseen vaikuttaa keskeisesti eräiden valkosolujen, makrofagien ja T-lymfosyyttien, tuottama proteiini, joka ristittiin tuumorinekroositekijäksi.

Hematopoieettiset kasvutekijät ohjailevat ja stimuloivat immunojärjestelmän solujen erilaistumista ja tuotantoa luuytimessä ja muissa verisoluja muodostavissa kudoksissa. Immunojärjestelmän kannalta ehkä keskeisin hematopoieettinen kasvutekijä on granulosyytti-makrofagi-solulinjaa stimuloiva tekijä. – Wikipedia

Kemokiinit saavat aikaan kemotaksista eli solun liikkumista joko suurempaa kemokiinipitoisuutta kohti tai siitä poispäin. Kemokiinit ovat yli 40 tunnetun molekyylin joukko rakenteeltaan samankaltaisia, pienikokoisia polypeptidejä (8-14 kDa), jotka sitoutuessaan kemokiinireseptoreihin aktivoivat ne. Kemokiinit ja niiden reseptorit luokitellaan C, CC, CXC ja CXXXC perheisiin sen mukaan, miten kemokiinin N-terminaalinen kysteiini paikantuu.

Kemokiinireseptorit ovat luonteeltaan G-proteiineja, joiden aktivoituminen käynnistää sarjan biokemiallisia reaktioita, kuten fosfatidyyli-inositolitrifostaatin hydrolysoitumisen, proteiinikinaasi C:n aktivoitumisen, kalsium-ionien sisänvirtauksen, sekä rac- ja Rho-proteiinien aktivaation. Rac ja Rho osallistuvat solun migraatioon säädellen aktiiniverkoston rakentumista lamellipodeissa ja filopodeissa.

Kemokiinien on osoitettu säätelevän erilaisia immuunijärjestelmän vasteita siten, että T-solujen alalajit ilmentävät eri kemokiinireseptoreita. Tämä puolestaan vaikuttaa siihen, mihin kudoksiin kyseiset T-solut voivat vaeltaa.

Monosyyteissä ja lepäävissä T-soluissa esiintyvät kemokiinireseptorit CCR5 and CXCR4 osallistuvat tulehdusreaktioihin, ja samat reseptorit avustavat HIV-virusten tarttumisessa T-soluihin. – Solunetti


Nämä polarisoidut solut on perinteisesti luokiteltu joko tulehdusta edistäviksi (M1-tyyppi) tai anti-inflammatorisiksi (M2-tyyppi) muutaman molekyylimarkkerin ilmentymisen mukaan. Molekyylit, kuten lipopolysakkaridi (LPS) ja interferoni-y (IFN-y), ovat voimakkaita M1-polarisaation promoottoreita, kun taas IL-4 indusoi M2-polarisaatiota.

Todisteiden lisääntyminen on kuitenkin osoittanut M1 / M2-kehyksen rajoitukset. Mikroglian polarisaatio on edelleen intensiivisen tieteellisen tutkimuksen aiheena. Lisääntyvä tutkimusnäyttö antaa ratkaisevan merkityksen solujen aineenvaihdunnalle mikrogliumin toiminnan ja polarisaation säätelyssä.

Solunulkoinen metabolinen ympäristö ja metabolisten reaktioiden ohjaamat muutokset solunsisäisessä aineenvaihduntaympäristössä, moduloivat vasteen immunologisiin signaaleihin.

Perifeerisissä immuunisoluissa mekanismit, joilla tulehdus vaikuttaa energia-aineenvaihduntaan, tunnetaan jo hyvin. Mikroglia-alueen viimeaikaiset havainnot osoittavat, että tämä immuunisolutyyppi sitoutuu erilaisiin metaboliareitteihin stimulaatiomallista riippuen.

Paljon vähemmän tiedetään kuitenkin siitä, kuinka energia-aineenvaihdunta ja metabolinen mikroympäristö vaikuttavat immuunivasteisiin. Immunometabolian havainnot ovat osoittaneet, että perifeeriset immuunisolut voivat sopeutua vaihteleviin ympäristöhaasteisiin metaboloimalla muita vaihtoehtoisia ravintoaineita kuin glukoosia (asetaattia, aminohappoja ja rasvahappoja).

Mikrogliassa tämä ns. metabolisen joustavuuden ilmiö ja vaihtoehtoisten substraattien energia-aineenvaihdunta ymmärretään edelleen puutteellisesti. Vasta äskettäin raportoitiin, että mikroglia voi glukoosin puuttuessa siirtyä käyttämään glutamiinia vaihtoehtoisena polttoaineena mikrogliafunktion ylläpitämiseksi.

Metabolisen joustavuuden merkitys lisääntyy samalla, kun metabolisen mikroympäristön merkityksestä immuunitoiminnan säätelylle saadaan lisää todisteita

Äskettäin on keksitty termi immunometaboliitit tai sytokiinien kaltaiset metaboliitit kuvaamaan metaboliitteja sukkinaattia, itakononaattia, laktaattia, fumaraattia ja a-ketoglutaraattia. Nämä ovat metaboliitteja, joilla on tärkeä vaikutus leukosyyttien aktivaatiossa ja erilaistumisessa, ja jotka ovat riippumattomia niiden tavanomaisesta roolista biosynteesissä ja bioenergeettisissä aineissa.

Ruokavalio-interventiot ovat osoittaneet terapeuttista potentiaalia aineenvaihduntaympäristön ja immuunijärjestelmän säätelijöinä. Tällaisista ruokavalioista ketogeeniset ruokavaliot ovat olleet suosittuja erityisesti aivosairauksien, kuten epilepsian ja gliooman (aivokasvain) hoidossa.

Huomio: Multippeliskleroosi aiheuttaa todellista tuhoa keskushermoston valkeassa ja harmaassa aineessa.Arpeumat ja kuolleiden neuroneiden muodostamat ”mustat aukot” ovat yhtä todellisia kuin amputoitu sormi tai varvas, joka ei ihmeenomaisesti jotain eliksiiriä nauttimalla kasva takaisin.

Ruokavalio-interventio terapiana hidastaa ja ehkäisee uusien hermostovaurioiden syntyä. Olemassaolevat vauriot voivat ehkä jossain määrin korjautua vuosien tai vuosikymmenten aikana neurogeneesin, remyelinaation ja neuroplastisuuden avulla, mutta sellaisesta ei ole tieteellistä näyttöä.

Yhtä kaikki, ketogeeninen ruokavalio hidastaa ja ehkäisee uusien leesioiden syntyä. Sen parempaan nykylääketiede ei oikein MS-taudin kohdalla pysty. Tämä on masentavaa, mutta samalla rohkaisevaa. Se on se, mitä me multippelisklerootikot voimme itsellemme antaa. Kukaan ei osaa korjata jo syntyneitä valkean ja harmaan aineen vaurioita, mutta me voimme ehkäistä uusien vaurioiden syntymistä ja hidastaa invalidisoivaa prosessia.

Tähän ruokavalioon liittyvien monien terveysvaikutusten joukossa ketoaine β-hydroksibutyraatin (BHB) endogeenisen tuotannon lisääntyminen on yksi biologisesti merkittävimmistä vaikutuksista.

Todiste tämän metaboliitin merkityksellisyydestä on se, että β-hydroksibutyraatti yksinään annettuna tuottaa ketogeenisen ruokavalion hyödylliset vaikutukset äärimmäisissä olosuhteissa.

Tämä on ajankohtainen aihe. NASA rahoittaa β-hydroksibutyraatin ja ketoosin vaikutuksia selvittäviä tutkimuksia, koska tulevaisuuden Mars-lentojen astronauttien aineenvaihdunta ja kognitiiviset kyvyt äärioloissa halutaan maksimoida. USAn puolustusministeriö rahoittaa ketoaineiden ja ketoosin tutkimusta, koska ketoosin uskotaan parantavan taistelusukeltajien toimintakykyä äärioloissa.

Ketoosin neuroprotektiiviset ja kognitiota tehostavat vaikutukset todentuvat erityisen hyvin äärioloissa. Karppaus ei vittuilusta huolimatta ole enää pienen pöpiseurakunnan ruokauskonto, vaan faktisesti ihmisen aineenvaihduntaa ja immuunijärjestelmää tehostava ruokavalio.

β-hydroksibutyraatti on nelihiilinen molekyyli, joka syntyy maksan rasvahappojen hapettuessa, kun elimistö ei saa glukoosia. Se voi toimia signalointimolekyylinä sitoutumalla suoraan G-proteiiniin kytkettyyn reseptoriin GPR109A tai histonideasetylaasin (HDAC) estäjänä sekä epäsuorasti oksidatiivisen aineenvaihdunnan kautta, minkä jälkeen muodostuu asetyyli-CoA ja NADH, eli asetyylikoentsyymi-A ja nikotiiniamidiadeniinidinukleotidin pelkistynyt muoto.

Vaikka β-hydroksibutyraatin suoria signalointivaikutuksia aivoissa ja mikroglia-alueella on tutkittu laajasti eri järjestelmissä, sen metaboliaa mikrogliassa ei ole aiemmin kartoitettu.

Kun otetaan huomioon metabolisen signaloinnin ja uudelleenohjelmoinnin keskeinen rooli immuniteetissa, β-hydroksibutyraatin metabolisten vaikutusten ymmärtäminen mikrogliassa nousee perustavanlaatuiseksi kysymykseksi.

Tässä käytimme stabiilin isotoopin (13C) jäljitystä ja metabolomiikkaa β-hydroksibutyraatin oksidatiivisen aineenvaihdunnan ja glukoosimetabolian välisen vuorovaikutuksen lepo- ja LPS- eli lipopolysakkaridi-aktivoidun mikroglian vertailuun.

Arvioimme myös β-hydroksibutyraatin vaikutusta lipopolysakkaridiin kohdistuvaan tulehdusvasteeseen analysoimalla polarisaatiotuottajien ilmentymässä tapahtuvia muutoksia.

Lipopolysakkaridi (LPS)on suurikokoinen molekyyli, joka koostuu lipidistä ja polysakkaridista. Molekyylin rakenteessa on kolme kovalenttisin sidoksin yhdistynyttä osaa: O-polysakkaridi eli O-antigeeni, ydinoligosakkaridi ja lipidi A. Lipopolysakkarideja esiintyy gramnegatiivisten bakteerien ulkokalvon pinnalla, jossa ne toimivat endotoksiineina ja aktivoivat elimistön immuunijärjestelmän.

Tulokset


Mikroglia-solut hapettavat β-hydroksibutyraattia TCA-syklissä

Sitruunahappokierto eli Krebsin sykli eli trikarboksyylihappokierto (TCA-kierto) on solujen mitokondrioissa tapahtuva monivaiheinen kemiallinen prosessi, jossa ravintoaineista peräisin olevat hiiliatomit hapettuvat hiilidioksidiksi ja samojen molekyylien sisältämät vedyt siirtyvät elektroninsiirtäjäkoentsyymeille. Prosessissa vapautuu energiaa, ja se on solujen pääasiallinen energianlähde.

Ennen kuin ravintoaineet kuten hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon, etenkin asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi. Lisäksi kierron eri vaiheissa sitoutuu vesimolekyylejä, ja siinä vapautuu hiilidioksidia sekä vetyioneja ja elektroneja. Nämä vapautuneet vetyionit ja ylimääräiset elektronit siirtyvät hapetus-pelkistysreaktioissa elektroninsiirtäjäkoentsyymeille, joita ovat NAD+:a ja FAD. Koentsyymeiltä vedyt siirtyvät edelleen elektroninsiirtoketjuun, jonka päätteeksi ne yhtyvät hengitysilmasta tulleen hapen kanssa vesimolekyyleiksi.

Syklisessä reaktiossa sitoutuu myös yksi fosforihappomolekyyli, jolloin muodostuu yksi korkeaenergiainen ATP-molekyyli GTP-välivaiheen kautta, ja neljä pelkistynyttä elektroninsiirtäjäkoentsyymiä (kolme NADH:ta ja yksi FADH2) kutakin pilkkoutunutta ja hapettunutta asetyylikoentsyymi-A:ta kohti. Sitruunahappokierto tapahtuu pääosin mitokondrion matriksissa, kun taas elektroninsiirtoketju tapahtuu mitokondrion sisäkalvolla.

Yksi sitruunahappokierron entsyymi, sukkinaattidehydrogenaasi, on mitokondrion sisäkalvon entsyymi. Se voi syöttää saamansa elektronit suoraan mitokondrion sisäkalvolla tapahtuvaan elektroninsiirtoketjuun.


β-hydroksibutyraati
n metabolian tutkimuksessa mikroglia-solulinjat BV2 (hiiri) ja HMC3 (ihminen) valittiin mikroglia-solumalleiksi.

β-hydroksibutyraatin pitoisuus nousee olosuhteissa, joille on tunnusomaista rajoitettu glukoosin saatavuus. Vaikka β-hydroksibutyraatin hapettumisen on jo kauan tiedetty tapahtuvan hermosoluissa, astrosyyteissä ja oligodendrosyyteissä, todisteita β-hydroksibutyraatin hapettumisesta mikroglia-soluissa ei vielä ole.

Pyrimme ensin vahvistamaan, voiko mikroglia hapettaa β-hydroksibutyraattia, sekä ymmärtämään, miten glukoosin saatavuus muuttaa β-hydroksibutyraatin aineenvaihduntaa.

Näiden hypoteesien testaamiseksi teimme stabiilin isotooppien jäljityskokeen käyttäen 13C-leimattua β-hydroksibutyraattia. 13C-leimattujen substraattien käyttö mahdollistaa hiilen kulkeutumisen jäljittämisen eri aineenvaihduntareittien kautta ja liittymisen alavirran metaboliitteihin.

β-hydroksibutyraatti hapetetaan kolmivaiheisen ketoaineiden hapetusreitin kautta, minkä jälkeen tuotetaan NADH:ta ja asetyyli-CoA:ta, jotka voidaan siirtää sitruunahappokiertoon. (Kuva 1)

BV2- ja HMC3-viljelmiä täydennettiin tasaisesti 5 mmol/l 13C-leimatulla BHB:lla (13C4-BHB) viljelyolosuhteissa, jotka eivät sisältäneet lisättyä glukoosia, 1 tai 5 mmol/l leimaamatonta glukoosia (12C6-glukoosi).

Rinnakkaisanalyysi 13C-leimatulla glukoosilla (13C6-glukoosi) vahvisti glykolyyttisen virtauksen merkittävän vähenemisen glukoosia rajoittavassa ympäristössä (kuvio S1A, B). Tuloksemme osoittivat, että sekä BV2 että HMC3 voivat tuoda ja hapettaa β-hydroksibutyraattia, kuten TCA-syklin m +2 13C-rikastus osoittaa. Välituotteina sitraatti, a-ketoglutaraatti, glutamaatti, sukkinaatti, fumaraatti ja malaatti (kuva 1B).

Tuloksemme osoittivat myös, että glukoosin saatavuus muuttaa β-hydroksibutyraatin vaikutusta eri tavalla kussakin solulinjassa. BV2-soluissa β-hydroksibutyraatin hapettuminen lisääntyi vähitellen glukoosipitoisuuden laskiessa, mikä ilmeni m+2 13C-rikastumisen kasvuna kaikissa sitruunahappokierron välituotteissa (kuvio 1B, vasemmalla).

HMC3-soluilla ei ollut samaa vastemallia, ja β-hydroksibutyraatin hapettuminen pysyi vakiona riippumatta glukoosipitoisuudesta, mistä osoittaa tasainen m +2 13C-rikastumisen osuus TCA-syklin välituotteissa (kuvio 1B, oikea).

Mielenkiintoista on, että sekä BV2- että HMC3-soluissa havaittavissa oleva osa 13C4-BHB-johdetuista hiilistä transformoitiin laktaatiksi (kuvio S2A, B) ja pyruvaatiksi (kuvio S2C, D).

Havaitsimme erityisesti solunsisäisen m+2 13C2-laktaatin lisääntymisen glukoosista riippuvaisella tavalla, mikä viittaa vaihtoehtoiseen β-hydroksibutyraatin metaboliareittiin, joka paranee glukoosia rajoittavissa olosuhteissa.

On raportoitu, että mikroglia-soluilla on joustava aineenvaihdunta ja glukoosipuutteessa ne voivat nopeasti siirtyä käyttämään glutamiinia mitokondrioiden aineenvaihdunnan ja valvontatoimintojen ylläpitämiseen. Siksi testataksemme mahdollisuutta, että β-hydroksibutyraatti voisi aiheuttaa mikroglia-proliferaation (lisääntymisen) hyvin matalan glukoosin olosuhteissa, viljelimme BV2- ja HMC3-soluja 0,1 mmol/l glukoosissa, johon oli lisätty 5 tai 10 mmol/l leimaamatonta β-hydroksibutyraattia.

Tuloksemme osoittavat, että β-hydroksibutyraatti ei aiheuttanut mikroglian lisääntymistä missään solulinjassa (kuva S2E, F). Koska sekä glukoosi että β-hydroksibutyraatinn metaboliareitit ovat mukana NADH:n tuotannossa, olimme kiinnostuneita siitä, voisiko β-hydroksibutyraatti muuttaa bioenergeettistä aineenvaihduntaa ja redox-tilaa indusoimalla muutoksia NADH : NAD+ -suhteessa.

Tämän suhteen on äskettäin raportoitu hallitsevan synnynnäisiä tulehdusvasteita transkriptionaalisen repressorin CtBP:n kautta. Sytosolinen NADH : NAD+ -suhde voidaan arvioida epäsuorasti mittaamalla laktaatin ja pyruvaatin solunsisäisten tasojen suhde (kuvio 1C) . Kuten odotettiin, 5 mmol/l glukoosissa viljellyillä soluilla oli suurempi NADH : NAD+ -suhde kuin 1 mmol/ glukoosissa viljellyillä soluilla (kuvio 1D, E).

BV2-soluissa β-hydroksibutyraatin lisääminen lisäsi NADH : NAD+ -suhdetta, kun soluja viljeltiin 5 mmol/l glukoosissa, mutta ei 1 mmol/l glukoosissa (kuvio 1D). HMC3-soluissa β-hydroksibutyraatin lisäys nosti suhdetta sekä 1 että 5 mmol/l glukoosiolosuhteissa (kuvio 1E).

Tutkimme myös β-hydroksibutyraatin isäyksen vaikutusta metaboliittitasoihin useilla metaboliareiteillä soluissa, joita viljeltiin 1 ja 5 mmol/l glukoosissa. BV2-solujen aineenvaihdunta reagoi paremmin β-hydroksibutyraattiin kuin HMC3. 1 mmol/l glukoosissa BV2-solut, joihin oli lisätty β-hydroksibutyraattia, osoittivat laktaatin, glysiinin ja glutamaatin kertymistä, kun taas 5 mmol/l glukoosissa havaittiin laktaatin kertymistä ja glutamaatin konsentraation pienenemistä (kuvio S3A).

HMC3-soluissa β-hydroksibutyraatti edisti glutamaatin kerääntymistä matalassa glukoosissa viljellyissä soluissa (kuvio S3B). Nämä tiedot yhdessä vahvistavat, että β-hydroksibutyraatti hapetetaan sitruunahappokierrossa (TCA-syklissä) mikroglia-soluissa ja edistää NADH:n tuotantoa ja sytosolisen NADH : NAD+ -suhteen säätelyä.

β-hydroksibutyraatin (BHB) hapettuminen hiiren (BV2) ja ihmisen (HMC3) soluissa.

  1. (A) Kaavamainen esitys 13C4-BHB: stä johdetusta 13C-rikastuksesta.
  2. (B) TCA-syklin välituotteiden (Cit, sitraatti; αKG, α-ketoglutaraatti; Glu, glutamaatti; Suc, sukkinaatti; Fum, fumaraatti; Mal, malaatti) m + 2 13C-rikastus BV2- ja HMC3-soluissa viljelyolosuhteissa joko ilman lisättiin glukoosia tai 1 tai 5 mM 12C6-glukoosia ja 5 mM 13C4-BHB 24 tunnin ajan. Pylväät edustavat n = 3 biologisen replikaation keskiarvoa ± SD. Tiedot analysoitiin yksisuuntaisella ANOVA: lla metaboliittia kohti, mitä seurasi Tukey-testi.
  3. (C) Kaavioesitys sytosolisesta NADH : NAD+ -suhteesta tasapainossa laktaatti: pyruvaatti-suhteen kanssa.
  4. (D, E) Sytosolinen NADH : NAD+ -suhde arvioitu käyttämällä laktaatin ja pyruvaatin solunsisäisiä tasoja BV2: ssa (D) ja HMC3: ssa (E). Pylväät edustavat n = 2-3 (-BHB) ja n = 5-6 (+ BHB) biologisten kopioiden keskiarvoa ± SD. Tiedot analysoitiin kaksisuuntaisella ANOVA:lla, jota seurasi Sidakin testi (-BHB vs. + BHB glukoosiluokassa). Tilastollista merkitsevyyttä merkitään * p <0,05, ** p <0,01 ja **** p <0,0001.

β-Hydroxybutyraatti muuttaa LPS:n aiheuttaman glykolyyttisen vasteen

β-hydroksibutyraatin roolia mikrogliassa ja neuroinflammatiossa on aiemmin tutkittu erilaisissa sairausmalleissa. β-hydroksibutyraatin metabolisia vaikutuksia mikroglia-aktivaatioon ja taustalla olevaan metaboliseen uudelleenohjelmointiin ei kuitenkaan tunneta.

Tutkimusten mukaan yhä useampi todiste osoittaa, että metabolinen häiriö voi muuttaa mikroglia-vastetta immuunisignaaleihin. Siksi haluamme ymmärtää β-hydroksibutyraatin vaikutusta LPS-aktivoituun mikrogliaan liittyvään metaboliseen uudelleenohjelmointiin.

Koska BV2-solut reagoivat metabolisesti paremmin β-hydroksibutyraatin lisäykseen ja aiemmat tutkimukset olivat optimoineet LPS-stimulaation ja luonnehtineet osittain tämän solulinjan metabolista vastetta, BV2 valittiin malliksi tutkittaessa β-hydroksibutyraatin vaikutuksia LPS:n aiheuttamaan metaboliseen uudelleenohjelmointiin.

BV2-soluja viljeltiin 5 mmol/l 13C6-glukoosin läsnä ollessa ja käsiteltiin joko 5 mmol/l 12C4β-hydroksibutyraatilla, 100 ng / ml LPS:llä tai molemmilla 6 tuntia.Onnistuneen aktivaation vahvisti tulehdusmerkinnän NOS2 uudelleen säätely (kuvio S4A). Glykolyyttisen aineenvaihdunnan muutosten tutkimiseksi mitasimme 13C-rikastumisen ja keskeisten glykolyyttisten välituotteiden suhteellisen runsauden (kuvio 2A). Vaikka LPS-hoito ei muuttanut glukoosin ottonopeutta, havaitsimme korkeamman glukoosinottotrendin soluissa, joita hoidettiin yksin β-hydroksibutyraatilla tai yhdessä LPS:n kanssa, mikä ei saavuttanut tilastollista merkitsevyyttä (kuvio 2B).

LPS:n, mutta ei β-hydroksibutyraatin lisääminen lisäsi glykolyyttistä virtausta solunsisäisen m+3 13C-pyruvaatin (kuvio 2C) ja m+3 13C-laktaatin (kuvio 2D) nousun perusteella.

Johdonmukaisesti tämä glykolyyttisen vuon kasvu, kun soluja käsiteltiin LPS:llä, liittyi sytosolisen NADH : NAD+ -suhteen nousuun (kuvio 2E). Pelkkä β-hydroksibutyraatin täydentäminen ei muuttanut NADH : NAD+ -suhdetta, mutta LPS:n ja β-hydroksibutyraatin yhdistelmä vähensi tätä verrattuna yksin LPS:ään. Mielenkiintoista on, että LPS:n ja β-hydroksibutyraatin vaikutukset 13C-laktaatin vientiin seurasivat eri suuntausta kuin solunsisäisen 13C-pyruvaatin ja 13C-laktaatin tuotanto. Vaikka erilliset hoidot LPS:llä tai β-hydroksibutyraatilla yksinään eivät muuttaneet 13C-laktaatin vientinopeutta, yhdistelmähoito lisäsi dramaattisesti 13C-laktaatin vientiä väliaineeseen (kuvio 2F), mikä viittaa siihen, että β-hydroksibutyraatti voisi muuttaa glukoosista otetun hiilen kohtaloa sekä laktaattimetaboliaa ja vientiä.

Tutkimme myös muutoksia joidenkin glykolyyttisten välituotteiden suhteellisessa runsaudessa (otoksen koko). Havaitsimme suuren dihydroksiasetonifosfaatin (DHAP) (kuvio 2G, H) pitoisuuden nousun LPS:llä käsitellyissä soluissa, jotka lisääntyivät enemmän, kun soluja käsiteltiin samanaikaisesti LPS:llä ja β-hydroksibutyraatilla, mikä viittaa synergistiseen metaboliseen vasteeseen molemmille aineille.

Löysimme myös seriinin, glysiinin ja metioniinin merkittäviä kertymiä, kun soluja käsiteltiin LPS:llä ja β-hydroksibutyraatilla samanaikaisesti (kuvio 2G). Nämä tulokset osoittavat yhdessä, että LPS lisää glykolyyttistä virtausta ja sytosolista NADH : NAD+ -suhdetta ja että BHB muuttaa LPS:n aiheuttamaa glykolyyttistä fenotyyppiä edistämällä laktaatin vientiä ja glykolyyttisten välituotteiden kertymistä.

β-hydroksibutyraatti edistää mitokondrioiden aineenvaihduntaa ja TCA-syklin välituotteiden kertymistä

Kuten aikaisemmin on esitetty kuviossa 1B, mikroglia-solut hapettavat β-hydroksibutyraattia sitruunahappokierrossa (TCA-syklissä). Viime vuosina useiden TCA-syklin välituotteiden on raportoitu osallistuvan immuniteetin signalointiin ja säätelyyn, mutta on epäselvää vaikuttaako tämä aineenvaihdunnan säätely myös mikrogliassa.

Lipopolysakkaridi-stimulaatiolla mitattiin sitruunahappokierron välituotteiden 13C-rikastuminen ja suhteellinen runsaus BV2-soluissa samoissa koeolosuhteissa kuin kuvassa 2. Pelkästään LPS-käsittely kasvatti 13C-glukoosista johdettujen hiilien virtausta mitokondrioihin. M+2 13C-sitraatin lisääntymieen liittyen (kuvio 3A).


Vastaavasti kuviossa 1B esitettyjen tulosten kanssa yksin β-hydroksibutyraatin lisääminen vähensi 13C-rikastumista kaikissa sitruunahappokierron välituotteissa verrattuna soluihin, joita viljeltiin ilman β-hydroksibutyraattia 13C-leimauksen laimentamisen vuoksi.

Lipopolysakkaridin lisääminen yhdessä β-hydroksibutyraatin kanssa lisäsi merkittävästi m+2 13C-sitraatin ja muiden TCA-syklin välituotteiden, kuten:

13C-a-ketoglutaraatin 13C-glutamaatin

13C-sukkinaatin

13C-malaatin

13C-fumaraatin

osuutta verrattuna B β-hydroksibutyraattiin yksin (kuva 3A).

Tutkimme myös muutoksia sitruunahappokierron välituotteiden ja aminohappojen suhteellisessa esiintymisessä. Erillinen käsittely lipopolysakkaridilla, muttei betahydroksibutyraatilla, lisäsi käsiteltyjen solujen sukkinaatin tasoa merkittävästi käsittelemättömiin soluihin verrattuna (kuvio 3B, C). Vastaava ilmiö on aiemmin raportoitu makrofageissa.

Sukkinaattitasot nousivat edelleen soluissa, joita oli käsitelty LPS:llä ja BHB:llä. Tämä viittaa synergistiseen vaikutukseen yhtäläisellä altistuksella näille kahdelle metaboliitille.

Pelkkä BHB-hoito ei muuttanut merkittävästi minkään tutkitun metaboliitin tasoja, mutta hoito LPS:lla ja BHB:lla yhdessä lisäsi myös immunometaboliittien fumaraatin (kuva 3D) ja a-ketoglutaraatin (kuva 3E) tasoja. Lisäksi havaittiin sitraatin, glutamaatin, malaatin ja pyroglutamaatin lisääntymistä, kun soluja käsiteltiin LPS:llä ja BHB:llä samanaikaisesti (kuvio 3B).

Tuloksemme osoittavat, että β-hydroksibutyraatti edistää mitokondrioiden metaboliaa ja sitruunahappokierron immunometaboliittien kertymistä LPS-aktivoiduihin soluihin.

β-hydroksibutyraatti tehostaa lipopolysakkaridin aiheuttaman tulehdusta ehkäisevän markkerin NOS2 stimulaatiota

β-hydroksibutyraatinn vaikutuksen ymmärtämiseksi mikroglian aktivaatiossa ja polarisaatiossa BV2-soluja käsiteltiin pienellä (1 ng / ml) tai suurella (100 ng / ml) LPS-annoksella, 5 mmol/l β-hydroksibutyraatilla tai molempien yhdistelmällä. ja määritettiin M1 (NOS2 ja IL-1p) ja M2 (ARG1) polarisaatiomerkkien ilmentyminen (kuvio 4A, B).

Stimulaatio joko pienellä tai korkealla LPS-konsentraatiolla yksin johti NOS2- ja IL-1β-ilmentymisen voimakkaaseen säätelyyn. Ainoastaan suurella LPS-pitoisuudella käsitellyt solut vähensivät merkittävästi ARG1:n ilmentymistä.

Pelkästään β-hydroksibutyraatin lisääminen ei vaikuttanut minkään geenin ilmentymiseen, mutta mikä tärkeintä, solut, joita oli hoidettu pienen LPS- ja BHB-annoksen yhdistelmällä, osoittivat NOS2-ilmentymisen lisääntynyttä säätelyä verrattuna pelkästään LPS: llä käsitellyihin soluihin.

Millaisia ajatuksia tämä herätti?

Tässä käyttämällä stabiilin isotoopin jäljitystä 13C-BHB:n kanssa olemme osoittaneet, että mikroglia-solut voivat tuoda ja hapettaa betahydroksibutyraattia sitruunahappokierrossa, jolloin sytosolinen NADH : NAD+ -suhde kasvaa myöhemmin.

Käyttämällä 13C-glukoosia havaitsimme, että lipopolysakkaridi (LPS) säätelee glykolyyttistä virtausta, lisää NADH : NAD+ -suhdetta ja edistää DHAP: n kertymistä. β-hydroksibutyraatin lisääminen lisäsi LPS:n indusoimaa DHAP:n kertymistä ja edisti glukoosista johdetun laktaatin vientiä. β-hydroksibutyraatti lisäsi myös synergistisesti sukkinaatin ja muiden keskeisten immunometaboliittien, kuten TCA-syklin tuottamien a-ketoglutaraatin ja fumaraatin, lipopolysakkaridin aiheuttamaa kertymistä.

β-hydroksibutyraatti on tärkein ketoaine yhdessä asetoasetaatin ja asetonin kanssa. Ketoaineita syntetisoituu maksassa rasvakudoksista tai ravinnon rasvahapoista. β-hydroksibutyraatin peruskonsentraatio plasmassa terveillä koehenkilöillä on suhteellisen pieni, viitearvojen ilmoitettuina 0,04–0,08 mmol/l ja tyypillisesti <0,5 mmol/l, ja se nousee erityisolosuhteissa, kuten paaston aikana (5–6 mmol/l), ketogeenisellä ruokavaliolla (1 mmol/l) tai diabeettisessa ketoasidoosissa (> 10 mmol/l).

Glukoosi on aivoille edullinen energiasubstraatti. Toisin kuin useimmat muut kudokset, aivot eivät voi käyttää rasvahappoja energiaksi, kun verensokeritaso vaarantuu. Alhaisen saatavuuden aikoina sitä voidaan kuitenkin täydentää vaihtoehtoisten substraattien, kuten monokarboksylaattipyruvaatin, laktaatin, asetaatin ja ketoaineiden hapetuksella. Suurin osa tämänhetkisestä tiedosta vaihtoehtoisten ravintoaineiden käytöstä aivosoluissa on saatu hermosoluista ja astrosyyteistä tai kokoaivokokeissa joko in vivo tai aivokuoren viipaleina.

Tuloksemme osoittavat selvästi, että mikroglia-solut BV2 ja HMC3 voivat tuoda ja hapettaa ketoaine β-hydroksibutyraattia. Monokarboksylaattikuljettimet (MCT) kuljettavat β-hydroksibutyraattia aktiivisesti aivoihin.

β-hydroksibutyraatin hapettuminen asetyyli-CoA: ksi tapahtuu lineaarisen metabolisen reaktion sekvenssin kautta, jota katalysoivat entsyymit β-hydroksibutyraattidehydrogenaasi (BDH1 / 2), sukkinyyli-CoA: 3: oksohappo-CoA-transferaasi (SCOT) ja asetyyli-CoA-asetyylitransferaasi ( ACAT1 / 2), minkä jälkeen tuotetaan yksi NADH- ja sukkinaattimolekyyli ja kaksi asetyyli-CoA-molekyyliä. SCOT koodaa geeni OXCT1, ja sen katsotaan olevan nopeutta rajoittava vaihe ketoaineen hapetuksessa.

Tuloksemme osoittavat, että mikroglia, kuten neuronit, astrosyytit ja oligodendrosyytit, omaavat entsymaattisen aktiivisuuden ketoaineiden hapettamiselle. Useat tutkimukset ovat raportoineet ikään, lajeihin ja aivojen alueeseen liittyvistä eroista entsyymiaktiivisuudessa, joka liittyy ketoaineiden hapettumiseen. Ketoaineiden hapettumisen (ketolyysin) säätelystä tiedetään vähän.

Solutasolla ketogeneesiä ohjaa säätelyverkko, johon osallistuvat AMPK, mTOR ja PPARa.

Yhteenvetona voidaan todeta, että tutkimus antoi uusia tietoja, jotka selittävät betahydroksibutyraatin toimintaa mikroglia-solulinjoissa. Osoitamme myös, kuinka β-hydroksibutyraatti lisää tunnettujen immunomoduloivien (immuunijärjestelmää säätelevien) metaboliittien tasoa näissä malleissa. Synteettisissä gliooma-hiirimalleissa ketogeeninen ruokavalion ja sädehoidon yhdistelmä johti kasvaimen täydelliseen hävittämiseen, mikä viittaa siihen, että ketogeeninen ruokavalio ohjaa immuunijärjestelmän toiminta.





Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa 2

Tämä on toinen osa progressiivisen multippeliskleroosin patogeneesiä avaavaa tutkimuskatsausta:

Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa

Tutkimuskatsauksen ensimmäinen osa maalasi MS-taudin oireiden biokemiallista taustaa heijastelevan värikkään ja hämmentävän neurologisen maiseman. Ensimmäiseen osaan voit tutustua tästä. Toisessa osassa jatketaan saman mikroskooppisen maailman kartoittamista.

CD4+ CD28-T-soluissa on oligoklonaalisia antigeenireseptoreita

Oligoklonaalisella tarkoitetaan useammasta kuin yhdestä solukloonista muodostuvaa rakennetta. Esimerkiksi immunoglobuliini-G, eli IgG on monomeerimuodossa esiintyvä ihmisen yleisin vasta-aine. IgG:n oligoklonaalisia joukkoja havaitaan lähes kaikkien multippeliskleroosia sairastavien aivo-selkäydinnesteestä (CSF), eli likvorissa. Niinpä niitä pidetään yhtenä MS-taudin diagnoosia tukevana immunologisena tunnuspiirteenä.

Oligoklonaaliset joukot (OCB) eivät kuitenkaan liity vain MS-tautiin. Niitä havaitaan myös kroonisissa keskushermostoinfektioissa. OCB-vasta-aineiden tunnistamien antigeenien tunnistamisen uskotaan antavan perustavanlaatuisia vihjeitä MS-taudin patogeneesistä.

CD4+ CD28-T-solut tuottavat suuria määriä tulehduksellisia sytokiinejä, kuten IFN-y ja GM-CSF, ja ilmentävät sytotoksisia molekyylejä, kuten NKG2D, perforiini ja grantsyymi B. Entä mitä nämä tulehdukselliset sytokiinit ovat?

  • Gammainterferoni (IFNy) on dimeroitunut liukoinen sytokiini, ja ainoa tyyppiä II olevien interferonien jäsen. Tämä interferoni tunnettiin aiemmin immuuni-interferonina.
  • Granulosyytti-makrofagipesäkkeitä stimuloiva tekijä (GM-CSF) tunnetaan myös nimellä pesäkkeitä stimuloiva tekijä 2 (CSF2), on makrofagien, T-solujen, syöjäsolujen, luonnollisten tappajasolujen, endoteelisolujen ja fibroblastien erittämä monomeerinen glykoproteiini, joka toimii sytokiininä. Toisin kuin granulosyyttipesäkkeitä stimuloiva tekijä, joka erityisesti edistää neutrofiilien lisääntymistä ja kypsymistä, GM-CSF vaikuttaa useampaan solutyyppiin, kuten makrofageihin ja eosinofiileihin.
  • GM-CSF stimuloi kantasoluja tuottamaan granulosyyttejä (neutrofiilejä, eosinofiilejä, basofiilejä) ja monosyyttejä. Monosyytit poistuvat verenkierrosta ja kulkeutuvat kudokseen, minkä jälkeen ne kypsyvät makrofageiksi ja dendriittisoluiksi. Siten se on osa immunologista ja tulehduksellista kaskadia, jossa vähäisen makrofagien määrän aktivaatio voi nopeasti johtaa niiden määrän kasvuun. Tämä on ratkaisevan tärkeää infektioiden torjunnassa. GM-CSF:llä on myös joitain vaikutuksia immuunijärjestelmän kypsiin soluihin. Näitä ovat esimerkiksi neutrofiilien kulkeutumisen tehostaminen ja solupinnalla ilmentyvien reseptorien muutoksen aiheuttaminen.
  • NKG2D on transmembraaniproteiini, joka kuuluu C-tyypin lektiinin kaltaisten reseptorien NKG2-perheeseen. NKG2D tunnistaa MIC:n ja RAET1 / ULBP-perheiden tuottamat proteiinit, jotka esiintyvät pahanlaatuisten, muuttuneiden ja infektoitujen solujen pinnalla. NKG2D on transformoituneiden ja infektoitujen solujen havaitsemisen ja tuhoamisen kannalta keskeinen tunnistusreseptori

    NK-soluissa NKG2D toimii aktivoivana reseptorina, joka kykenee laukaisemaan sytotoksisuuden. NKG2D:n tehtävä CD8+ T-soluissa on lähettää stimulointisignaaleja niiden aktivoimiseksi. Virukset solunsisäisinä patogeeneinä voivat aiheuttaa stressioligandien ilmentymistä NKG2D:lle.

    Solun vanhenemisen aikana solut säätelevät NKG2D-ligandien ilmentymistä, mikä mahdollistaa ikääntyvien solujen NK-välitteisen tappamisen rakeiden eksosytoosireitin kautta. Ikääntyvien solujen MICA- ja ULBP2-proteiinit tunnistaa NKG2D-reseptorin Natural Killer -soluissa, mikä on välttämätöntä vanhenevien solujen tehokkaalle tunnistamiselle ja eliminoinnille.

  • Perforiini on solun hajottamiseen osallistuva proteiini, jota tappaja-T-solut ja luonnolliset tappajasolut erittävät tuhotessaan kohdesolujaan. Virusinfektoituneen tai pahanlaatuiseksi muuttuneen solun tunnistaessaan tappaja-T-solu vapauttaa eksosytoosilla perforiinia ja grantsyymeja kohdesolun pinnalle. Solunulkoisen nesteen korkean kalsiumpitoisuuden vaikutuksesta perforiini liittyy kohdesolun solukalvoon, polymerisoituu ja muodostaa solukalvon läpäiseviä kanavia. Kanavien avulla solun sisälle kulkeutuu solunulkoisesta nesteestä kalsiumioneja, jotka käynnistävät kohdesolussa solukalvon korjausmekanismin. Tähän korjausmekanismiin sisältyy solukalvon vaurioituneiden osien ottaminen solun sisälle endosytoosilla. Muodostuviin endosytoosirakkuloihin kulkeutuu myös solukalvon pinnalta tappaja-T-solun erittämiä perforiini- ja grantsyymiproteiineja.
  • Grantsyymi vapautuu todennäköisesti perforiinin avustuksella endosytoosirakkuloista solulimaan, jossa se käynnistää kohdesolun apoptoitumisen.

CD4+ CD28-T-soluilla on vastaavia ominaisuuksia kuin synnynnäisillä T-soluilla. Yhdessä nämä solut voivat aiheuttaa vastaavan hermosolujen ja aksonien vaurioitumisen, kuin CD8+ T-solut.

On kuitenkin epäselvää, mitkä antigeenit tai biokemialliset tekijät laukaisevat ja / tai ohjaavat CD4+ CD28-T-solujen yleistymistä ja missä vaiheessa ne muuttuvat sytotoksisesti aktiivisiksi. Sytotoksinen aktiivisuus kuitenkin vaikuttaa kudosvaurioihin ja sen seurauksena MS-taudin etenemiseen.

Mikroglia-aktivaatio

Aktiivinen demyelinaatio ja neurodegeneraatio on yhdistetty mikroglia-aktivaatioon MS-taudin varhaisissa leesioissa. Mikroglia-solut aktivoivat aivojen parenkyymiä havaitsemaan vaarasignaaleja. Tämä tila näyttää toteutuvan lukuisissa vuorovaikutuksissa neuronien kanssa.

Tällaisia vuorovaikutuksia on kuvattu esimerkiksi CD200-CD200R-, CD47-CD172a- ja fraktalkiini-CX3CR1- välillä. Aivovaurion tai sairauden seurauksena nämä vuorovaikutukset estyvät ja mikroglia kehittyy fenotyypiltään ”aktiiviseksi”.

Tämä muutos voidaan aiheuttaa useilla mekanismeilla, kuten Th1- tai Th17-T-solujen erittämien tulehdusta edistävien sytokiinien tuotanto. Myös Tollin kaltaisten reseptorien (TLR) tunnistamien mikrobipatogeenien (PAMP) tai leusiinipitoisten toistuvien reseptorien (NLR) ilmentyminen, solunsisäisten komponenttien vapautuminen nekroottisista tai apoptoottisista soluista sekä lämpöshokkiproteiinien, väärin taittuneiden proteiinien (DAMP) tai komplementtikaskadin komponenttien läsnäolo johtaa vastaavaan mikroglia-aktivaatioon.

Mikrogia-aktivaatio ei rajoitu vaurioihin, mutta sitä esiintyy myös hajanaisesti normaalissa esiintyvässä valkoisessa ja harmaassa aineessa. Terveeltä vaikuttavassa valkeassa aineessa (NAWM) voi esiintyä aktivoituneen mikroglian klustereita. Näitä ns. Mikroglia-kyhmyjä, on runsaasti plakkien vieressä olevilla alueilla, etenkin potilailla, joilla on progressiivinen tautimuoto.

Mikroglia-kyhmyt on yhdistetty vaurioituneisiin aksoneihin, jotka ilmentävät amyloidiprekursoriproteiinin (APP) kertymistä, ja muutoksia neurofilamenttifosforylaatiossa periplakinissa* valkeassa aineessa.

  • Periplakiini on proteiini, jota ihmisissä koodaa PPL-geeni. Tämän geenin koodaama proteiini on osa desmosomien ja epidermaalisen kornifioidun vaipan keratinosyytteissä. Periplakiini muodostaa sauvadomeeninsa kautta komplekseja envoplakiinin kanssa. Tämä proteiini voi toimia linkkinä kornifioidun vaipan ja desmosomien sekä välifilamenttien välillä. AKT1 / PKB:n, proteiinikinaasin, joka välittää erilaisia solukasvun ja selviytymisen signalointiprosesseja, on ilmoitettu olevan vuorovaikutuksessa tämän proteiinin kanssa, mikä viittaa tämän proteiinin mahdolliseen rooliin lokalisointisignaalina AKT1-välitteisessä signaloinnissa. PPL:n (geeni) on osoitettu olevan vuorovaikutuksessa keratiini 8:n ja Envoplakinin kanssa.

Lisäksi on havaittu suoraa spatiaalista yhteyttä mikroglia-kyhmyjen ja Wallerian rappeutumista* sairastavien aksonien välillä. Nämä havainnot osoittavat, että mikroglia-aktivaatio liittyy hermosolujen vaurioiden ja kudosten atrofian merkkeihin, mikä viittaa vahvasti siihen, että mikroglia-solut vaikuttavat keskushermoston vaurioihin progressiivisessa MS-taudissa.

  • Wallerian rappeuma on aktiivinen rappeutumisprosessi, joka syntyy, kun hermokuitu katkeaa tai vahingoittuu ja aksonin distaalinen osa (eli kauempana hermosolun rungosta) rappeutuu.Tähän liittyvä taaksepäin tapahtuva rappeutumisprosessi, tunnetaan nimellä ’Wallerian-tyyppinen rappeuma’, esiintyy monissa neurodegeneratiivisissa sairauksissa, erityisesti niissä, joissa aksonikuljetukset ovat heikentyneet, kuten ALS ja Alzheimerin tauti.

    Wallerian rappeuma tapahtuu aksonivaurion jälkeen sekä ääreishermostossa (PNS) että keskushermostossa (CNS). Se esiintyy aksonin osassa, joka on distaalinen loukkaantumispaikasta, ja alkaa yleensä 24–36 tunnin sisällä vauriosta. Ennen rappeutumista aksonin distaaliosa pyrkii pysymään sähköisesti virittyneenä. Loukkaantumisen jälkeen aksonaalirunko ja aksonikalvo hajoaa.

Aksonaalista rappeutumista seuraa myeliinivaipan hajoaminen ja solujätettä siivoavien makrofagien lisääntyminen.MS-taudisssa mikrogliaalisten solujen aiheuttamat vauriot välittyvät erilaisten mekanismien kautta, mukaan lukien tulehdusta edistävien sytokiinien, kuten IL-1, IL-6, TNF-a ja IFN-y, eritys, fagosyyttinen aktiivisuus ja antigeenien esittely CD4+ T-solujen MHC-luokan II molekyylien kautta.

Tulehdukselliset sytokiinit voivat myös aiheuttaa mitokondrioiden vaurioita sekä hermosoluissa että gliasoluissa

Mikrogliasolujen tuottamat reaktiiviset happi- ja typpilajit (ROS / RNS) aiheuttavat suoraa vahinkoa hermosoluille sytokromi C-oksidaasin (COX1) menetyksen sekä mitokondrioiden soluhengitysketjuyhdistelmän IV-aktiivisuuden menetyksen seurauksena, mikä johtaa mitokondrioiden toimintahäiriöön.

Tärkeää on, että Fe2+:n vapautuminen solunulkoiseen tilaan loukkaantuneista oligodendrosyyteistä voi vahvistaa oksidatiivisia vaurioita muodostamalla H2O2:sta (vetyperoksidista) erittäin myrkyllisiä hydroksyyli (OH) -radikaaleja.

Aktivoidun mikroglian Fe2+:n saanti vaikuttaa niiden rappeutumiseen, mikä johtaa toiseen Fe2+:n vapautumisaaltoon. Se voi lisätä ympäröivien kudosten alttiutta vapaiden radikaalien ohjaamalle aksoneiden ja hermosolujen tuhoamiselle.

MS-taudin etenemiseen mahdollisesti liittyvät mekanismit

  1. Progressiivisessa MS-taudissa tulehdusilmiöt, jotka johtavat aksonin rappeutumiseen ja tuhoutumiseen, vaikuttavat keskushermostoon. Solukomponentteja edustavat solut (T- ja B-lymfosyytit) sekä paikalliset keskushermostosolut (mikroglia-solut ja astrosyytit).B-solut voivat muodostaa ektooppisia rakenteita, jotka muistuttavat tertiäärisiä imusolmukkeita, tuottamalla vasta-aineita myeliini- ja ei-myeliiniantigeenejä vastaan. Näillä on tärkeä rooli aksonaalisissa ja hermosoluissa tapahtuvassa vaurioitumisessa komplementtikaskadiaktivaation kautta. CD8+ -lymfosyytit voivat tunnistaa spesifiset aksonaaliset antigeenit ja tuottaa kudosvaurioita perforiinin tai gransyymien A ja B erityksen kautta.Autoreaktiiviset CD4+ Th1- ja Th17-lymfosyytit voivat aktivoida mikrogliaalisia soluja, jotka puolestaan tuottavat tulehdusta edistäviä sytokineja (IL-1, IL 6, TNF-a) tai hapen tai typen vapaita radikaaleja (ROS / RNS) aiheuttaen aksonivaurioita ja hermosolujen menetyksiä sivullisten mekanismin kautta.
  2. Demyelinaation jälkeen energiantarve kasvaa paranodaalisten myeliinisilmukoiden häiriöiden vuoksi. Hermosolujen ATP-tuotannon väheneminen johtaa Na+ / K+ -pumpun häiriöön. Tämä tuottaa jatkuvaa natriumvirtaa, joka ajaa käänteistä natrium / kalsiumvaihtoa ja aiheuttaa kalsiumin kumuloitumista aksoniin. Tämä puolestaan aktivoi hajoavia entsyymejä, kuten proteaasit, fosfolipaasit ja kalpaiinit, mikä johtaa edelleen hermosolujen ja / tai aksonien vaurioihin sekä heikentyneeseen ATP-tuotantoon.
  3. Aksonaalivauriot voivat johtua huonosta troofisesta (ravinnonottoon liittyvästä) tuesta. Oligodendrosyytit sieppaavat glukoosia verenkierrosta ja hajottavat sen glykolyysissä pyruvaateiksi, ATP-molekyyleiksi ja laktaatiksi. Solujen mitokondriot jatkavat pyruvaattien energia-aineenvaihduntaa sitruunahappokierrossa ja elektroninsiirtoketjussa. Vaihtoehtoinen energialähde aksoneille tulee astrosyytteihin varastoituneesta glykogeenistä, joka voidaan hajottaa glukoosiksi ja myöhemmin pyruvaatiksi tai laktaatiksi hapen saatavuuden mukaan.
  4. Useat mekanismit aiheuttavat mikroglia-aktivaation, mukaan lukien Th1- tai Th17-T-solut, mikrobipatogeenien (PAMP) läsnäolo, jotka Tollin kaltaiset reseptorit (TLR) tai leusiinipitoiset toistoa sisältävät reseptorit (NLR) tunnistavat; solunsisäisten komponenttien vapautuminen nekroottisista tai apoptoottisista soluista; lämpöshokkiproteiinien, väärin taittuneiden proteiinien (DAMP) tai komplementtikaskadin komponenttien läsnäolo.Kun ne mikroglia-solut aktivoituvat, ne saavat aikaan astrosyyttien aktivaation ja lisääntymisen, mikä johtaa astroglioosiin, eli reaktiivisten astrosyyttien lisääntymiseen

Progressiivisessa MS-taudissa aivokuoren demyelinoiduissa leesioissa ei ole tulehduksellisia lymfosyyttien tai makrofagien infiltraatteja, eikä niissä ole komplementtikerrostumia

Suurin osa fagosyyteista (syöjäsoluista) asemoituu mikrogliaan lähelle neuriitteja ja hermosolujen rakenteita. Aktivoidulla mikroglialla on myös joukko hermosoluja suojaavia neuroprotektiivisia toimintoja, kuten kuolleiden solujen yms. jätteiden fagosytoosi ja siivous, kasvutekijöiden tuotanto ja hermosolujen muokkaaminen.

Neuroprotektiivisten mikroglia-solujen erottaminen tulehdusta ehkäisevistä solutyypeistä on edelleen haaste mikroglia-solujen toiminnan tulkinnassa.

On epäselvää, kuinka varhaisessa vaiheessa MS-taudin aikana nämä rappeuttavat tapahtumat alkavat. Tulevat in vivo -tutkimukset, jotka yhdistävät mikroglia-aktivaation paikalliseen aivokuoren atrofian tai toimintahäiriön tasoon sekä vammaisuuden etenemiseen yksittäisillä koehenkilöillä, auttaisivat parantamaan ymmärrystä aivokuoripatologian seurauksista taudin eri vaiheissa.

Tässä yhteydessä mikroglia-positroniemissiotomografiakuvat (v) in vivo (PET) voisivat selventää aktivoidun mikroglian roolia MS-tautiin liittyvässä hermoston rappeutumisessa. Selektiivisen translokaattoriproteiinin (TSPO) radioligandin 11C-PK11195 käyttö mahdollistaa aktivoidun mikroglian havaitsemisen PET:llä. TSPO on proteiini, jota ilmentyy mikrogliaalisten solujen ulommalla mitokondriokalvolla, terveessä keskushermostossa matalilla tasoilla, mutta sitä säätelee mikroglia-aktivaatio, mikä tekee TSPO:sta herkän ”reaaliaikaisen” aktivaatiomarkkerin.

Keskushermostoon kohdistuvassa ei-neoplastisessa vaurioissa ilman BBB-vaurioita mikroglia on tärkein solupopulaatio, joka ilmentää TSPO:ta. Verisuonista peräisin olevat makrofagit, reaktiiviset astrosyytit ja verisuoniston endoteelisolut ilmentävät kuitenkin TSPO:ta. Kuvantamistutkimukset, joissa käytettiin TSPO-radioligandia 11C-PK11195, ovat osoittaneet, että mikrogliasolujen aktivaatio tapahtuu MS-taudin varhaisessa vaiheessa ja näyttää olevan yhteydessä invaliditeetin asteeseen ja aivojen atrofiaan.

SPMS-potilaiden NAWM:ssä TSPO:n sitoutuminen lisääntyy merkittävästi verrattuna ikään sovitettuihin terveisiin verrokkeihin. PET-kuvantamista voidaan käyttää myös erottamaan aktiiviset ja passiiviset krooniset vauriot. Hitaasti laajenevien kroonisten aktiivisten vaurioiden uskotaan edistävän MS-taudin etenemistä. Plakin kinetiikan havaitseminen in vivo tarjoaa todennäköisesti uutta tietoa taustalla olevasta patologiasta, joka ajaa progressiota.

Kuten muissakin neurodegeneratiivisissa häiriöissä, mikroglian lisääntyminen ja aktivaatio on ensisijainen mekanismi astrosytoosin taustalla

Vaikka tutkimuksissa astrosyytit selviytyivät tulehduksen ja ROS / RNS:n aiheuttamasta oksidatiivisesta stressistä, niissä oli silti vaurion merkkejä, mikä heijastui lähinnä solumorfologian ja molekyyliekspression muutoksiin.

Arpikudos koostuu pääasiassa astrosyyteistä, mutta vakavissa vaurioissa esiintyy myös vuorovaikutusta muiden solutyyppien, kuten oligodendrosyyttien esisolujen, ja fibromeningeaalisten solujen kanssa.

Astrosyytteissä on havaittu useita spesifisiä molekulaarisia ja morfologisia piirteitä reaktiivisen astroglioosin aikana sekä ihmisen patologiassa että eläinmalleissa, joista gliaalifibrillaarihappoproteiinin (GFAP), vimentiinin, nestiinin ja vähemmän tutkitun synemiinin säätely ovat tunnusmerkkejä.

Gliaaliarvet näkyvät MS-potilaiden kudoksissa ja ympäröivät demyelinoituneita alueita. Arpien muodostumisen merkitys näyttäisi olevan vahingoittuneiden keskushermoston alueiden eristäminen kudosten tuhoutumisen leviämisen estämiseksi.

Gliaaliarpien jäykkyys johtaa kuitenkin sekä remyelinaation että aksonien regeneroitumisen estymiseen. Molemmat vaikutukset välittyvät eri mekanismien kautta. Astrosyyttien FGF-2:n liiallinen eritys voi olla haitallista remyelinaatiolle, mikä puolestaan edistää oliogodendrosyyttien esiastesolujen (OPC) lisääntymistä ja eloonjäämistä, mutta estää niiden kypsymisen.

Toinen molekyyli, jolla näyttää olevan tärkeä rooli OPC:n kypsymisen estämisessä, on glykosaminoglykaanihyaluronaani (glycosaminoglycan hyaluronan), jota esiintyy solunulkoisessa matriksissa ja keskushermoston valkeassa aineessa. Hyaluronaanin kanssa paikallistuvat oligodendrosyytit ilmentävät näiden solujen kypsymätöntä fenotyyppiä, ja oligodendrosyyttien esiastesolujen in vitro -hoito hyaluronaanilla estää solujen kypsymisen.

Vahingoittuneiden alueiden astrosyytit vapauttavat estäviä solunulkoisia matriksimolekyylejä, jotka tunnetaan kondroitiinisulfaattiproteoglykaaneina (CSPG) ja jotka voivat vakavasti loukkaantuneilla alueilla vaikuttaa sekä kasvukartioarkkitehtuurin sytoskeletoniin (solun tukirankaan) että kalvokomponentteihin.

CSPG:t ovat molekyyliperhe, jolle on tunnusomaista proteiinisydän, johon on kiinnittynyt erittäin sulfatoituneita glykosaminoglykaaniketjuja (GAG). Neurokaani (eritetty) ja brevikaani (soluun sitoutunut) ovat tärkeimmät astrosyyttien tuottamat proteoglykaanit in vitro, ja molempien on osoitettu estävän aksonin kasvua keskushermostovaurioiden jälkeen.

On vahvaa näyttöä siitä, että astrosyytit tuottavat liikaa kondroitiinisulfaattiproteoglykaaneita, kun niistä tulee reaktiivisia, ja että CSPG:n estävä aktiivisuus riippuu GAG-pitoisuudesta, koska GAG-ketjujen poistaminen proteiinisydämestä tukahduttaa CSPG:n välittämän eston. Kondroitiinisulfaattiproteoglykaanien (CSPG) lisäksi muut astrosyyttien ilmentämät vähemmän tutkitut estomolekyylit voivat tukahduttaa aksonikasvua.

Efriinit (EPH) ja niiden reseptorit erittyvät esimerkiksi normaalien astrosyyttien toimesta ja lisääntyvät MS-vaurioissa, mikä aiheuttaa aksonikasvukartion romahtamisen aktivoimalla aksoniin sitoutuneen EPH-tyrosiinireseptorikinaasin.

Astrosyytit osana immuunijärjestelmää voivat edistää MS-taudin etenemistä useiden mekanismien avulla

Ensinnäkin ne voivat vaikuttaa suoraan solujen pääsyyn keskushermostoon veri-aivoesteen läpi säätelemällä adheesiomolekyylien – erityisesti verisuonten adheesiomolekyyli-1 (VCAM-1) ja solujen välinen adheesiomolekyyli-1 (ICAM-1), ilmentymistä.

Toiseksi astrosyytit erittävät erilaisia kemokiinejä, kuten CCL-2 (MCP-1), CCL5 (RANTES), IP-10 (CXCL10), CXCL12 (SDF-1) ja IL-8 (CXCL8), jotka houkuttelevat perifeerisiä immuunisoluja ( esim. T-solut, monosyytit ja DC:t) sekä paikallisia keskushermostosoluja (mikroglia) vaurioalueille.

Astrosyytit voivat erittää GM-CSF:ää, M-CSF:ää tai TGF-β: ta, jotka säätävät MHC-luokan II molekyylien ilmentymistä mikroglialla ja jopa niiden fagosytoosia

Tämä voisi olla ensisijainen mekanismi, jonka kautta astrosyytit jatkavat immuunivälitteistä demyelinaatiota ja hermoston rappeutumista.

Hiljattain tehdyt eläintutkimukset havaitsivat, että EAE:n kroonisissa vaiheissa astrosyyttien ehtyminen lievittää taudin vakavuutta. Tämä astrosyyttien vahingollinen vaikutus EAE:ssa välittyy ensisijaisesti 4-galaktosyylitransferaasin 5 ja 6 (B4GALT5 ja B4GALT6) vaikutuksesta.

B4GALT6:tta ilmentävät myös reaktiiviset astrosyytit ihmisen MS-leesioissa. Nämä entsyymit syntetisoivat signalointimolekyylin laktosyyliseramidia (LacCer), jonka keskushermostossa ilmentyminen lisääntyy merkittävästi EAE:n progressiivisten vaiheiden aikana.

LacCer edistää astrosyyttien aktivaatiota autokriinisellä tavalla indusoimalla GM-CSF- ja CCL2-geenejä, aktivoimalla mikrogliaa ja aiheuttamalla vastaavasti monosyyttien tunkeutumista verestä.

B4GALT6:n estäminen hiirikokeissa pysäyttää keskushermoston neurodegeneraation EAE:ssa ja hillitseee myös ihmisen astrosyyttien aktivaatiota in vitro

Astrosyytit ilmentävät normaalissa keskushermostossa pysyvää (konstitutiivista) B-solua aktivoivaa tekijää (BAFF), joka on välttämätöntä B-solujen kehitykselle ja immunoglobuliinituotannolle.

MS-vaurioissa ja EAE:ta sairastavissa hiirissä BAFF:n ilmentymistä astrosyytteissä säätelee lisääntyvä vaste ärsykkeelle (up-regulated), mikä viittaa siihen, että astrosyytit voivat edistää B-soluista riippuvaisen autoimmuniteetin kehittymistä.

Luontaisten immuunisolujen tärkeä tehtävä on toimia antigeeniä esittelevinä soluina. Vaikka astrosyytit ilmentävät MHC-luokan I ja luokan II molekyylejä, jotka kykenevät esittelemään myeliiniantigeenejä, niiden kyky ilmentää myös stimuloivia molekyylejä, kuten CD40, CD80 ja CD86, haastaa tämän toiminnon, mikä tekee niiden lopullisesta vaikutuksesta epäselvän.

Sen lisäksi, että astrosyytit ovat osa immuunijärjestelmää, ne edistävät MS:n etenemistä tuottamalla sytotoksisia tekijöitä.

Jyrsijöillä IL-17- ja IFN-y-stimuloidut astrosyytit aiheuttavat typpioksidisyntaasia (iNOS). IL-1 ja yhdistetty altistus TGF-β:lla ja IFN-y:llä lisää astrosyyttien erittämän typpioksidin (NO) prosentuaalista osuutta, mikä on yksi merkittävimmistä vaurioita aiheuttavista molekyyleistä hermoston rappeutumisessa.

NO (typpioksidi) stimuloi glutamaatin vapautumista astrosyyteistä, mikä lisää edelleen hermosolun jatkuvaa stimulaatiota välittäjäaine glutamaatilla (eksitoksisuutta, joka on häiriö glutamaatin aineenvaihdunnassa).

Typpioksidin (NO) hallitseva osuus eksitotoksisuuteen (eli glutamaatin aineenvaihduntahäiriöön) riippuu lisääntyneestä superoksidi-ioni O2-tuotannosta, joka reagoi typpioksidin kanssa muodostaen peroksinitriitin (ONOO−) ja johtaa hermosolujen nekroosiin (kuolio) tai apoptoosiin (ohjattu solukuolema) sen pitoisuudesta riippuen.

Peroksinitriitti inaktivoi glutamaattikuljettimet astrosyytteissä vahingoittamalla suoraan myeliiniä, oligodendrosyyttejä ja aksoneja

Astrosyyttien kuljettajien vähentynyt glutamaatin saanti voi myös vaikuttaa epänormaaliin solunulkoisen glutamaattitasoon, joka on myrkyllistä oligodendrosyytteille, aksoneille ja neuroneille.

Eksitotoksisuus johtuu pääasiassa glutamaattireseptorien pitkäaikaisesta aktivoitumisesta ja massiivisesta Ca2+ -virtauksesta elinkelpoisiin hermosoluihin, mikä puolestaan johtaa muutoksiin mikrotubuluksissa ja neurofilamenttien fosforylaatiossa, ja aiheuttaa lopulta aksonin tukirangan hajoamiseen.

Astrosyytteillä on kaksoisrooli, joka ei ainoastaan edesauta aksonin rappeutumista, vaan myös luo sallivan ympäristön, joka edistää remyelinoitumista. Astrosyyttien todellinen vaikutus MS-taudin patogeneesiin ja tulehduksen korjaamiseen riippuu siis useista tekijöistä, kuten loukkaantumisen jälkeinen ajoitus, vaurion tyyppi ja ympäröivä mikroympäristö sekä vuorovaikutus muiden solutyyppien kanssa ja niiden aktivoitumiseen vaikuttavat tekijät.

Ionikanavien ja aksonivaurioiden uudelleenjakautuminen

Koska patologiset tulokset ja tulehdukseen liittyvien aksonien määrä korreloivat MS-taudin tulehdusasteen kanssa, suuri kiinnostus kohdistuu synnynnäisen immuunijärjestelmän vapauttamiin neurotoksisiin tuotteisiin, kuten makrofageihin, mikroglia-soluihin ja astrosyytteihin.

Mitokondriot ja mitokondrioiden DNA (mtDNA) ovat erittäin alttiita hapettumisvaurioille. ROS ja RNS aiheuttavat mitokondrioihin entsyymivajetta, joka voi olla joko palautuva tai peruuttamaton.

MS-taudissa aktiiviset leesiot osoittavat mitokondrioiden diffuusia vaurioitumista, mikä tekee energian puutteellisesta saannista tärkeimmän mekanismin toiminnallisten ja rakenteellisten oireiden taustalla.

Progressiivisessa MS-taudissa mitokondriovauriot ilmenevät harmaassa aineessa. Aivokuoren syvemmissä kerroksissa olevat hermosolujen soluelimet osoittavat sekä heikentynyttä mitokondrioiden aktiivisuutta hengitysketjukomplekseissa että muutoksia moottoriproteiineissa, jotka ovat vastuussa mitokondrioiden liikkumisesta solurungosta aksoneihin.

Aksonaalikuljetus on välttämätöntä hermosolujen terveydelle, ja se on osallisena erilaisissa hermostoa rappeuttavissa olosuhteissa. Mitokondrioita, kuten muita kalvorakenteita, kuljettaa aksonia pitkin kaksi suurta mikrotubuluspohjaisten molekyylimoottorien perhettä, kinesiiniperhe, joka välittää anterogradisen kuljetuksen pois solurungosta aksoniterminaaliin päin, ja sytoplasmallinen dyneiini, joka ajaa retrogradista liikettä distaalisesta aksonista kohti solurunkoa.

Progressiivista MS-tautia sairastavilla kinesiinin vähenemisen aiheuttamaa mitokondrioiden kuljetusvajetta esiintyy erityisesti ei-demyelinoidussa aivokuoressa. Tällaiset muutokset edeltävät rakenteellisia aksonivaurioita ja morfologisia muutoksia mitokondrioissa.

Etenevässä MS-taudissa syvempien aivokuorikerroksien neuroneissa esiintyy mitokondrioita, joissa on mtDNA-deleetioita, mikä viittaa solujen kiihtyneeseen ikääntymiseen

Deleetion taustalla on useimmiten kromosomin katkeaminen kahdesta eri kohdasta, jolloin irronnut pala häviää. Tämän seurauksena väistämättä myös osa perintöaineksesta eli geeneistä häviää, mikä aiheuttaa kehityshäiriöitä. Deleetion seurauksena vastinkromosomin resessiivisetkin alleelit tulevat näkyviin fenotyypissä.

Mitokondrioiden poikkeavuuksien seuraukset hermosolujen rungoissa ja aksoneissa ovat kaksinkertaiset.

Ensinnäkin mitokondrioiden toimintahäiriö johtaa energian puutteeseen, joka lievissä muodoissa aiheuttaa toiminnallisia häiriöitä ilman rakenteellisten vaurioita. Kuitenkin, kun vaurio ylittää tietyn kynnyksen, energian puute johtaa aksonin rappeutumiseen ja solukuolemaan.

Kun hermosysteemi on menettänyt varauksensa, se on kyvyttömämpi spontaaniin toipumiseen. Siten sen kyky toiminnalliseen parantumiseen on heikentynyt.

Toiseksi mitokondriovauriot vahvistavat oksidatiivista stressiä vapauttamalla happiradikaaleja, jotka syntyvät heikentyneen soluhengitysketjun toiminnan seurauksena, mikä luo kudoksen tuhoutumisen kierteen. Demyelinaation jälkeen seuraa tiettyjen Na+ -kanavien isoformien (Nav 1.1 ja Nav 1.6) uudelleenjakautuminen myymeloimattomalla segmentillä, mikä johtaa lisääntyneeseen natriumvirtaan.

Na+ -kanavien varhainen uudelleenjako MS-plakkien ja EAE:n valkeassa aineessa hajonneilla aksoneilla mahdollistaa toimintapotentiaalien jatkumisen MS-taudin kliinisen toiminnan palautumisen yhteydessä.

Nav 1.6 tuottaa pysyvän sähkövirran, joka on suurempi kuin Nav 1.2:n, on paikallistettu Na+ / Ca2+ -vaihtimen ja APP:n kanssa, mikä viittaa aksonin vaurioitumiseen. Nav 1.2 voi puolestaan edistää mukautuvaa toimintoa, jolla on rajallinen kyky ylläpitää toimintapotentiaalien korkeataajuista johtumista. Ne voivat myötävaikuttaa hitaaseen depolarisoitumiseen edistämällä ulkoisia polttomalleja demyelinaation jälkeen.

Mitokondrioiden hidas aksonaalinen kuljetus sekä mitokondrioiden vauriot voivat johtaa Na+ / K+ ATPaasipumpun vaurioitumiseen, mikä tuottaa pysyvän natriumvirran. Aksoplasmaan kertynyt Na+ korvataan Ca2+:lla Na+ / Ca2+ -vaihtimen käänteisen toiminnan kautta.

Lisääntynyt intraaksonaalinen Ca2+ aktivoi erilaisia katabolisia entsyymejä, mukaan lukien proteaasit, fosfolipaasit ja kalpaiinit, mikä lopulta johtaa solun tukirangan proteiinien progressiiviseen proteolyyttiseen hajoamiseen.

Solunsisäinen Ca2+: n kasvu johtaa mikrotubulusten ja neurofilamenttien (NF) fosforylaation muutoksiin, mikä aiheuttaa solun tukirangan (sytoskeletti) hajoamisen. Lisää vahingollista Ca2+:n kertymistä aksoneihin aiheutuu L- ja N-tyypin Ca2+ -kanavien sisäänvirtauksen kautta sekä vapautumalla solunsisäisistä varastoista aksoplasmisessa verkkokalvossa. Epänormaali Ca2+:n aksonaalinen kertyminen voi johtua myös glutamaattineurotoksisuudesta, joka muuttaa solunsisäistä Ca2+-homeostaasia aksonien AMPA / kainaatti- ja metabotrooppisten glutamaattireseptorien välittämän mekanismin kautta.

Na+ -kanavien lisäksi muilla ionikanavilla on rinnakkaisia adaptiivisia muutoksia tulehduksellisiin ärsykkeisiin: esim. muuttamalla niiden jakautumista hermosoluissa alkukompensoivana mekanismina johtokyvyn ja aksonin eheyden säilyttämiseksi.

Jänniteportoitujen Ca2+ -kanavien uudelleenjako, transienttipotentiaalireseptorit melastatiini 4 (TRPM4) ja happoa tuntevat ionikanavat 1 (ASIC1) aiheuttavat ylimääräistä Ca2+ -kuormitusta aiheuttaen edelleen vaurioita aksoneihin.

Neurofilamenttien epänormaalit kertymät ovat monien neurodegeneratiivisten häiriöiden patologinen tunnusmerkki

Neurofilamentit (NF) luokitellaan tyypin IV välituotesäikeiksi, joita esiintyy neuronien sytoplasmassa. Ne ovat proteiinipolymeerejä, joiden halkaisija on 10 nm ja pituus monta mikrometriä. Yhdessä mikrotubulusten (~ 25 nm) ja mikrofilamenttien (7 nm) kanssa ne muodostavat hermosolujen tukirangan (sytoskeletin).

Niiden uskotaan toimivan ensisijaisesti aksoneiden rakenteellisena tukena ja aksonin halkaisijan säätelijänä. Halkaisijaa vaikuttaa hermon johtumisnopeuteen. Neurofilamentteja muodostavat proteiinit ovat välifilamenttiproteiiniperheen jäseniä, joka on jaettu kuuteen tyyppiin niiden geenijärjestelyn ja proteiinirakenteen perusteella.

Tyypit I ja II ovat keratiinit, jotka ilmentyvät epiteelissä. Tyyppi III sisältää proteiinit vimentiini, desmiini, perifeeri ja gliaalifibrillaarihappoproteiini (GFAP). Tyyppi IV koostuu neurofilamenttiproteiineista L, M, H ja internexiinista. Tyyppi V koostuu ydinlaminoista ja tyyppi VI koostuu proteiinista nestiini. Tyypin IV välifilamenttigeeneillä kaikilla on kaksi ainutlaatuista intronia, joita ei löydy muista välifilamenttigeenisekvensseistä, mikä viittaa yhteiseen evoluutiolähteeseen yhdestä primitiivisestä tyypin IV geenistä.

Neurofilamentin kevyen (NfL), keskiraskaan- (NfM) ja raskaan ketjuproteiinin (NfH) alayksiköiden rooli neurodegeneraation ja aksonivaurioiden biomarkkereina kiinnostaa tutkijoita, koska ne ovat solun tukirangan eli sytoskeletin rakennustelineitä. Neurofilamenteilla on tärkeä rooli aksonin radiaaliselle kasvulle ja vakaudelle, mikä mahdollistaa hermon tehokkaan johtumisnopeuden sekä dendriittisen haarautumisen ja kasvun.

Neuroflamentteja esiintyy yksinomaan hermosoluissa. Niiden määrä saavuttaa epänormaalin tason aksonivaurioiden ja lopulta hermosolujen kuoleman seurauksena. Normaaleissa olosuhteissa neurofilamentit ovat erittäin vakaita aksonien sisällä ja niiden vaihtuvuus on vähäistä.

Aksonaalisia vaurioita aiheuttavat patologiset prosessit vapauttavat neurofilamentti-proteiineja selkäydinnesteeseen (CSF) ja perifeeriseen vereen vahingon laajuudesta riippuen

MS-taudin tutkimukset ovat osoittaneet että NfLn määrä selkäydinnesteessä liittyi taudin aktiivisuuden ja invaliditeetin asteeseen. Lisäksi NfL:n määrä selkäydinnesteessä laskee taudin modifiointiterapioiden seurauksena, mikä viittaa siihen, että NfL:ää voidaan käyttää terapian tehon seuraamiseen.

Lupaavista MS-tautiin liittyvistä kliinisistä löydöksistä huolimatta merkittävä este NfL-arvioinnin laajalle soveltamiselle MS-tutkimuksessa ja kliinisessä käytännössä on ollut selkäydinnesteen näytteenoton tarve, ongelma, joka on voitettu käyttämällä neljännen sukupolven immunomäärityksiä, jotka mahdollistavat seerumin NfL-tasojen arvioinnin.

Seerumin korkeat NfL-tasot korreloivat MS-taudin vakavuuden ja ivalidisoitumisen kassa. Lääkehoitoa saavilla potilailla on matalampi seerumin NfL-arvo kuin hoitamattomilla potilailla, mikä osoittaa, että muutos NfL-tasoissa on kertoo hoitovasteesta.

Potilailla, joiden seerumin NfL-tasot olivat korkeat jo taudin alussa, esiintyi huomattavasti enemmän aivojen ja selkäytimen atrofiaa 2 ja 5 vuoden seurannan aikana. Nämä havainnot osoittavat yhdessä, että seerumin NfL-tasot voivat olla hyödyllinen merkki aksonivaurioista, kun käytetään riittävää havainnointitekniikkaa.

Myeliinitroofismin häiriö johtaa aksonaaliseen rappeutumiseen

Troofismi viittaa solun ja kudoksen ravinnonottoon. Vaikka myeliiniä pidetään perinteisesti passiivisena eristävänä rakenteena, viimeisimmät havainnot osoittavat, että sillä voi olla dynaamisempi rooli. Myeliini on metabolisesti aktiivinen, mikä sallii makromolekyylien liikkumisen periksonaaliseen tilaan, mikä vaikuttaa merkittävästi aksonien terveyteen ja hermosolujen selviytymiseen.

Kun myelinaatio on saatu päätökseen, oligodendrosyyttien päätehtävä on tarjota runsaasti energiaa sisältäviä substraatteja aksoneille, joita tarvitaan nopeaan aksonaaliseen kuljetukseen. Lisäksi resurssien tehokkaaseen rekrytointiin on olemassa kaksisuuntainen signalointi, jolloin aksonit ilmoittavat myelinisoiville soluilleen aineenvaihduntatarpeet suhteessa aktiivisuuteensa.

Myeliinivaippaa ja sen alapuolista aksonia tulisi sen vuoksi pitää funktionaalisena yksikkönä, joka on kytketty paitsi morfologisella, myös metabolisella tasolla. Eläintutkimukset ovat osoittaneet, että oligodendrosyyteillä on kriittinen rooli aksonien ja neuronien ylläpidossa ja pitkäaikaisessa selviytymisessä.

Oligodendrosyyttispesifisen Plp1-geenin mutaatiot, jotka koodaavat PLP / DM20: ta myeliinivaipan rakenteelliseksi komponentiksi, kehittävät progressiivista aksonaalista keskushermoston rappeutumista vanhemmassa iässä.

Jokaisella oligodendrogliaalisella proteiinilla on erillinen rooli myelinisoidun aksonin toiminnan tukemisessa. Aksonaalista rappeutumista edeltävä aksonipatologia sisältää muuttuneen aksonikuljetuksen ja aksonimunan muodostumisen. Nämä havainnot ovat näkyvämpiä paranodaalisilla alueilla, joilla myeliini-aksonaalinen viestintä tapahtuu todennäköisimmin, ja muistuttavat suuresti MS-potilaiden keskushermostokudoksessa havaittuja muutoksia. Eläinmallien havainnot viittaavat siihen, että oligodendrosyyttien myeliiniä tuottava funktio ei liity niiden rooliin aksonin säilyttämisessä ja että oligodendrosyytit itse ovat kriittisiä aksonitoiminnon ylläpitämiselle ja selviytymiselle.

Kehityksensä aikana oligodendrosyytit hyödyntävät glukoosia ja laktaattia, jotta nopea myelinaatio syntetisoisi suuria määriä lipidejä.

Kun myelinaatio on valmis, oligodendrosyytteistä peräisin oleva laktaatti ja pyruvaatti voidaan ottaa mitokondrioiden ATP-tuotantoon, mikä tukee solujen energiantarpeita. Kokeet ovat osoittaneet, että monokarboksyylihappokuljettajat (MCT) ovat kriittisiä aksonaalisen eheyden ylläpitämiseksi.

Sekvenssihomologian perusteella on tunnistettu 16 MCT-jäsentä, joista vain MCT1, 2 ja 4 löytyvät keskushermostosta. Kun oligodendrosyytit keräävät solunsisäistä laktaattia, tämä substraatti voi virrata MCT1:n läpi periksonaaliseen tilaan, jossa neuronit sieppaavat sen MCT2:n kautta ja metabolisoivat sen energiantarpeen täydentämiseksi.

Erityisesti MCT1:n sekä geneettinen että farmakologinen alasregulaatio*, jota esiintyy melkein yksinomaan oligodendrosyyteissä, johtaa aksonin rappeutumiseen ja hermosolujen menetykseen sekä in vivo (elävässä organismissa) että in vitro (koeputkessa) ilman ilmeisiä oligodendrosyyttien vaurioita.

*alasregulaatio on prosessi, jossa solu vähentää solukomponentin, kuten RNA: n tai proteiinin määrää vasteena ulkoiselle ärsykkeelle

Vaikka edellä mainitut havainnot tarjoavat vahvaa näyttöä oligodendrosyyttien roolista aksonien suorassa energiantuotannossa, myös muut solut, kuten astrosyytit, voivat osallistua. Astrosyytit ovat pohjimmiltaan ainoat solut, jotka sisältävät glykogeenia keskushermostossa, ja glykogeenimetabolia, jota seuraa glykolyysi, tarjoaa laktaatin lähteen muille soluille. Tutkimukset osoittavat, että astrosyytit siirtävät energiametaboliitteja suoraan oligodendrosyytteihin, jotka puolestaan tukevat hermosolujen ja aksonien aineenvaihduntaa, kuten aiemmin on käsitelty.

Astrosyyttien ja myelinoivien solujen väliset yhteydet tapahtuvat konneksiinien (Cx) muodostamien aukkoyhteyksien kautta. Nämä aukkoyhteydet käsittävät Cx32:n ja Cx47:n ilmentyneinä oligodendrosyyteillä, jotka muodostavat heteromeerisiä kanavia astrosyyttien kanssa Cx30:n ja Cx43:n kautta.

Cx43:n menetys estää glukoosin kulkeutumisen oligodendrosyyttisolujen kantasoluihin ja niiden lisääntymiseen, mikä puolestaan voi vaikuttaa oligodendrogeneesiin ja oligodendrosyyttien metaboliseen tukeen.

Kaiken kaikkiaan nämä havainnot tarjoavat uusia näkökulmia oligodendrosyyttien ja astrosyyttien roolista MS-taudin patogeneesissä. Kaksisuuntaisten signalointireittien tunnistaminen, joilla oligodendrosyytit vaikuttavat aksonimetaboliaan, on erittäin merkityksellistä MS-taudin etenemisen ymmärtämiseksi.

Efektiivisten MS-taudin tehokkaiden hoitomuotojen tunnistaminen on edelleen prioriteetti ja haaste MS-yhteisölle

Uusien ja tehokkaiden hoitostrategioiden kehittämiseksi on tarpeen ymmärtää paremmin tautiin liittyvät patologiset mekanismit.

Tässä artikkelissa kirjoittajat ovat tiivistäneet joitakin tärkeimmistä mekanismeista, jotka liittyvät MS-taudin etenemiseen. Epäilemättä lisätutkimukset johtavat parempaan ymmärrykseen demyelinaatio- / remyelinoitumisprosesseista sekä gliasolujen merkityksestä hermosolujen homeostaasissa ja hermosolujen rappeutumisessa.

Tehokkaiden hoitomuotojen kehittäminen riippuu suurelta osin taudin patogeneesin kattavasta ymmärryksestä, eläinmalleista, jotka sisältävät nämä patogeeniset ominaisuudet, uusista koemalleista sekä uusista lääkäreiden ja perustutkijoiden yhteistyömalleista.

Pahoittelen, jos tekstiin jäi kirjoitus- tai asiavirheitä. Aineevaihduntaa ja biokemiallisia prosesseja käsittelevän tekstin ymmärrettäväksi suomentaminen on haastavaa. Minäkin vasta harjoittelen. Aihe on kuitenkin tavattoman kiinnostava.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6466454/




Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa 1

Sairastan ensisijaisesti etenevää multippeliskleroosia, johon ei tunneta hidastavaa, tai parantavaa lääkitystä. Primaaristi progressiivinen MS-tauti tunnetaan edelleen heikommin, kuin selvästi yleisempi aaltoilevasti etenevä relapsoiva-remittoiva MS.

Usein MS-taudista puhuttaessa unohdetaan, että relapsoiva-remittoiva MS-tauti ja primaaristi progressiivinen MS-tauti eroavat taudin etenemisen suhteen merkittävästi toisistaan. Tautimuodot ovat luonteiltaan kuin kesä ja talvi.

Yritän parhaani mukaan levittää tietoa PPMS-taudin syistä ja vaikutusmekanismeista. Etsin myös aktiivisesti tietoa keinoista, jolla taudin neurodegeneratiivista etenemistä voisi hidastaa.

En usko, että monitekijäisiin ongelmiin on yksinkertaisia tai helppoja vastauksia

Tämäkin on pitkä ja vaikeatajuinen aineenvaihduntaa ja biokemiaa sivuava kirjoitus, jonka sisäistäminen vie aikaa. Tämä on toistaiseksi täsmällisin selvitys etenevän MS-taudin patogeneesista, jonka olen lukenut. Jaan artikkelin kahteen osaan, joista tämä on ensimmäinen.

Avaan tässä Jorge Correalen, Mariano Marrodanin ja María Célica Ysrraelitin laatimaa tutkimuskatsausta: Mechanisms of Neurodegeneration and Axonal Dysfunction in Progressive Multiple Sclerosis

Progressiivinen multippeliskleroosi on monitekijäinen neurologinen sairaus, joka vaurioittaa aivojen kortikaalisten alueiden ja harmaan aineen soluja

Taudille tyypillinen oireiden asteittainen paheneminen johtuu erilaisista mekanismeista ja keskushermostoon rajoittuneista immuunireaktioista, kuten:

  1. B-solujen dysregulaatio (eli B-solujen säätelyvirhe)
  2. CD8+ T-solut, jotka aiheuttavat demyelinaation ja/tai aksonaaliset / hermosolujen vauriot
  3. aivokuoren demyelinoivissa vaurioissa havaittu neuriittiseen transaktioon liittyvä mikrogliaalinen soluaktivaatio

Muita mahdollisia neurodegeneraation aiheuttajia ovat reaktiivisten happi- ja typpiradikaalien muodostuminen ja solujen energiantuotantoa heikentävät mitokondrioiden vauriot.

Ca2+:n kertyminen aksoneihin lisää solujen rappeutumista aktivoimalla eräitä katabolisia entsyymeitä, mikä johtaa sytoskeletoniproteiinien, eli solun tukirangan proteiinien progressiiviseen proteolyyttiseen hajoamiseen.

Oligodendrosyyttien aksoneille tuottaman energian väheneminen johtaa aksonien rappeutumiseen ja siten hermosolujen vaurioitumiseen ja tuhoutumiseen. Nämä mekanismit eivät poissulje toisiaan.

Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa

Aivot ja selkäydin

 


Tässä katsauksessa sukelletaan syvälle aivoihin ja aivojen kemiallisiin tapahtumiin.

Multippeliskleroosi on aivoihin ja selkäytimeen vaikuttava neurologinen sairaus, jonka oireita on helpompi ymmärtää dissektoimalla aivot erilaisiin toiminnallisiin segmentteihin.

Keskushermostoon kuuluvat isot aivot, pikkuaivot, aivorunko ja selkäydin. Keskushermosto saa informaatiota ääreis- eli perifeerisestä hermostosta. Aivojen signaalit lihaksille ja umpieritysrauhasille välittyvät myös ääreishermoja pitkin.

Tietoisuus ja tahdosta riippuvainen toiminta on keskittynyt isoihin aivoihin. Pikkuaivot orkestroivat tahdosta riippumattomia toimintoja tai toteuttavat isojen aivojen käskyjä. Pikkuaivoilla on tärkeä rooli motorisen muistin hallinnassa ja opittujen liikeratojen suorittamisessa. Pikkuaivot liittyvät aivorungon takaosaan pikkuaivovarsien (pedunculus cerebelli) välityksellä.

Aivorunko sisältää motorisia ja sensorisia hermoratoja sekä yhteyksiä aivojen eri osien välillä. Aivorungossa on myös paljon hermosolurykelmiä, eli tumakkeita, jotka säätelevät tiedostamattomia elintoimintoja, kuten hengitystä.

Ylhäältä katsoen aivorunko muodostuu väliaivoista (diencephalon), keskiaivoista (mesencephalon), aivosillasta (pons) ja ydinjatkoksesta (medulla oblongata). Väliaivoissa on hormonitoimintaa säätelevä hypotalamus sekä talamus, jonka solujen kautta aistien lähettämät signaalit hajua paitsi, välittyvät aivokuorelle.

Selkäydin sisältää ensisijaisesti lihasten ohjaamiseen ja tuntoaistimusten välittämiseen liittyviä hermoratoja. Toisaalta selkäytimen neuronit hallitsevat eräitä automaattisia reflektireaktioita ja ohjaavat eräitä automaattisia toimintoja, kuten kävelyn säätelyä.

Aivot kelluvat aivo-selkäydinnesteessä (cerebrospinal fluid / CSF), joka suojaa aivojen herkkiä rakenteita fyysisenä ja kemiallisena puskurina. CSF suojaa aivoja mm. iskuilta.

Kaksi aivopuoliskoa (hemispheres) käsittävät isot aivot koostuvat aivokuoresta (cortex), valkeasta aineesta harmaan sisäpuolella sekä tyvitumakkeista (basal ganglia). Basaaligangliat ovat hermosolujen kasaumia, joilla on yhteyksiä liikettä ohjaaviin aivokuoren alueisiin sekä pikkuaivoihin.

Valkea aine koostuu lähinnä aivoon tulevista ja aivoista lähtevistä sekä aivokuoren eri osien välisistä aksonikimpuista (viejähaarakekimpuista), joiden myeliinitupit antavat valkealle aineelle värin.

Aivokuori jaetaan neljään lohkoon kummallakin aivopuoliskolla. Etummaisena on otsalohko (lobus frontalis). Sen takana on päälaenlohko (lobus parietalis). Näiden väliin jäävä uurre on keskusvako (sulcus centralis). Sivuvaon (sulcus Sylvii) alapuolella on ohimolohko (lobus temporalis). Takaraivolohko (lobus occipitalis) on aivojen takaosassa.

Aivokuori näyttää pinnallisesti tarkasteltuna melko samanlaiselta kaikkialta, mutta solutyyppien jakauman, aivokuoren kerrosrakenteen, metabolian, yhteyksien sekä toiminnallisten erojen vuoksi kukin lohko on jaettu lukuisiin aivoalueisiin. Ensimmäinen systemaattinen jako oli histologinen: saksalainen Brodmann numeroi aivoalueet siinä järjestyksessä kun hän uusia kudosrakenteita löysi.

Aivokuoren sytoarkkitehtoniset alueet Brodmannin mukaan. Tärkeimmät alueet ovat motorinen aivokuori (alue 4), tuntoaivokuori (1,2 ja 3), näköaivokuori (17,18 ja 19) sekä kuuloaivokuori (41 ja 42). Muut alueet muodostavat ihmisen aivoissa erityisen laajoiksi kehittyneet assosiatiiviset osat.

 


Aivokuoren eri alueet ja aivoalueiden osat ovat kytkeytyneet toisiinsa assosiaatiosyiksi kutsuttujen valkean aineen aksonikimppujen välityksellä. Aivopuoliskojen välisiä yhteyksiä kutsutaan kommissuraalisyiksi. Kommissuraalisyiden pari miljoonaa aksonia muodostaa aivokurkiaisen (corpus callosum), joka on suurin aivopuoliskojen välinen tiedonsiirtoväylä.

Aisteista tulevat (afferentit) signaalit (hajua lukuunottamatta) välittyvät talamuksen kautta; talamuksen ja korteksin yhteydet ovat kaksisuuntaiset, ts. aivokuorelta on voimakas takaisinkytkentä talamukseen.


Suurin hermosäiekimppu talamuksesta aivokuorelle on optinen radiaatio (optic radiation) ulommasta polvitumakkeesta näköaivokuorelle. Motoriset (efferentit) viestit taas vällittyvät pitkin capsula internaa aivokuorelta aivorunkoon. Tämä vahva hermosäiekimppu menee talamuksen ja tyvitumakkeiden välistä.

Keskushermosto on sekä vasemmalta että oikealta puoleltaan yhteydessä ulkomaailmaan 12 aivohermon (cranial nerves) ja 31 selkäydinhermon (spinal nerves) kautta. Aivohermot ovat yhteydessä pään seudun aisteihin ja lihaksiin.

Selkäydinhermot palvelevat muuta osaa kehosta. Niiden kautta saapuvat afferentit hermoradat menevät ensin talamukseen ja sieltä aivokuorelle. Selänpuoleiset hermoradat (dorsal columns) vievät selkäytimen yläpäässä oleviin tumakkeisiin, joista signaalit etenevät lemniscus medialista pitkin talamuksen vastakkaiseen puoliskoon ja sieltä edelleen tuntoaivokuorelle (alueet 1, 2 ja 3).

Pikkuaivot koostuvat kahdesta voimakkaasti poimuttuneesta puoliskosta. Pikkuaivokuoren (cortex cerebelli) sisäpuolella on myelinisoitujen aksonien muodostamaa valkeaa ainetta. Pikkuaivokuori on kauttaaltaan samanlainen, joten sen eri alueet luultavasti käsittelevät saamansa tiedon samalla tavalla.

Pikkuaivot säätelevät lihasliikkeitä ja liikesarjoja (esim. polkupyörällä ajo) ja liikkeiden ajoitusta yhdessä tyvitumakkeiden ja liikeaivokuoren kanssa. Ne ovat tärkeät myös tasapainon säilymisen kannalta. Keskushermostoa ympäröi tiivis kalvosto.

Aivokalvojen ja hermokudoksen välissä on aivoselkäydinnestettä (cerebrospinal fluid = CSF, liquor cerebrospinalis), jota valmistuu aivokammioiden seinämissä . Aivot kelluvat tässä nesteessä ja neste muodostaa hermosoluille optimaalisen toimintaympäristön, jota aktiiviset mekanismit pyrkivät pitämään vakaana.

Veri saapuu aivoihin molemminpuolisia kaulavaltimoita (carotid artery, arteria carotis) ja niskassa kulkevia nikamavaltimoita (vertebral artery, a. vertebralis) pitkin. Nämä neljä valtimoa muodostavat aivojen pohjassa verisuonirenkaan (circle of Willis, circulus Willisii 1500-luvulla eläneen brittianatomin mukaan), josta nousee molemmin puolin kolme aivojen päävaltimoa (a. cerebri anterior, a. cerebri media ja a. cerebri posterior).

Mikäli kaula- tai nikamavaltimo ahtautuu hitaasti, elimistö pystyy yleensä korvaamaan aivojen verenpuutteen tämän suonirenkaan avulla; äkillinen tukos aiheuttaa kuitenkin ainakin ohimeneviä oireita.

Kun kudosta aivovaltimoiden tukkeutuessa hapenpuutteen takia vaurioituu, puhutaan aivoinfarktista tai ohimenevästä aivoverenkiertohäiriöstä (TIA). Verisuonen katketessa taas syntyy aivoverenvuoto joko aivojen sisään (intrakerebraalivuoto) tai lukinkalvon alle (subaraknoidaalivuoto). Vuodon tai infarktin paikka ja laajuus ratkaisevat, minkälaisia oireita potilaalla on.

Pahimmassa tapauksessa aivoinfarkti johtaa nopeaan kuolemaan. Aivojen laskimot (sinukset) kulkevat lähellä kalloa ja veri palaa niistä yläonttolaskimon kautta sydämeen.

Lähde: Aivojen rakenne ja toiminta, Risto Ilmoniemi, Helsingin yliopistollinen keskussairaala

Johdanto

Multippeliskleroosi (MS) on keskushermoston (CNS) krooninen tulehdussairaus, joka aiheuttaa vaurioita aivojen ja selkäytimen valkeassa ja harmaassa aineessa.

Viejähaarakkeita suojaavien myeliinituppien vaurioitumisen (demyelinaation) lisäksi keskushermostossa tapahtuu neurodegeneraatiota, joka johtaa hermosolujen surkastumiseen, rappeutumiseen ja kuoleman.

MS-taudin etiologia tunnetaan yhä huonosti, mutta immunologisten, geneettisten ja histopatologisten tutkimusten perusteella uskotaan, että MS-taudin patogeneesissä autoimmuniteetilla on keskeinen rooli.

Taudin kulku voi vaihdella potilaskohtaisesti, mutta useimmilla potilailla esiintyy toistuvia kliinisiä oireita taudin alusta alkaen, minkä jälkeen tapahtuu täydellinen tai osittainen oireista toipuminen. Tämä tautimuoto on aaltoilevasti etenevä, eli relapsoiva-remittoiva MS (RRMS).

10–15 vuoden jälkeen RRMS muuttuu eteneväksi (progressiiviseksi) jopa 50%:lla potilaista. Toissijaisesti etenevässä MS-taudissa (SPMS) oireet etenevät yleensä hitaasti ilman pahenemis- tai paranemisvaiheita monen vuoden ajan.

15 prosentilla MS-potilaista eireet etenevät taudin alusta alkaen tasaisesti ilman pahenemis- ja paranemisvaiheita. Tämä on ensisijaiseksi etenevä, eli primaaristi progressiivinen MS-tauti (PPMS).

Nykyään ei olla aivan varmoja siitä, onko PPMS erillinen MS-taudin muoto vai ilman tunnistettavia kliinisiä relapseja sekundaarisesti eteneväksi muuttunut MS.

Tämä on ihan uskottava hypoteesi. Minä koin kaksoiskuvia ja tasapainovaikeuksia aiheuttaneen kohtauksen vuosia ennen MS-diagnoosia. Sen syy ei koskaanselvinnyt, mutta jälkikäteen ajatellen kohtaus saattoi olla ensimmäinen ja ainoa MS-taudin pahenemisvaihe. Oireet kestivät useita päiviä.

Toisaalta monet MS-tautiin viittaavat oireet olivat minulla alkaneet lievinä jo vuosituhannen vaihteen molemmin puolin.

Sellaisenkin hypoteesin olen lukenut, jossa PPMS luokitellaan omaksi sairaudekseen, joka yhtäläisyyksistä huolimatta ei varsinaisesti ole inflammatorinen autoimmuunitauti, kuten MS-tauti, vaan lähempänä muita neurodegeneratiivisia sairauksia, kuten Parkinsonin tautia.

Multippeliskleroosin tyypillisin aivokudosvaurio on aksoneita suojaavien myeliinituppien primaarinen demyelinaatio aivojen valkeassa aineessa. Myeliinin vauriot altistavat myös hermosyyt vaurioille.

RRMS:sä aktiivisesti demyelinoiviin plakkeihin liittyy immuunisolujen pääsy ääreisalueelta keskushermostoon, mikä selittyy veri-aivoesteen (BBB) vuotamisella.

Terveen veri-aivoesteen ei pitäisi päästää perifeerisiä immuunisoluja keskushermostoon.

Progressiivisessa MS-taudissa patologisia prosesseja aivoissa välittävät pääasiassa paikalliset keskushermostosolut. Magneettikuvantamisella (MRI) on osoitettu, että PPMS:ssä keskushermoston vauriossa esiintyy vähäisempiä gadolinium-pitoisuuksia, mikä viittaa siihen, että leesiot eivät ole immuunijärjestelmän aiheuttamia.

Useat kudospatologiset havainnot liittyvät progressiiviseen MS: ään. Tärkein on aivojen atrofia, eli rappeuma tai surkastuminen, jonka aiheuttaa pääasiassa aksonien krooninen demyelinaatio, mikä johtaa lopulta hermosolujen menetykseen.

Vaikka MRI-kuvantaminen ja neuropatologiset tutkimukset ovat osoittaneet, että sekä aksonin rappeutumista että hermosolujen kuolemaa esiintyy akuuteissa ja aktiivisissa MS-vaurioissa, taudin eteneminen tapahtuu todennäköisesti, kun aksonituho ylittää keskushermoston kompensointikyvyn.

Ovatko tulehdus ja hermoston rappeutuminen ensisijaisia vai toissijaisia prosesseja ja miten ne ovat vuorovaikutuksessa taudin aikana, on edelleen epäselvää

Toinen progressiivisen MS:n merkittävä patologinen substraatti on kortikaalinen demyelinaatio. Harmaan aineen demyelinaatiota havaitaan myös pikkuaivokuoressa, hippokampuksessa ja syvän harmaan aineen solujen tumisa.

Demyelinoitumisen ja oligodendrosyyttien häviämisen lisäksi demyelinoivissa aivokuoren vaurioissa esiintyy hermosolujen transaktiota, hermosolujen kuolemaa ja pienentyneitä presynaptisia terminaalilukuja.

Progressiivisissa MS-vaurioissa diffuusia patologiaa esiintyy myös terveeltä vaikuttavassa valkeassa ja harmaassa aineessa, mikä heijastuu diffuuseina (epätarkkarajaisina) aksonivaurioina, joissa syvä mikroglia-aktivaatio vaikuttaa aivokalvon laajan tulehdusreaktion taustalla.

MRI-tutkimukset viittaavat siihen, että aivokuoren atrofia (surkastuminen) voi olla läheisemmässä suhteessa diffuusiin hermoston rappeutumiseen terveeltä näyttävässä valkeassa aineessa kuin fokaaliseen (pesäkkeisiin liittyvän) valkean aineen demyelinaation laajuudessa.

Tässä katsauksessa käsitellään nykyistä käsitystä harmaan aineen tapahtumista progressiivisen MS-taudin patogeneesissa sekä oletettuja mekanismeja, jotka voivat selittää hermoston rappeutumista ja hermosolujen kuolemaa.

MS-taudissa havaitut harmaan aineen muutokset

MS-taudin uskottiin pitkään olevan tulehduksen välittämä keskushermoston valkean aineen demyelinoiva sairaus, mutta viime vuosina on noussut esiin mahdollisuus, että aivokuoren ja syvän harmaan aineen demyelinaatio voivat olla valkean aineen vaurioita merkittävämpiä taudin oireita ja etenemistä selittäviä syitä.

Valkean aineen demyelinaation ruumiinavaus- ja in vivo tutkimukset ovat paljastaneet laajojen vaurioiden esiintymisen harmaata ainetta tukevissa rakenteissa.

Aluksi tämä selitettiin harvinaisena geneettisenä poikkeamana, joka liittyy yksinomaan taudin pitkittyneeseen kestoon ja eteneviin muotoihin.

Äskettäin osoitettiin, että kortikaalisia ja syvän harmaan aineen vaurioita talamuksessa, häntätumakkeessa, tyvitumakkeessa ja pikkuaivokuoressa esiintyy jo taudin alkuvaiheessa riippumatta valkean aineen patologiasta.

Todisteet taudin aktiivisuuteen ja aggressiivisempiin muotoihin liittyvistä harmaan aineen vaurioista lisääntyvät jatkuvasti

Toisin kuin muissa neurodegeneratiivisissa sairauksissa, ei tiedetä, onko aivokuoren atrofia MS:ssä diffuusi prosessi vai kehittyykö atrofia sen sijaan yksilöllisten anatomisten mallien mukaisesti.

Otsalohkon kortikaaliset osat, pihtipoimun takaosat, aivosaareke ja ohimolohkojen (erityisesti hippokampuksen) ja pikkuaivojen aivokuoren alueet ovat aivoalueita, joihin progressiivinen tauti iskee jo taudin varhaisessa vaiheessa. Tämä selittää ivaliditeetin etenemisen ja tautiin usein liittyvät lievät ja keskivaikeat kognitiiviset oireet.

Pitkään MS-tautia sairastaneilla on viime aikoina kuvattu erilaisia kortikaalisen atrofian tapahtumia, joissa on tai ei ole samanaikaisia valkean aineen vaurioita.

Suurin osa saadusta näytöstä viittaa vaurioiden symmetriseen (ei-satunnaiseen) jakautumiseen. Vaurioilla on vahva yhteys kliinisiin oireisiin.

Ruumiinavauksissa saaduista keskushermostokudosnäytteistä on havaittu erilaisia aivokuoren vaurioita noin 60 prosentissa tapauksista, kun taas uudemmissa 7T-magneettikuvausprotokollissa esiintyvyyden arvioidaan olevan yli 90%.

MS-potilaiden aivokudoksessa on raportoitu kolmen tyyppisiä kortikaalisia vaurioita: leukokortikaalisia, intrakortikaalisia ja subpiaalisia

Leukokortikaaliset leesiot (tyypin 1 leesiot) näyttävät alkavan aivokuoren alapuolisesta valkeasta aineesta ja ulottuvan aivokuoreen kerroksiin V ja VI. Näiden vaurioiden aivokuorisektorit osoittivat lisääntynyttä lymfosyyttien ja mikroglia- / monosyyttien määrää verrattuna terveeseen aivokuoreen samasta aivosta tai ikääntyneistä vertailuaivoista, vaikka näiden solujen lukumäärä on huomattavasti vähäisempi kuin aivokuoren alapuolisessa valkeassa ainessa. Leukokortikaalisia vaurioita on havaittu potilailla jopa taudin varhaisimmissa vaiheissa.

Intrakortikaaliset, eli aivokuoren sisäiset leesiot (tyypin 2 leesiot) sijaitsevat kokonaan aivokuoressa, eivätkä ole suorassa kosketuksessa aivokuoren valkean aineen tai pehmytkudoksen (pia mater) kanssa. Nämä vauriot ovat yleensä pieniä ja perivaskulaarisia (verisuonia ympäröiviä).

Subpiaaliset leesiot (tyypin 3 leesiot) edustavat kaikkein runsainta kortikaalivaurioiden tyyppiä ja ovat merkittävimpiä vaurioita MS-taudin progressiivisissa muodoissa. Nähin vaurioihin liittyy usein myeliinin menetystä kortikaalisissa kerroksissa I – IV, jotka ulottuvat useisiin aivopoimuihin (gyri, gyrus).

Joskus ne voivat läpäistä kaikki kuusi aivokuorikerrosta, mutta harvoin vauriot tunkeutuvat subkortikaaliseen valkoiseen aineeseen.

Oireisiin voi liittyä tulehdusreaktio aivokalvolla. Myeliinivaurioita paitsi, subpiaalisissa leesioissa ei ole suurinta osaa muista patologisista ominaispiirteistä, joita kuvataan valkean aineen vaurioissa, kuten veri-aivoesteen vuotaminen, immuunisolujen tunkeutuminen keskushermostoon, perivaskulaariset muutokset (perivascular cuffs, jossa inflammaatioon viittaavia leukosyyttejä kumuloituu verisuonten ympärille), astroglioosi tai oligodendrosyyttien esisolujen tuhoutuminen.

Aktiivinen kudosvaurio liittyy myös mikroglia-aktivaatioon. Korrelaatiota subpiaalisen ja valkean aineen leesioiden kuormitusten välillä ei ole havaittu, mikä viittaa siihen, että subpiaalinen demyelinaatio tapahtuu riippumatta valkean aineen demyelinaatiosta.

Ruumiinavaustutkimusten yleinen konsensus on, että subpiaalisia vaurioita esiintyy runsaasti MS:n progressiivisissa tautimuodoissa ( PPMS ja SPMS), mutta ne ovat harvinaisia MS-potilailla, joilla on akuutti MS tai RRMS.

Syvän harmaan aineen (DGM) rakenteiden muutokset MS-taudissa

DGM-rakenteiden muutoksia multippeliskleroosissa on tutkittu melko vähän.Kortikaalista atrofiaa havaitaan usein syvässä harmaassa aineessa, etenkin talamuksessa.

On yhä enemmän todisteita siitä, että harmaan aineen volyymin väheneminen (neurodegeneraatio) on invaliditeetin etenemisen kannalta tärkeämpi vaikuttaja, kuin demyelinaatio ja valkean aineen vauriot.

Talamus saattaa olla erityisen herkkä hermoston rappeutumiselle. Demyelinoivia vaurioita voi esiintyä talamuksessa ja peritalaamisilla alueilla.

DGM:n demyelinaatiota löydetään usein MS-tautia sairastaneiden ruumiinavauksissa. Kuolemanjälkeisissä tutkimuksissa demyelinaatiota havaitaan erityisesti häntätumakkeessa sekä talamuksen mediaalisissa ja anteriorisissa tumakkeissa.

Talamuksessa havaittavien vaurioiden histopatologinen* hahmottelu kokoaa yhteen aktiivisen, kroonisesti demyelinoivan, valkeassa aineessa havaittujen vaurioiden spektrin.

* histopatologiassa tutkitaan, onko kudosnäytteissä tulehdukseen, kasvaimiin, rappeumaan tai syöpään viittaavia muutoksia

Samoin kuin ruumiinavauksessa todetut muutokset aivokuoren harmaassa aineessa, T- ja B-solujen aiheuttama parenkymaalinen tunkeutuminen on rajallista verrattuna klassisten aktiivisten valkean aineen vaurioiden havaittuihin tasoihin.

Tutkimus on osoittanut MS-potilailla selkeitä surkastumia harmaan aineen volyymissa

Surkastumat keskittyvät alueille, jotka ovat vahvasti yhteydessä erilaisiin hermosoluihin.

Koska DGM-rakenteet ovat laajasti yhteydessä kortikaalikehän harmaan aineen alueisiin, atrofia voi johtua myös taaksepäin kulkevasta tapahtumaketjusta, joka aiheutuu aksonitransaktiosta talamuksesta ulkonevissa valkean aineen rakenteissa tai sekundaarisesti talamushermosolujen trans-synaptisesta deafferentaatiosta*.

*keskushermostoon tuovien hermoimpulssien kulun estyminen esim. katkenneissa hermoissa

Tutkimukset ovat osoittaneet, että syvän harmaan aineen volyymin surkastuminen on ajan myötä nopeampaa kuin muilla aivojen alueilla kaikissa kliinisissä MS-fenotyypeissä, ja se johtaa invaliditeetin etenemiseen.

Yhdessä nämä tutkimukset tarjoavat vahvaa näyttöä siitä, että talamuksen ja DGM:n volyymiin surkastuminen vaikuttaa dramaattisesti taudin vaikeusasteeseen.

Tulehduksia lievittävät sekä immuunijärjestelmän toimintaa säätelevät lääkkeet toimivat yleensä hyvin aaltomaisesti etenevässä RRMS-tautimuodossa, mutta niillä ei ole terapeuttista arvoa progresiivisissa tautimuodoisssa.

Lääkkeet eivät hidasta MS-taudin etenemistä, vaikka ne lievittävät ja estävät RRMS-taudin akuutteja pahenemisvaiheita. Pitkällä aikahaitarilla eri MS-tautimuotojen invalidisaation aste ja kliiniset oireet lähestyvät toisiaan. Tämä viittaa siihen, että neurodeneraation hidastamiseen tähtäävä terapia olisi taudin alusta alkaen perusteltua.

Ilmeisesti vain neurodegeneraation ehkäisemisellä ja hidastamisella voi vaikuttaa myönteisesti taudin etenemiseen pitkällä aikavälillä.

Lisääntyvä kliininen näyttö osoittaa, että toistaiseksi paras tapa hidastaa/estää neurodegeneraatiota on ketoosiin perustuva aineenvaihdunta, sillä aivorappeumaa ja solujen kuolemaa aiheuttaa erityisesti aivosolujen glukoosinottoon liittyvä trofistinen häiriö.

Kun aivosolut eivät saa energiaa glukoosista, ne kuolevat energianpuutteeseen. Onneksi aivosolut saavat tarvitsemansa energian vaihtoehtoisesti myös ketoaineista, kuten betahydroksibutyraatista.

MRI-kuvantaminen ja kognitiiviset testit osoittavat, että ketoosissa aivojen aktiivisuus ja soluterveys paranevat. Käsittelin aihetta aiemmin pitkässä tutkimuskatsauksessa.

Neurodegeneraation mekanismit

Etenevän MS-taudin syistä on esitetty erilaisia valituneita arvauksia. Eräs ehdotus on, että vaikka aivovaurioita ohjaavat tulehdusprosessit ovat verrannollisia aaltoilevasti etenevän MS-taudin tulehdusprosessien kanssa, progressiivisesti etenevässä taudissa keskushermostoon kehittyy tulehdussoluja suosiva mikroympäristö, mikä tekee immunomodifioivista hoidoista tehottomia.

Toinen mahdollisuus on, että MS alkaa tulehduksellisena sairautena, mutta useiden vuosien jälkeen tulehdusvasteista riippumaton neurodegeneratiivinen prosessi muuttuu taudin etenemisessä keskeiseksi mekanismiksi.

MS voi olla neurodegeneratiivinen sairaus, jossa tulehdus esiintyy toissijaisena tauden etenemistä vahvistavana vasteena.

Nämä erilaiset mekanismit eivät sulje pois toisiaan ja voivat esiintyä yhdessä. Siksi MS-taudissa neurodegeneraatio ja lopulta taudin eteneminen sekä krooniset vauriot kehittyvät monien erilaisten molekyylimekanismien seurauksena. Näistä on esitetty yhteenveto, jota en käännä:

Multippeliskleroosin etenemistä selittävät mekanismit

Immunological Mechanisms and Effectors

Mechanisms of Neurodegeneration and Axonal Dysfunction

B Cells

Mitochondrial Injury

Antibody production, Ag presentation, ectopic formation of follicle-like structures
Induction of compartmentalized population driving CNS injury, independent of peripheral immune activity.
Secretion of IL-6, TNF-α, IL-10, and IL-35: Complement activation and T cell functions
EBV-infected B-cell Induce CD8-mediated immune responses against brain tissue

Impaired activity of respiratory chain complexes (I, III and IV)
Alterations in mitochondrial molecular motors
mtDNA deletions
Energy deficiency: failure of Na+/K+ ATPase, reverse activity of NCX, and excess of intra-axonal Ca2+. Amplify oxidative stress. Mediates histotoxic hypoxia, which magnifies energy deficiency

CD8+ cytotoxic T lymphocytes

Release of Fe3+

Release of TNF-α: neuronal cell death via p55 receptor; IFN-γ: increased Glutamate neurotoxicity and Ca2+ influx; secretion of perforin and granzyme: cellular membrane damage, associated to Na+ and Ca2+ influx

Iron accumulates with aging. The release of Fe3+ from damaged OGD amplifies oxidative injury

Astrocytes *

Anomalous Distribution of Ion Channels

Secretion of pro-inflammatory cytokines (IL-1, IL-6, TNF-α), chemokines (CCL-2, CCL-5, IP-10, CXCL-12, IL-8) and BAFF.
Blood-brain-barrier breakthrough: action on endothelial cells and tight junctions
Activation of microglia: secretion of CXCL-10/CXR3, GM-CSF, M-CSF and TGF-β. Production of Lactosylceramide: induces secretion of CCL2 and GM-CSF
Production of ROS, RNS, NO and ONOO-limited Glutamate transporters, increasing Glutamate excitotoxicity
Reactive astrogliosis: inhibition of remyelination and axonal regeneration by over-secretion of FGF-2, CSPGs and EPH.
Upregulation of purinergic receptors: increased responsiveness to ATP, formation of membrane pores and increased of Ca2+ influx
Cellular senescence: low level of chronic inflammation, altered Ca2+ homeostasis

Redistribution of Na+ channels (Nav, 1.2, 1.6 and 1.8) along the denuded axon: increased energy demand.
Activation of VGCC, ASIC1 and TRPM4 contributes to excess of intra-axonal Ca2+
Glutamate excitotoxicity mediates massive influx of Ca2+ into neurons
Excess of intra-axonal Ca2+ stimulates catabolic enzyme systems: leading to proteolytic degradation of cytoskeletal proteins

Microglia *

Loss of Myelin-Derived Trophic Support and Deficit in Axonal Transport

Decreased expression of immunosuppressive factors: fractalkine-CX3CR1, and CD200-CD200R. Secretion of pro-inflammatory cytokines: IL-1, IL-6, TNF-α, IFN-γ. Ag presentation of CD4+ T cells via Major Histocompatibility Complex (MHC) Class II
Oxidative burst: production of ROS and RNS
Acquisition of aging phenotype: expression of AGE and RAGE

Alteration of a single myelin protein synthesis (PLP, MGA, or CNP) can cause axonal dysfunction
Deficit in axonal transport can reduced expression of kinesins (anterograde transport) and dyneins (retrograde transport)

 

*Taulukossa esiintyvät lyhennykset:

Ag: antigeeni
AGE: Edistyneet glykaation lopputuotteet
ASIC1: happoa tunnistava ionikanava
BAFF: B-solua aktivoiva tekijä
CNP: 2’3′-syklinen nukleotidi 3′-fosfodiesteraasi
CNS: keskushermosto
CSPG:t: kondroitiinisulfaatti-proteoglykaanit
EBV: Epstein – Barr-virus
EPH: efriinit
FGF-2: fibroblastien kasvutekijä 2
GM-CSF: granulosyytti-makrofagipesäkkeitä stimuloiva tekijä
MAG: myeliiniin liittyvä glykoproteiini
M-CSF: makrofagipesäkkeitä stimuloiva tekijä
mtDNA: mitokondrioiden DNA
NCX: natriumkalsiumvaihdin
NO: typpioksidi
OGD: oligodendrosyytit
ONOO -: peroksinitriitti
PLP: proteolipidiproteiini
RAGE: AGE-reseptori
RNS: reaktiiviset typpilajit
ROS: reaktiiviset happilajit
TRPM4: ohimenevä potentiaalireseptori melastatiini 4
VGCC: Jänniteohjattu Ca2 + -kanava.

Tulehdukselliset tapahtumat

Eläinmalleista ja MS-potilailla tehdyistä immunologisista tutkimuksista saatu näyttö viittaa siihen, että keskushermostoon kohdistuva perifeerinen immuunivaste ohjaa sairausprosessia varhaisvaiheissa, kun taas keskushermostoon rajoittuneet immuunireaktiot hallitsevat taudin etenemisen myöhempiä vaiheita.

Tulehduksellisen infiltraatin (keräymä, tiivistymä) koostumus keskushermostossa johtuu perifeeristen immuunisolujen sisäänvirtauksen ja erityisesti mikrogliaalisten solujen aktivoitumisen yhdistelmästä, joka voi muuttaa niiden sisäistä ”lepotilaa” vasteena pitkittyneelle tulehdukselle.

Etenevässä MS-taudissa tulehdusta aiheuttavien ehdokkaiden joukossa B-solujen rooli näyttää olevan hyvin merkittävä. B-solutoimintoja, joilla voi olla merkitystä etenevässä MS-taudissa ovat:

  • vasta-ainetuotanto
  • tulehdusta edistävien sytokiinien lisääntynyt eritys
  • puutteellinen komplementtijärjestelmän aktivaatioon ja T-solujen toimintaan vaikuttava säätelysytokiinien tuotanto
  • antigeenien esittely ja follikkelien kaltaisten rakenteiden virhesijaintinen, eli ektooppinen muodostuminen.

Ektooppiset munarakkulamaiset rakenteet ovat patologisia kudosmuodostumia, jotka muistuttavat tertiäärisiä imusolmukkeita, ja jotka löytyvät leptomeningien* subaraknoidisesta (lukinkalvon alaisesta?) tilasta lähellä tulehtuneita verisuonia ja joita esiintyy myös muissa kroonisissa tulehdussairauksissa. Nämä voidaan indusoida follikulaaristen T-auttajasolujen sytokiiniverkostoilla, jotka toimivat positiivisina (so. IL-21 ja IL-22) ja negatiivisina (eli IL-27) säätelijöinä, samoin kuin muutoksilla stroomassa (sidekudosverkossa).

*Leptomeningit: Kaksi sisintä kudoskerrosta, jotka peittävät aivot ja selkäytimen. Näitä kahta kerrosta kutsutaan arachnoid materiksi ja pia materiksi

Näiden patologisten rakenteiden koostumukselle on tunnusomaista T- ja B-solujen aggregaatit, jotka usein osoittavat T-/B-segregoitumista


Ne kykenevät ylläpitämään vasta-aineiden monipuolistumista
in situ, isotyyppien vaihtamista, B-solujen erilaistumista ja oligoklonaalista leviämistä, jotka muistuttavat ektooppisia itukeskuksia, mikä voi myös tukea autoreaktiivisten plasmasolujen tuotantoa paikallisen tulehduksen kohdalla.

Nämä rakenteet paikallistuvat yhdessä harmaata ainetta olevien leesioiden ja parenkymaalisen (eli elimistön peruskudokseen – parenkyymiin liittyvä) tunkeutumisen kanssa, ja niitä esiintyy eri kehitysvaiheissa, aina yksinkertaisista T- ja B-soluklustereista retikuliinipäällysteen ympäröimiin erittäin järjestäytyneisiin follikkeleihin.

Follikkelimaiset kehittyneet, lymfoidiset kemokiinit CCL19, CCL21, CXCL12 ja CXCL13, jotka kontrolloivat B-solujen rekrytointia, kypsymistä ja antigeenivalintaa, ylläpitävät korkeaa humoraalista vastetta keskushermoston perifeerisestä tulehduksesta riippumatta.

Tällä on erityistä merkitystä progressiivisessa MS-taudissa, jossa veri-aivoeste toimii jokseenkin normaalisti ja taudin aktiivisuuden laukaiseva perifeeristen immuunisolujen pääsy aivoihin on vähäistä.

Sekä myeliiniantigeenien että ei-myeliiniantigeenien, kuten neurofassiinin, neurofilamenttien ja gliakaliumkanavan KIR 4, vasta-aineilla on osoitettu olevan tärkeä rooli aksonien ja hermosolujen vaurioissa komplementtikaskadiaktivaation kautta.

Progressiivisessa MS-taudissa aivokuoren demyelinaatiossa neurodegeneraatio ja atrofia osoittavat positiivista korrelaatiota diffuusien tulehduksellisten infiltraattien ja leptomeningien lymfoidi-follikkelirakenteiden kanssa, mikä osoittaa, että näiden rakenteiden aktivaatio vaikuttaa kortikaaliseen patologiaan.

Follikkelimaisia rakenteita esiintyy noin 40 prosentissa SPMS-tapauksista, mutta ne ovat harvinaisia PPMS-potilailla


Follikkelimainen, eli rakkulamainen

Ei tiedetä, ovatko follikkelimaiset rakenteet alusta alkaen tyypillisiä piirteitä taudin eri alatyypeille vai kehittyvätkö ne pysyvien kudosvaurioiden ja antigeenien vapautumisen seurauksena.

Sekundaarisesti progressiivisen MS-taudin aivokalvontulehdukseen liittyy glial limitansin vaurioituminen (ks. kuva) ja hermosolujen menetysgradientti, joka on suurempi pinnallisissa aivokuorikerroksissa (I-III) lähempänä pialin pintaa kuin sisäisissä aivokuorikerroksissa.


Diffundoivilla sytotoksisilla tekijöillä voi olla tärkeä rooli subpiaalisen aivokuoren vaurioiden kehittymisessä. Follikkelien kaltaisten rakenteiden esiintyminen SPMS-potilailla on liittynyt vakavampaan kliiniseen taudinkulkuun, lyhyempään taudin kestoon ja aikaisempaan kuolemaan.

PPMS:n ja SPMS-patologian taustalla olevat neurodegeneratiiviset ja immunologiset mekanismit ovat jäljellä. Molemmissa tapauksissa diffuusi aivokalvontulehdus ja aivokuoren hermosolujen patologia voivat olla merkittäviä tekijöitä sairauden kliinisessä etenemisessä, mikä viittaa samankaltaisiin patogeenisiin mekanismeihin riippumatta aikaisemmasta relapsoivasta remissiokurssista tai follikkelien kaltaisten rakenteiden esiintymisestä.

Epstein-Barrin virus

Taudin muotojen välillä havaitut erot ovat luonteeltaan enemmän määrällisiä kuin laadullisia.

Koska serologisissa ja epidemiologisissa tutkimuksissa on löydetty yhteys B-lymfotrooppisen Epstein-Barrin viruksen (EBV) infektion ja MS-taudin välillä, on oletettu, että keskushermostoon imeytyvien B-solujen EBV-infektio voi johtaa MS-patologiaan.

Analyysi kuolemanjälkeisestä aivokudoksesta MS-potilailla on osoittanut, että EBV-tartunnan saaneiden B-solujen / plasmasolujen kertyminen aivokalvoihin ja valkean aineen vaurioiden perivaskulaariseen osastoon on yleistä ja että EBV:ta sisältävien solujen määrä korreloi aivojen tulehduksen asteen kanssa.

EBV:n puuttuminen aivoon tunkeutuvissa B-soluissa muissa tulehduksellisissa neurologisissa sairauksissa osoittaa, että EBV:n infektoimien B-solujen pesiytyminen keskushermostoon on spesifistä MS-taudille eikä yleinen tulehduksen aiheuttama ilmiö.

Kortikaalisten vaurioiden kolonisaatio on liitetty EBV:n koodaamiin pieniin tuman mRNA (EBER) -transkripteihin B-soluissa ja plasmasoluissa, jotka ilmentyvät pääasiassa virusinfektion piilevän vaiheen aikana.

Latenssiproteiinien EBNA2 ja LMP1, jotka tuottavat lisääntymis- ja prosurvival -signaaleja B-soluille, ilmentyminen aktiivisissa valkean aineen vaurioissa ja aivokalvoissa useimmissa MS-tapauksissa, samoin kuin B-solujen lisääntymisen esiintyminen MS-aivoissa tukevat mekanismia EBV-ohjatulle B-solujen esiintymiselle.

Tutkimuksissa follikkelimaiset rakenteet sisälsivät runsaasti LMP1+:sta, mutta ei EBNA2+ -soluja. Samaan aikaan lyyttisten (liukenevien) proteiinien BZLF1 ja BERF1 havaittiin rajoittuneen plasmasoluihin, jotka sijaitsevat aktiivisissa kortikaalisissa vaurioissa, mikä osoittaa, että nämä rakenteet ovat viruksen uudelleenaktivoitumisen pääkohteita.

Koska EBNA2:ta ja LMP1:tä ilmentäviä soluja ei yleensä löydy verestä, niiden läsnäolo aivoissa viittaa EBV-säätelyn häiriöön

Joidenkin tutkimusten mukaan keskushermostoon liittyvä EBV-infektio ei kuitenkaan näyttele erityistä roolia MS-taudissa. Varhaiset lyyttiset (hajoamiseen, liukenemiseen liittyvät) EBV-antigeenit herättivät CD8+ -välitteisiä immuunivasteita aiheuttaen voimakkaita sytotoksisia vaikutuksia aivokudoksessa.

Aktiivisimmat aivokuoren MS-vauriot ovat usein täynnä CD8+ T-soluja, ja ne sisältävät vain vähän B-soluja tai plasmasoluja, mikä viittaa siihen, että kortikaalinen tulehdus korreloi sekä B- että plasmasolujen määrän vähenemisen kanssa.

Nämä havainnot viittaavat siihen, että EBV:n uudelleenaktivoituminen yhdistettynä CD8+ T-solujen välittämään voimakkaaseen sytotoksiseen viruslääkkeeseen voi johtaa akuuttiin tulehdukseen sekä valkeassa että harmaassa aineessa sekä aivokalvotilassa.

CD8+ -T-solut voivat myös tunnistaa oligodendrosyytteissä, neuroneissa tai aksoneissa läsnä olevat spesifiset antigeenit.

Aktivoituina ne voivat olla osittain vastuussa demyelinaatiosta tai aksonaalisista / hermosolujen vaurioista MS-taudissa. Useimmat MS-vaurioista toipuneet CD8+ T-lymfosyytit kuuluivat muutamiin klooneihin. Tietyt MS-potilailla löydetyt CD8+ T-solukloonit voivat säilyä monien vuosien ajan selkäydinnesteessä (CSF) ja / tai keskushermostokudoksessa.

Keskushermostosta havaittujen CD4+ T-solujen valikoima MS-potilailla on heterogeeninen. Kaiken kaikkiaan havainnot vahvistavat käsitystä siitä, että MS-potilaiden keskushermostossa olevat CD8+ T-lymfosyytit eivät ole vain sivullisia soluja, vaan ne osallistuvat aktiiviseen immuunivasteeseen.

Aksonaaliset valkean aineen vauriot korreloivat sekä CD8+ T-solujen että aktivoituneiden mikroglia / makrofagien ja keskushermostosolujen lukumäärän kanssa, joilla on voimakas MHC I -ekspressio kaikentyyppisissä tulehduksellisissa vaurioissa.

Nämä havainnot viittaavat yhdessä siihen, että valkean aineen vaurioissa CD8+ T-solut vaikuttavat efektorisoluina aiheuttaen sekä oligodendrosyyttien että aksonien vaurioita.

Taustalla olevista mekanismeista, joiden kautta sytotoksiset CD8+ T-lymfosyytit vahingoittavat aksoneja ja neuroneja MS-taudissa, on kuitenkin edelleen kiistaa.

Sytotoksiset CD8+ T-lymfosyytit vapauttavat sytokiinejä, kuten IFN-y ja TNF-a, samoin kuin perforiini ja grantsyymit A ja B.

IFN-y voi lisätä glutamaatin neurotoksisuutta ja Ca2+ -virtausta soluihin moduloimalla IFN-y / AMPA-glutamaattireseptorikompleksia. Toisaalta TNF-a laukaisee solukuoleman hermosoluissa olevan p55-reseptorin kautta.

Perforiini ja grantsyymit vahingoittavat suoraan solukalvoa aiheuttaen Na+– ja Ca2+ -virtauksen, mikä johtaa lopulta energian puutteeseen ja sen seurauksena lyyttisten soluentsyymien aktivoitumiseen.

Grantsyymit häiritsevät kalsiumin homeostaasia lisäämällä lepotasoa ja parantamalla IP3-välitteistä endoplasman verkkokalsiumin vapautumista. Kohonneet Ca2+ -pitoisuudet ovat riittäviä aktivoimaan kalsiumriippuvaisia solukuolemaan vaikuttajia, kuten kaspaasit.

Vaikka perforiini lisäsi GrB-välitteistä neurotoksisuutta, rekombinantti GrB voi itse aiheuttaa neurotoksisuutta perforiinista riippumatta.

Samoin CD8+ -sytotoksisten T-lymfosyyttien Fas-antigeenin ja hermosolujen Fas-ligandin välinen vuorovaikutus laukaisee Ca2+:n vapautumisen solunsisäisistä varastointipaikoista, mikä johtaa solunsisäisen kaspaasikaskadin lisäaktivaatioon, mikä vaurioittaa aksoneita ja neuroneita.

Sytotoksisten CD4+ T-solujen rooli progressiivisessa MS:ssä unohtuu usein

Tuoreet tutkimukset osoittivat kuitenkin, että tämä T-solupopulaatio lisääntyi myöhäisissä / kroonisissa kokeellisissa autoimmuunisissa enkefalomyeliitti- (EAE) vaurioissa verrattuna akuutteihin vaurioihin.

Sytotoksisten CD4+ T-solujen osuudet lisääntyivät edelleen SPMS-potilaiden selkäydinnesteessä (CSF) vastaaviin verinäytteisiin verrattuna.

Nämä solut syntyvät toistuvasta antigeenisesta stimulaatiosta, minkä jälkeen ne menettävät rinnakkaistimulaattorimolekyylin CD28, jolloin sytotoksinen fenotyyppi on verrattavissa NK- ja CD8+ T-soluihin. Lisäksi CD4+ CD28-T-solut menettävät herkkyytensä apoptoosin induktioon ja ovat resistenttejä niitä säätelevien T-solujen tukahduttaville vaikutuksille.

CD4+ CD28-T-solujen lisääntyminen liittyy useisiin autoimmuuni- ja kroonisiin tulehdustiloihin, kuten MS, kun taas terveillä niitä ei yleensä havaita.

Ne on tunnistettu paitsi kroonisten tulehdussairauksien potilaiden verenkierrossa myös kohdekudoksissa. MS:ssä CD4+ CD28-T-solut kykenevät kulkeutumaan keskushermostoon pääasiassa fraktalkiinijärjestelmän (CX3CL1-CX3CR1) kautta.

Potilailla, joilla on paljon näitä soluja, on vakavampi sairaus ja yleensä huonompi ennuste

Itse asiassa äskettäin CD4+ CD28-T-solujen lähtötason prosenttiosuus liittyi multimodaalisesti herätettyyn potentiaaliin (EP), mikä osoitti yhteyden näiden solujen ja taudin vakavuuden välillä.

Lähtötason CD4+ CD28-T-solujen prosenttiosuudella oli ennustearvo, koska se liittyi EP:hen 3 vuoden kuluttua ja EP:n ja laajennetun vammaisuuden tila-asteikkoon (EDSS) viiden vuoden kuluttua.

Uusien ja tehokkaiden hoitostrategioiden kehittämiseksi on tarpeen ymmärtää paremmin tautiin liittyvät patologiset mekanismit.

Tässä artikkelissa kirjoittajat ovat tiivistäneet joitakin tärkeimmistä mekanismeista, jotka liittyvät MS-taudin etenemiseen. Epäilemättä lisätutkimukset johtavat parempaan ymmärrykseen demyelinaatio- / remyelinoitumisprosesseista sekä gliasolujen merkityksestä hermosolujen homeostaasissa ja hermosolujen rappeutumisessa.

Tehokkaiden hoitomuotojen kehittäminen riippuu suurelta osin taudin patogeneesin kattavasta ymmärryksestä, eläinmalleista, jotka sisältävät nämä patogeeniset ominaisuudet, uusista koemalleista sekä uusista lääkäreiden ja perustutkijoiden yhteistyömalleista.

Pahoittelen, jos tekstiin jäi kirjoitus- tai asiavirheitä. Aineevaihduntaa ja biokemiallisia prosesseja käsittelevän tekstin ymmärrettäväksi suomentaminen on haastavaa.

Tämä on ensimmäinen osa tutkimuskatsausta: Neurodegeneraation ja aksonaalisten vaurioiden mekanismit progressiivisessa multippeliskleroosissa




Insuliini ja terveys: Neljäs luku

Jatkan insuliinia käsittelevää kirjoitussarjaa syventymällä insuliinin terveysvaikutuksiin erityisesti sydän- ja verisuonitauteihin liittyen. Aiemmissa artikkeleissa (Insuliini ja terveys: Johdanto, Insuliini ja terveys: Hiilihydraatti-insuliinimalli, Insuliini ja terveys: Kolmas luku)käsittelin insuliinin kemiallista rakennetta, aineenvaihduntaa ja biokemiaa yleisellä tasolla.

Aihe on vaikea ja joiltain osin kiistanalainen, joten esittelen tässä kirjoituksessa kaksi hyvin perusteltua näkemystä insuliiniresistenssin syistä. Ne ovat osittain yhteneviä ja osittain ristiriitaisia. Kahden tutkiimuskatsauksen käsittelyn vuoksi teksti on todella pitkä ja paikoin myös vaikeaselkoinen.

Tässä tutkimuskatsauksessa osoitetaan, että:

Heikentynyt ravinnonsaanti edistää hyperlipidemiaa ja insuliiniresistenssiä aiheuttaen hyperglykemiaa. Tämä tila muuttaa solujen metaboliaa ja solunsisäistä signalointia, joka vaikuttaa negatiivisesti soluihin.

Kardiomyosyytissä tämä vaurio voidaan tiivistää kolmeen vaikutukseen:

  1. muutos insuliinin signalointiin
  2. kasvanut substraatin saavutettavuus ja
  3. aineenvaihdunnan muutosten joustamattomuus

Kaikki nämä vaikutukset edistävät solutapahtumia, kuten:

  1. geeniekspressiomodifikaatiot
  2. hyperglykemia ja dyslipidemia
  3. oksidatiivisen stressin ja tulehdusvasteen aktivoituminen,
  4. endoteelin toimintahäiriöt ja
  5. kohdunulkoisten lipidien kumuloituminen, joka ylläpitää metabolisen sääntelyn purkamista

Kaiken kaikkiaan insuliiniresistenssi vaikuttaa sydän- ja verisuonitauteihin (CVD) kahden itsenäisen aineenvaihdutareitin kautta:

  1. ateroomapleksin muodostuminen
  2. kammion hypertrofia ja diastolinen poikkeavuus

Lyhyesti: Tämä tutkimuskatsaus osoittaa, että korkea verensokeri ja insuliiniresistenssi ovat merkittäviä sydäntautien riskitekijöitä.

Diabeetikoilla on suurempi sydäninfarktin, sydäntautien ja sydänkuolleisuuden riski kuin diabetesta sairastamattomilla. Tätä riskiä ei selitä muut muuttujat, kuten tupakointi, kolesteroli, verenpaine tai kehon rasvan jakautuminen.

Hypo- ja hyperinsulinemiaan liittyvät sairaudet

Insuliinilla on merkittäviä metabolisia vaikutuksia koko kehossa. Haiman Langerhansin saarekkeiden beetasolut säätelevät insuliinin tuotantoa seuraamalla plasman glukoosin, aminohappojen, ketohappojen ja rasvahappojen pitoisuuksia. Insuliini säätelee energiaravinteiden hapettamista energiaksi ja varastointia rasvakudokseen triglyserideina.

Diabetes mellitus (DM1) on insuliinin puutokseen (hypoinsulinemiaan) liittyvä sairaus, jossa elimistön oma immuunijärjestelmä tuhoaa haiman Langerhansin saarekkeiden beetasoluja, mikä nopeasti johtaa elintärkeän insuliinin tuotannon vähenemiseen ja loppumiseen.Tyypin 1 diabetes puhkeaa tavallisesti alle 40-vuotiaana ja usein jo lapsena ennen murrosikää.

Beetasolujen tuhoutuminen on todennäköisesti seurausta beetasolujen yhteen tai useampaan rakenteeseen kohdistuvasta virheellisen tunnistamisen aiheuttamasta autoimmunireaktiosta, jossa elimistön oma immuunijärjestelmä kohdistaa aktivaation omia kudoksia vastaan.

Taudin tarkkaa syytä ei tunneta, mutta sairastuminen edellyttää geneettisen alttiuden sekä yhden tai useamman taudin laukaisevan ympäristömuuttujan. Tyypin 1 diabeteksen saattaa laukaista esimerkiksi sikiöaikainen D-vitamiinin puutos ja yleinen herpes zoster-infektio.

Taudin oireet saadaan hallintaan insuliinikorvaushoidolla. Verensokeripitoisuuden muutosten tarkkailu, tasaisen verensokerin ylläpitäminen, insuliinihoito ja ruokavaliomuutokset minimoivat tyypin 1 diabeteksen pitkän aikavälin komplikaatioita, kuten verisonten ja hermoston vaurioitumista. Insuliinihoito on elinkautinen.

DM2

Tyypin 2 diabetes mellitus (DM2) on useiden vuosien aikana kehittyvä solujen insuliiniherkkyyden heikentymisestä johtuva elintapasairaus. Toisin sanoen kohdekudokset eivät reagoi asianmukaisesti haiman tuottamaan insuliiniin. Seurauksena voi olla hyperinsulinemia, jossa vereen erittyvä runsaskaan insuliini ei avaa soluja glukoosinotolle.

Rasvakudoksen ja elinten adiposyyttien insuliiniherkkyys säilyy yleensä pitkään, joten glukoosi ohjautuu rasvasoluihin lihasten sijaan.

Tyypillisesti DM2 puhkeaa aikuisiässä. Massiivisista tutkimusponnisteluista huolimatta tyypin 2 diabetekseen johtavien tekijöiden tarkkaa luonnetta on ollut vaikea varmistaa. Taudin patogeneesi on selvästi monitekijäinen.

Lihavuutta pidetään riskitekijänä, mutta lihavuus voi itsessään olla diabetesta edeltävä oire insuliiniresistenssistä. Kaikki diabeetikot eivät ole lihavia, mutta monet lihavat sairastavat insuliiniresistenssiä. Insuliiniresistenssi todennäköisesti johtaa aikuistyypin diabetekseen. Insuliiniresistenssin aiheuttama lihavuus ei aina näy ulospäin, sillä se aiheuttaa tavallisesti elinten rasvoittumista ja viskeraalista keskivartalon elimiä ympäröivää läskiä.

Aikuistyypin diabeteksessa haiman kyky syntetisoida ja erittää insuliinia säilyy ainakin taudin varhaisvaiheessa melko normaalina. Insuliinilääkityksestä ei siis taudin varhaisvaiheessa ole sanottavaa hyötyä. Pikemminkin päinvastoin. Tautia hallitaan ruokavaliohoidolla ja verensokeria laskevilla hypoglykeemisillä lääkkeillä.

Tyypin 2 diabetes on kuitenkin etenevä sairaus, jossa insuliinilääkityskin tulee todennäköisesti ajankohtaiseksi jossain vaiheessa, mikäli verensokeri- ja insuliinipitoisuuksia ei ruokavaliolla saada korjattua.

Hyperinsulinemia, eli liiallinen insuliinin eritys on yleisimmin seurausta insuliiniresistenssistä, joka liittyy tyypin 2 diabetekseen tai metaboliseen oireyhtymään. Hyperinsulinemia voi myös johtua haiman insuliinia erittävästä kasvaimesta (insulinooma), mutta se on harvinaista.

Hyperinsulinemia voi olla hengenvaarallinen tila, josssa veren glukoosipitoisuus laskee nopeasti ja aivojen energiansaanti romahtaa (insuliinishokki).

Glukagoni

Glukagonilla on tärkeä rooli veren normaalin glukoosipitoisuuden säätelyssä. Se on insuliinin vastavaikuttaja. Toisin sanoen glukagonin vaikutus veren glukoosipitoisuuteen on päinvastainen insuliinin vaikutukselle. Insuliini on anabolinen hormoni, joka orkestroi energiaravinteiden käyttöä ja varastoimista. Glukagoni on katabolinen hormoni, joka purkaa energiavarastoja, kuten glykogeenejä verenkiertoon.

Glukagoni on lineaarinen peptidi, jossa on 29 aminohappoa. Sen ensisijainen sekvenssi on melkein täysin konservoitunut (identtinen) selkärankaisten keskuudessa, ja se on rakenteellisesti sukua peptidihormonien sekretiiniperheeseelle.

Glukagoni syntetisoidaan proglukagonina ja prosessoidaan proteolyyttisesti glukagonin tuottamiseksi haimasaarien alfasoluissa. Proglukagonia ilmentyy myös suolistossa, jossa sitä ei prosessoida glukagoniksi, vaan glukagonin kaltaisten peptidien perheeksi (enteroglukagoni).

Glukagonin fysiologiset vaikutukset

Glukagonin tärkein vaikutus on stimuloida veren glukoosipitoisuuden nousua.

Kun veren glukoosipitoisuus alkaa laskea normaalin alapuolelle, on välttämätöntä löytää ja pumpata lisää glukoosia vereen. Glukagoni hallitsee kahta keskeistä metaboliareittiä maksassa, mikä johtaa siihen, että elin luovuttaa glukoosia muuhun kehoon:

  • Glukagoni stimuloi maksassa varastoituneen glykogeenin hajoamista.

    Kun veren glukoosipitoisuus on korkea, maksa varastoi suuria määriä glukoosia glykogeeneiksi. Maksan glykogeenien koko vaihtelee ihmisten ja elämäntilanteiden välillä, mutta keskimäärin glukoosia varastoituu maksaan noin 200-250 g.

    Insuliinin vaikutuksesta osa glukoosista varastoidaan glykogeenin muodossa. Myöhemmin, kun veren glukoosipitoisuus alkaa laskea, glukagonin erittyminen vaikuttaa maksasoluihin aktivoiden entsyymejä, jotka depolymeroivat glykogeenejä glukoosiksi ja vapauttavat glukoosia verenkiertoon.

  • Glukagoni aktivoi maksan glukoneogeneesiä. Glukoneogeneesi on aineenvaihduntakanava, jossa sitruunahappokierron väliaineita, eräitä aminohappoja ja glyserolia muutetaan glukoosiksi.

    Glukoneogeneesi tuottaa tarvittaessa kaiken elimistön tarvitseman glukoosin.

Glukagonilla näyttää olevan vähäinen vaikutus triglyseridien lipolyysin tehostamisessa rasvakudoksessa.

Lipolyyttiset hormonit, kuten kortikotropiini, glukagoni ja adrenaliini aktivoivat rasvasolujen lipolyysin, jossa triglyseridejä pilkotaan verenkiertoon vapaiksi rasvahapoiksi ja glyseroliksi.

Insuliini on puolestaan lipolyyttisten entsyymien, kuten hormonisensitiivisen lipaasin (HSL) estäjä. Veren korkea insuliinipitoisuus estää rasvasolujen purkamisen energiakäyttöön.

Glukagonierityksen hallinta

Glukagonin tärkein vaikutus on lisätä veren glukoosipitoisuutta. Glukagonia erittyy hypoglykemian, eli matalan veren glukoosipitoisuuden vaikutuksesta. Kahden muun mekanismin tiedetään laukaisevan glukagonin erityksen:

  1. Kohonnut aminohappopitoisuus veressä: Tässä tilanteessa glukagoni edistää ylimääräisten aminohappojen muuntumista glukoosiksi lisäämällä glukoneogeneesiä.

    Koska korkea veren aminohappopitoisuus stimuloi myös insuliinin erittymistä, tämä on poikkeuksellinen tilanne, jossa sekä insuliini että glukagoni ovat samanaikaisesti aktiivisia.

  2. Liikunta: Tässä tapauksessa ei ole täysin selvää, onko todellinen glukoosin erittymisen laukaiseva ärsyke liikunta sinänsä vai liikunnan aiheuttama veren glukoosipitoisuuden lasku.

    Glukagonin eritystä estävät korkeat verensokeritasot. Ei ole selvää, heijastako tämä glukoosin suoraa vaikutusta alfasoluun vai ehkä insuliinin vaikutusta, jonka tiedetään vaimentavan glukagonia.

    Toinen hormoni, jonka tiedetään estävän glukagonin eritystä, on somatostatiini.

Glukagoniin liittyvät sairaudet

Glukagonin korkeaan tai matalaan eritykseen liittyvät sairaudet ovat hyvin harvinaisia. Alfa-solujen (glukagonomat) syövät ovat eräs sairaus, jonka tiedetään aiheuttavan liiallista glukagonieritystä.

Vaikka insuliinipuutos on selvästi tärkein tekijä tyypin 1 diabetes mellituksessa, on huomattavaa näyttöä siitä, että glukagonin poikkeava eritys edistää taudissa havaittuja metabolisia häiriöitä.

Monilla diabetesta sairastavilla potilailla, joilla mitataan hyperglykeminen verensokeri, on myös kohonnut glukagonipitoisuus veressä, vaikka kohonnut verensokeritaso estää glukagonin eritystä.

Sydän- ja verisuonitaudit: Yleinen näkemys

Vuosikymmenten ajan sydän- ja verisuonitaudit (CVD) ovat olleet johtava kuolinsyy ympäri maailmaa.

Sydän- ja verisuonitauteihin liittyy useita samanaikaisia sairauksia, kuten lihavuus, epänormaalit lipidiprofiilit ja insuliiniresistenssi. Vaikka insuliiniresistenssi ja DM2 hyväksytään vihdoin sydän- ja verisuonitautien itsenäisiksi riskitekijöiksi, yleinen sydänsairauksien malli nojaa vahvasti perinteiseen oppiin rasvojen ja erityisesti tyydyttyneiden rasvojen haitallisuudesta.

Vaikka vapaat rasvahapot näyttävät kasvattavan insuliiniresistenssin riskiä, mekanismi jolla rasvahapot aiheuttavat insuliiniresistenssin, on tuntematon.

Kyse lienee perinteisestä muna-kana-ongelmasta: kumpi oli ensin? Aineenvaihdunnan tasolla syy- ja seuraussuhteet kääntyvät herkästi nurinniskoin.

Insuliiniresistenssistä on ainakin kaksi vaihtoehtoista mallia: a) rasva aiheuttaa insuliiniresistenssia, ja b) insuliiniresistenssi aiheuttaa kehon ja veren rasvapitoisuuden lisääntymistä ja lihomista.

Avaan tässä tutkimuskatsausta, jonka ovat koonneet Valeska Ormazabal, Soumyalekshmi Nair, Omar Elfeky, Claudio Aguayo, Carlos Salomon & Felipe A. Zuñiga. Association between insulin resistance and the development of cardiovascular disease on julkaistu alun perin Cardiovascular Diabetology -lehdessä.

Lopuksi tutustun vielä lyhyesti James J. DiNicolantonion ja James H. O’keefen BMJ-lehdessä julkaistuun artikkeliiin: Added sugars drive coronary heart disease via insulin resistance and hyperinsulinaemia: a new paradigm.

Ensimmäinen tutkimuskatsaus noudattaa nähdäkseni yleistä ja perinteisempää  lääke- ja ravintotieteellistä tulkintaa insuliiniresistenssistä ja sen vaikutuksista sydän- ja verisuonitauteihin.

Tämä käsitys on osittain ristiriidassa kasvavan rasvojen aineenvaihduntaa selittävän tutkimusaineiston kanssa. Tieteen periaatteisiin kuuluu tieteen itseään korjaava luonne; paremmin ilmiöitä selittävä evidenssin tukema malli kumoaa heikommin ilmiöitä selittävän mallin. Nähdäkseni tyydyttyneisiin rasvoihin liittyvä paradigma on romahtamassa ja oppi sokereiden haitallisuudesta täsmentyy jatkuvasti.

Kasvavan evidenssin mukaan hyperglykemia ja insuliiniresistenssi ovat sydän- ja verisuoniterveyden kannalta merkittävämpiä riskitekijöitä, kuin LDL.

Jälkimmäinen artikkeli vastaa lähemmin uutta käsitystä insuliiniresistenssista sydän- ja verisuonitautien riskitekijänä. Siinä sydän- ja verisuonitaudit palautuvat hyperglykemiaan, insuliiniresistenssiin ja hyperinsulinemiaan.

Insuliini on avainhormoni, joka toimii solujen aineenvaihdunnan säätelijänä monissa ihmiskehon kudoksissa.

Insuliiniresistenssi määritellään kudosvasteen heikkenemisenä insuliinin stimulaatiolle, joten insuliiniresistenssille on tunnusomaista glukoosin imeytymisen ja hapettumisen häiriöt, glykogeenisynteesin väheneminen ja vähäisemmässä määrin kyky estää lipidien hapettumista ( β-oksidaatiota).

Vapaat rasvahapot ovat hallitseva substraatti, jota aikuisen sydänlihaksessa käytetään ATP:n tuotantoon, mutta sydämen metabolinen verkosto on erittäin joustava ja se voi käyttää muita substraatteja, kuten glukoosia, laktaattia, ketoaineita tai aminohappoja energian tuotantoon.

Substraatilla tarkoitetaan yhdistettä, jota entsyymi- tai muu reaktio muuttaa. Energia-aineenvaihdunnan substraatteja ovat glukoosi, vapaat rasvahapot, ketoaineet ja aminohapot.

Insuliiniresistenssin aikana useat metaboliset muutokset johtavat sydän- ja verisuonitautien riskin lisääntymiseen. Insuliiniresistenssi voi esimerkiksi aiheuttaa glukoosimetabolian epätasapainon, kuten kroonisen hyperglykemian, mikä puolestaan laukaisee oksidatiivisen stressin, joka aiheuttaa soluvaurioihin johtavan tulehdusreaktion.

Insuliiniresistenssi voi myös muuttaa systeemistä lipidimetaboliaa, joka johtaa sitten dyslipidemiaan ja haitallisen lipiditriadin kehittymiseen:

  1. korkeat plasman triglyseridipitoisuudet

  2. matalat korkean tiheyden lipoproteiinipitoisuudet (HDL)

  3. matalatiheyksisten lipoproteiinien lisääntyminen (LDL)

Tämä lipiditriadi yhdessä endoteelin insuliinisignaloinnin toimintahäiriöiden kanssa myötävaikuttaa ateroskleroottisen plakin muodostumiseen.

Insuliiniresistenssin ja sydämen metabolisten muutosten systeemiset seuraukset aiheuttavat vahinkoa ainakin kolmella mekanismilla:

  1. insuliinisignaloinnin muuttuminen
  2. heikentynyt energiasubstraatin aineenvaihdunnan säätely

  3. muuttunut substraattien kulku sydänlihakseen

Insuliiniresistenssin vähentämiseen keskittyvät hoidot voivat vähentää sekä sydän- ja verisuonitautien että ateroskleroottisten plakkien muodostumista.

Sydäntautien tausta

Sydän- ja verisuonitauteihin liittyvät patologiset prosessit ja riskitekijät alkavat jo lapsuudessa.

Erityisesti lihavuus, joka liittyy epänormaaliin lipidiprofiiliin nuoremmalla iällä, assosioituu vahvasti insuliiniresistenssin kanssa. Kuten tutkimuksissa korostetaan, monilla tekijöillä, kuten lihavuudella, epänormaalilla lipidiprofiililla ja insuliiniresistenssillä, on keskeinen rooli sydän- ja verisuonitautien (CVD) kehittymisessä.

Fysiologisissa olosuhteissa insuliini stimuloi metabolisten substraattien käyttöä monissa kudoksissa, kuten sydämessä, luurankolihaksissa, maksassa ja rasvakudoksessa.

Kardiomyosyyteissä, eli sydänlihassoluissa insuliini edistää glukoosin ja rasvahappojen imeytymistä, mutta estää β-ksidaation eli rasvahappojen hapettamisen energiaksi.

Haima yrittää kompensoida solujen heikentynyttä insuliiniherkkyyttä erittämällä kasvavia määriä insuliinia, mikä johtaa hyperinsulinemiaan.

Insuliiniresistenssin ja / tai hyperinsulinemian aikana normaali glukoositoleranssi säilyy johtuen joukosta fysiologisia muutoksia, jotka tämä ilmiö aktivoi.

Insuliiniresistenssin ja CVD:n kehittymisriskin välillä on todettu vahva korrelaatio. Useat molekyylimekanismit edistävät insuliiniresistenssin ja CVD:n välistä yhteyttä. Nämä mekanismit sisältävät insuliiniresistenssin roolin ateroskleroosin kehittymisessä, verisuonten (endoteelin) toiminnassa, verenpainetaudissa ja makrofagien lisääntymisessä.

Insuliinisignalointi

Insuliini on voimakas anabolinen hormoni, jolla on laajasti vaikutuksia monentyyppisiin soluihin.

Jotkut insuliinin tärkeimmistä metabolisista vaikutuksista ovat glukoosinoton stimuloiminen luurankolihaksissa ja adiposyyteissä, glykogeenisynteesin edistäminen luurankolihaksissa, maksan glukoosituotannon (glukoneogeneesin) tukahduttaminen ja lipolyysin estäminen adiposyyteissä.

Ruokailun seurauksena insuliinia erittyy haimasta verenkiertoon. Se aiheuttaa kiertävän glukoosin imeytymistä kohdekudoksiin sitoutumalla solujen insuliinireseptoreihin.

Tämä sitoutuminen aktivoi reseptorin autofosforylaation, joka laukaisee alavirran signalointikaskadin fosforyloimalla insuliinireseptorisubstraattien tyrosiinitähteet, IRS (IRS-1 tai IRS-2), mitä seuraa reaktiosarja, jossa fosfatidyyli-inositoli-3-kinaasi (PI3K), fosfoinositidista riippuvainen kinaasi -1, Akt (Akt1 ja Akt2), proteiinikinaasi C (PKC) ja rapamysiinin* nisäkäskohde (mTOR), samoin kuin ribosomaalinen proteiini S6-kinaasi beeta 1 (S6K1) fosforyloituvat.

Substraattitason fosforylaatio

Substraattitason fosforylaatio on soluissa tapahtuva kemiallinen reaktio, jossa syntyy ATP:tä fosfaattiryhmän liittyessä ADP:hen. Reaktio tapahtuu solulimassa glykolyysin yhteydessä sekä aerobisissa että anaerobisissa oloissa.

Substraattitason fosforylaatiossa voi syntyä neljä ATP:tä. Kaksi ATP-molekyyliä syntyy kahden 1,3-bisfosfoglyseraatin luovuttaessa fosfaattiryhmän ADP:lle fosfoglyseraattikinaasientsyymin avulla. Samalla syntyy 3-fosfoglyseraattia. Kaksi ATP:tä syntyy myös, kun fosfoenolipyruvaatti luovuttaa fosfaattiryhmän ADP:lle pyruvaattikinaasientsyymin avulla. Lisäksi syntyy palorypälehappoa.

Substraattitason fosforylaatio toimii myös luustolihaksissa ja aivoissa, joissa on energiaa varastoivaa ja fosfaattiryhmän sisältävää fosfokreatiinia ja kreatiinifosfokinaasientsyymi siirtää fosfaattiryhmän ADP:lle, jolloin tuloksena on ATP:tä. – Wikipedia

*Rapamysiini (sirolimuusi) on immunosuppressiivinen lääke, jota käytetään elinsiirron, varsinkin munuaisensiirron jälkeisen hylkimisreaktion estossa. Se löydettiin alun perin Pääsiäissaarelta (Rapa Nui), mistä tulee nimitys rapamysiini.

Yhdysvaltalaisessa tutkimuksessa sirolimuusi pidensi vanhojen hiirten jäljellä olevaa elinajanodotetta 28–38%:lla. Aine kuitenkin heikentää immuniteettia, joten ihmisille se ei sovi vanhenemisen hidastamiseen.

Rapamysiini lisää henkilön alttiutta saada vaarallinen infektio. Lääkkeen aiheuttama immuunijärjestelmän heikkeneminen voi myös lisätä syöpäriskiä. Lääkkeellä on runsaasti sivuvaikutuksia, kuten hypertensio, nivelkivut, vatsavaivat, kuume, virtsatietulehdus, pahoinvointi, päänsärky, anemia ja hypokalemia. Rapamysiini hidastaa energian kulutusta.

GLUT4

Nämä aineenvaihduntatapahtumat johtavat lisääntyneeseen glukoosinkuljettaja-4:n (GLUT4) siirtymään (translokaatio) solukalvolle, mikä helpottaa glukoosinottoa.

Imeytymisen jälkeen vapaa glukoosi fosforyloituu nopeasti glukoosi-6-fosfaatiksi (G6P), joka myöhemmin siirtyy eri metaboliareiteille.

Insuliinisignalointi tehostaa lipidien varastoitumista rasvasoluihin kahdella mekanismilla, stimuloimalla triglyseridisynteesiä ja estämällä lipolyysin käynnisymistä.

Triglyseridejä varastoidaan lipidipisaroihin, jotka sisältävät lipidipisaraproteiineja, kuten perilipiiniä.

Lipolyysin esto tapahtuu vähentämällä cAMP-tasoja ja estämällä proteiinikinaasi A:n (PKA) -aktiivisuutta, mikä heikentää siten hormoniherkän lipaasin -fosforylaatiota ja perilipiiniä aiheuttaen lipolyysinopeuden laskun.

Adiposyyttien lipidipisaroiden sisältämät triglyseridit hydrolysoituvat rasvahapoiksi, asyyliglyserideiksi ja glyseroliksi aktivoimalla hormoniherkkää lipaasia.

Maksassa insuliini estää glukoosin tuotantoa ja vapautumista estämällä glukoneogeneesin ja glykogenolyysin säätämällä fosfoenolipyruvaattikarboksylaasin (PEPCK) ilmentymistä.

Lisäksi insuliini voi stimuloida glykogeenisynteesiä Akt2-aktivaation, glykogeenisyntaasikinaasi 3:n (GSK3) estämisen ja glykogeenisyntaasin (GS) aktivaation kautta seriinitähteiden desfosforylaation kautta näiden proteiinien NH2- ja COOH-terminaaleissa.

Insuliinin verisuonivaikutukset ovat monimutkaisia: insuliinilla voi olla joko suojaavia tai haitallisia vaikutuksia verisuonistossa.

Insuliinin verisuonia suojaavat vaikutukset liittyvät endoteelin typpioksidisyntaasin (eNOS) aktivaatioon PI3K / Akt-reitin kautta.

Haitallisiin vaikutuksiin sisältyy verisuonten sileän lihassolun (VSMC) lisääntymisen indusointi, verisuonten supistuminen ja proinflammatorinen aktiivisuus.

Nämä verisuonivaikutukset välittyvät mitogeeniaktivoidun proteiinikinaasireitin (MAPK) kautta. Tämä osallistuu vain insuliinin mitogeenisiin vaikutuksiin, mutta ei sen metabolisiin vaikutuksiin. Mitogeeni on yhdiste, joka käynnistää solunjakautumisen.

Insuliiniresistenssi

Yleisen hypoteesin mukaan insuliiniresistenssi määritellään kliiniseksi tilaksi, jossa insuliinilla on odotettua pienempi fysiologinen vaikutus.

Insuliiniresistenssi tarkoittaa tilaa, jossa insuliinin vaikutus heikkenee. Insuliiniresistenssi aiheuttaa verensokerin nousua (hyperglykemia). Insuliiniresistenssi lisää huomattavasti kakkostyypin diabeteksen sekä sydän- ja verisuonisairauksien riskiä.

Muutos voi olla lyhyt- tai pitkävaikutteinen aiheuttajasta riippuen. Resistenssille herkistäviä tekijöitä tunnetaan yli 30, niitä ovat muun muassa lihavuus, tupakointi, asidoosi, alkoholi, korkea verenpaine, raskaus (raskausajan diabetes) ja palovammat. Insuliiniresistenssi on yhteinen nimittäjä monille sairauksille, jotka yleistyvät länsimaissa. Yksi yleisimmistä on metabolinen oireyhtymä.

Insuliiniresistenssi voi johtua häiriöstä insuliinin sitoutumisessa solun insuliinireseptoriin, reseptorien määrän tai toiminnan muutoksesta, glukoosin-sokerin kuljetusproteiinin (GLUT4) määrän tai toiminnan häiriöstä tai glukoosiaineenvaihdunnan häiriöstä solun sisällä. Häiriö on siis glukoosin otossa soluun tai sen aineenvaihdunnassa solun sisällä.

Insuliiniresistenssistä kärsiviä suositellaan valitsemaan matalan glykemiaindeksin ruoka-aineita ja ruokia. Lisäksi heidän kannattaa valita sellaisia ruoka-aineita, joilla on myös matala insuliini-indeksi. – Wikipedia

Glukoosinoton häiriö

Tämä ilmiö johtuu puutteista insuliinin stimuloimassa glukoosinotossa, erityisesti glykogeenisynteesissä, ja vähemmässä määrin glukoosin hapettumisessa. Insuliiniresistenssin vaikutukset eri kudoksiin riippuvat kudosten fysiologisesta ja metabolisesta toiminnasta.

Suuren aineenvaihduntavaikutuksen vuoksi insuliiniresistenssillä on merkittäviä vaikutuksia luurankolihakseen, rasvasoluihin ja maksakudokseen, jotka ovat solunsisäisen glukoosikuljetuksen sekä glukoosi- ja lipidimetabolian pääkohteet.

Luurankolihasten ja rasvasolujen osuus GLUT4 -reseptorien insuliinin stimuloimasta glukoosinotosta ovat noin 60–70%.

Insuliiniresistenssi heikentää maksan ja lihasten glykogeenisynteesiä, lisää proteiinikataboliaa luurankolihaksissa (lihasten kannibalisoiminen energiaksi) ja estää lipoproteiinilipaasiaktiivisuutta adiposyyteissä, mikä johtaa vapaiden rasvahappojen ja tulehduksellisten sytokiinien, kuten IL-6, TNFa sekä kylläisyyshormoni leptiinin, erityksen lisääntymiseen.

Maksan aineenvaihdunta kattaa karkeasti 30% insuliinin stimuloimasta glukoosin metaboliasta. Insuliiniresistenssi heikentää maksan glukoosiaineenvaihduntaa ja rasvahappojen aineenvaihduntaa, mikä puolestaan lisää veren triglyseridipitoisuutta ja VLDL-lipoproteiinien eritystä maksasta.

Insuliiniresistenssi aiheuttaa endoteelisolujen toimintahäiriöitä vähentämällä typpioksidin tuotantoa endoteelisoluissa ja lisäämällä veren hyytymistä estävien tekijöiden vapautumista. Tämä johtaa verihiutaleiden aggregaatioon (puuroutumiseen).

Insuliiniresistenssi vaikuttaa PI3K-reitin metaboliaan, kun taas MAP-kinaasireitti toimii normaalisti. Tämä aiheuttaa insuliinin mitogeenisen vaikutuksen endoteelisoluissa ja kasvattaa ateroskleroosin riskiä.

Veren matalalalla insuliinipitoisuudella ja insuliiniresistenssillä on merkittävä fysiologinen rooli raskauden ja nälkiintymisen aikaisen aineenvaihdunnan säätelyssä.

Ravinnon puutteellisen saannin aiheuttama alhainen glukoosipitoisuus johtaa heikentyneeseen insuliinin eritykseen, mikä helpottaa glukoosin mobilisoitumista maksasta.

Matala insuliinipitoisuus edistää lipolyysin käynnistymistä, jolloin rasvasoluista vapautuu vereen vapaita rasvahappoja ja glyserolia, joita voidaan käyttää ketoaineiden, β-oksidaation ja glukoosin lähtöaineina.

Nämä kompensointimekanismit auttavat ylläpitämään verensokeritasoja poikkeusolosuhteissa, kuten paastolla. Nykyään tiedetään, että aivosolut osaavat tuottaa energiaa ketoaineista, mutta vielä kymmenisen vuotta sitten aivotoiminnan uskottiin edellyttävän tasaista glukoosinsaantia.

β-hydroksibutyraatti on aivojen kuvantamisen ja kognitiivisten testien perusteella erinomainen energianlähde aivosoluille.

Veren punasoluilta puuttuu mitokondriot, joten niiden energianluotanto on glukoosista energiaa tuottavan glykolyysin varassa. Gukoosin puuttuessa ja glykogeenien ehtyessä glukoneogeneesi valmistaa glukoosia veren punasoluille.

Odottavan äidin insuliiniresistenssi sekä glukoosinsaannin turvaavat kompensoivat aineenvaihduntamekanismit varmistavat sikiölle kasvun ja kehityksen kannalta riittävän energian- ja ravinteiden saatavuuden.

Insuliiniresistenssi on avainasemassa metabolisten sairauksien, kuten tyypin 2 diabeteksen patogeneesissä. Insuliiniresistenssi on osallisena useissa muissakin sairauksissa, kuten rintasyövässä, nivelreumassa, munasarjojen monirakkulaoireyhtymässä, alkoholista riippumattomassa rasvamaksassa sekä sydän- ja verisuonitaudeissa. Insuliinimetabolian häiriöt vaikuttavat useimpien elintapasairauksien taustalla.

Ei-hapettavalle aineenvaihduntareitille päätyneiden lipidien liiallinen määrä kardiomyosyyteissä johtaa myrkyllisten lipidilajien (lipotoksiinien) kertymiseen soluihin, mikä muuttaa solujen signalointia ja sydämen rakennetta.

Lipotoksiinit

Lipotoksisuus on metabolinen oireyhtymä, joka johtuu lipidivälituotteiden kertymisestä ei-rasvakudokseen. Tämä johtaa solujen toimintahäiriöihin ja solukuolemaan. Kudoksiin, joihin lipotoksisuus normaalisti vaikuttaa, kuuluvat munuaiset, maksa, sydän ja luurankolihakset.

Lipotoksisuudella uskotaan olevan huomattava merkitys sydämen vajaatoiminnassa, liikalihavuudessa ja diabeteksessa.

Normaaleissa solutoiminnoissa lipidien tuotannon ja niiden hapettumisen tai kuljetuksen välillä on tasapaino.

Lipotoksisissa soluissa tuotettujen lipidien määrän ja energian tuotantoon hapetettujen lipidien määrän välillä on epätasapaino. Soluuntulon jälkeen rasvahapot voidaan muuntaa erityyppisiksi lipideiksi varastointia varten.

Rasvan yleinen varastomuoto, eli triglyseridi koostuu kolmesta glyserolimolekyyliin sitoutuneesta rasvahaposta, ja sitä pidetään neutraalimpana ja vaarattomimpana solunsisäisenä lipidivarastona.

Vaihtoehtoisesti rasvahapot voidaan muuntaa lipidivälituotteiksi, kuten diasyyliglyseroliksi, keramideiksi ja rasva-asyyli-CoA:ksi.

Nämä lipidivälituotteet voivat heikentää solun toimintaa, jota kutsutaan lipotoksisuudeksi

Adiposyytit, solut, jotka normaalisti toimivat kehon lipidivarastona, pystyvät käsittelemään ylimääräisiä lipidejä. Liian suuri lipidien määrä ylikuormittaa soluja ja aiheuttaa lipidien leviämisen ei-rasvasoluihin, joilla ei ole rasvoille tarvittavaa varastotilaa.

Kun ei-rasvasolujen varastointikapasiteetti ylitetään, seurauksena on solujen toimintahäiriö ja / tai solukuolema. Mekanismia, jolla lipotoksisuus aiheuttaa solun kuoleman ja toimintahäiriöitä, ei tunneta hyvin. Apoptoosin syy ja solun toimintahäiriön laajuus liittyvät solutyyppiin sekä ylimääräisten lipidien tyyppiin ja määrään.

Lihavuuden syy-vaikutus lipotoksisuudessa on kiistanalainen aihe. Jotkut tutkijat väittävät, että lihavuudella on suojaavia vaikutuksia lipotoksisuutta vastaan, koska se johtaa ylimääräiseen rasvakudokseen, johon voidaan varastoida ylimääräisiä lipidejä. Toiset väittävät, että lihavuus on lipotoksisuuden riskitekijä. Molemmat osapuolet myöntävät, että runsasrasvainen ruokavalio lisää lipotoksisten solujen määrää.

Henkilöt, joilla on paljon lipotoksisia soluja, sairastuvat yleensä sekä leptiini- että insuliiniresistenssiin. Tälle korrelaatiolle ei kuitenkaan ole löydetty selvää syy-mekanismia.

Häiriöt useilla solun signalointireiteillä, kuten mitokondrioiden toimintahäiriöissä ja endoplasmisen verkkokalvon stressissä, on liitetty lipotoksisuuteen.

Välittäjien, kuten reaktiivisten happilajien (ROS), typpioksidin (NO), keramidin, fosfatidyyli-inositoli-3-kinaasin, diasyyliglyserolin (DAG), PPAR-ydinreseptorien ligandien, leptiinin, on ehdotettu edistävän näitä lipotoksisia vaikutuksia ja lisäävän solujen apoptoosinopeutta.

Insuliiniresistenssi solutasolla

Insuliini vaikuttaa useissa aineenvaihduntaprosesseissa ja toimii signalointijärjestelmänä, joka mahdollistaa tasapainon ravinteiden tarjonnan ja tarpeen välillä.

Insuliiniresistenssissä kohdesolut eivät reagoi veresssä kiertävän insuliinin tavanomaisiin tasoihin, joten normaalia vastetta varten tarvitaan suurempia insuliinipitoisuuksia.

Insuliiniresistentti tila määritellään glukoosin imeytymisen heikkenemisenä lihaksissa ja maksan lisääntyneenä glukoneogeneesinä, mikä johtaa hyperglykemiaan, eli postbrandiaaliseen ja paastonjälkeiseen kohonneeseen verensokeriin.

Insuliiniresistenssiin liittyviä mekanismeja on selitetty monin tavoin, mutta kiistatonta tieteellistä konsensusta insuliiniresistenssin syystä ei taida olla.

Insuliiniresistenssin patogeneesi voidaan kuitenkin ryhmitellä geneettisiin virheisiin, rasvasta peräisin olevaan signaalointiin (kohdunulkoisten rasvojen kertyminen), fyysiseen passiivisuuteen, lihavuuteen ja tulehduksiin.

Insuliiniresistenssi ja geenit

Yksi lähestymistapa sairastumisen selittämiseen on insuliiniresistenssiin johtavan geneettisen virheen analysointi selvittämällä insuliinin signalointiketjuun assosioituvia ehdokasgeenejä. Insuliiniresistenssissä ja tyypin 2 diabeteksessa on havaittu useita muutoksia insuliinin signalointiin liittyvissä geeneissä.

IRS-1- ja IRS-2-geenien poikkeavuudet hiirikokeissa osoittavat, että IRS-1-hiiret ovat insuliiniresistenttejä, mutta eivät hyperglykeemisiä. Hiiret, joilta puuttuu IRS-2-geeni ovat vakavasti hyperglykeemisiä johtuen perifeerisen insuliinin toiminnan poikkeavuuksista ja β-solujen insuliinin erityksen häiriöistä.

Akt1:n häiriö hiirissä ei aiheuta merkittäviä häiriöitä aineenvaihdunnassa, kun taas hiiret, joilta Akt2 on estetty, osoittavat insuliiniresistenssiin viittaavia oireita, jotka fenotyypiltään muistuttavat läheisesti tyypin 2 diabetesta.

Muita mutaatioita, jotka on tunnistettu ja tutkittu tyypin 2 diabetekseen liittyen, ovat mutaatiot insuliinireseptorissa, PI3K:ssa, maksan glukokinaasipromoottorissa, GLUT4, glykogeenisyntaasissa ja proteiinifosfataasi-1:ssä.

Erilaisista tyypin 2 diabetekseen assosioituvista mutaatioista huolimatta, harvat henkilöt ovat diabeettisia geneettisten mutaatioiden vuoksi.

Geneettinen alttius aikuistyypin diabetekseen kuitenkin kasvattaa sairastumisriskiä. Voi myös olla useita muita geneettisiä poikkeamia, joita ei ole vielä tunnistettu ja jotka voivat vaikuttaa insuliiniresistenssin ja tyypin 2 diabeteksen patogeneesiin.

Ympäristötekijät

Lihavuuden aiheuttama vapaiden rasvahappojen (FFA) lisääntyminen verenkierrossa saattaa laukaista insuliiniresistenssin lipidien kertymisen kautta.

Tämä voi aktivoida epätyypillisen PKC:n, joka estää insuliinin solusignaloinnin ja insuliinin stimuloiman glukoosinoton luuston lihaksissa, sekä vähentää insuliinin stimuloimaa maksan glykogeenisynteesiä. Tämä voi johtaa insuliiniresistenssiin ja lisääntyneeseen glukoosin kulkeutumiseen maksassa.

Lisäksi vapaat rasvahapot laukaisevat insuliiniresistenssin aktivoimalla suoraan Tollin kaltaisen reseptorin 4 (TLR4) ja luontaisen immuunivasteen.

Lihavuus liittyy tulehdustekijöihin, joille on tunnusomaista ATM:ien (rasvakudoksen makrofagien) lisääntyminen

Tulehdustekijät lisäävät lipolyysiä ja edistävät maksan triglyseridisynteesiä ja hyperlipidemiaa lisääntyneen rasvahappoesteröinnin vuoksi.

ATM stimuloi tulehdussytokiineja, jotka estävät insuliinin signalointia ja nopeuttavat maksan glukoneogeneesiä sekä postbrandiaalista eli aterianjälkeistä hyperglykemiaa.

Muita insuliiniresistenssiä selittäviä mekanismeja ovat sekä mTOR- että S6K1-reittien aktivaatio. Nämä aktivaatiot aiheuttavat IRS-1: n seriinifosforylaation ja sen jälkeen IRS-1:een liittyvän PI3K-aktiivisuuden vähenemisen. On arveltu, että ravinteiden kyllästysolosuhteissa S6K1 voi säätää negatiivisesti insuliinin signalointia ja herkkyyttä.

Lisäksi IRS-1:n seriinifosforylaatiota on tutkittu eri olosuhteissa. Näyttää siltä, että mTOR-S6K1:stä riippuvaisen mekanismin lisäksi erilaiset seriinikinaasit, kuten c-Jun NH2-terminaalinen kinaasi (JNK), stressillä aktivoidut proteiinikinaasit, tuumorinekroositekijä-alfa (TNF-a) ja PKC voivat edistää IRS:n seriinifosforylaatiota aiheuttaen insuliinisignaalin voimakkuuden vähenemisen metaboliareitillä.

Lihavuuden merkitys insuliiniresistenssissa

Ihmisillä, joiden painoindeksi (BMI) on korkea (BMI ≥ 30 kg / m2), on suurempi sydän- ja verisuonitautien riski verrattuna ihmisiin, joilla on normaali BMI (BMI = 18,8–24,9 kg / m2).

Lihavuus assosioituu insuliiniresistenssiin. Molekyylimekanismi, jolla rasvan lisääntyminen selittäisi insuliiniresistenssin, on kuitenkin epäselvä; lipidien kertymisestä johtuva tulehdus, rasvahappojen hapettumisen estävä vaikutus glukoosin hapettumiseen, lipotoksiinien kertyminen ja adiposytokiinien eritys on kaikki yhdistetty paikallisen ja systeemisen insuliiniresistenssin kehittymiseen.

Lisääntyvä näyttö viittaa siihen, että rasvakoostumuksen heterogeenisuus ja rasvakudoksen jakautuminen voi olla ratkaisevan tärkeää insuliiniresistenssin ja kardiometabolisten häiriöiden kehittymisessä.

Viskeraalinen rasvakudos (VAT) assosioituu vahvasiti insuliiniresistenssin, DM2:n lisääntyvään esiintyvyyteen ja suurempaan sydän- ja verisuonitautien riskiin.

Viskeraalinen rasva liittyy tulehdusta edistävien adiposytokiinien korkeaan tuotantoon, oksidatiiviseen stressiin ja reniini-angiotensiini-aldosteronijärjestelmän (RAAS) aktivaatioon.

Krooninen energian (kalorien) liikasaanti aiheuttaa sisäelinten rasvamassan lisääntymisen, yksittäisten adiposyyttien hypertrofian ja adiposyyttien jakautumisen uusiksi rasvasoluiksi.

Rasvapitoisuuden lisääntyessä adiposyytit vapauttavat kemotaktisia tekijöitä, kuten monosyyttien kemoattraktantiproteiini-1 (MCP-1) ja tuumorinekroositekijä-a (TNFa), jotka moduloivat tulehdusvastetta rasvakudoksessa. MCP-1 aloittaa monosyyttien migraation viskeraaliseen rasvakudokseen ja edistää niiden erilaistumista makrofageiksi.

Makrofagit erittävät suuria määriä TNF-alfaa. Lipolyysi lisääntyy samalla kun insuliinin stimuloiman glukoosin kuljettaja-4 (GLUT4), triglyseridien biosynteesi ja adiposyyttien varastointi viskeraalisessa rasvakudoksessa vähenevät, mikä tämän mallin mukaan johtaa kiertävien veressä triglyseriditasojen nousuun.

Tämä tapahtuma voi johtaa toksisten rasvahappolajien (eli diasyyliglyserolin, keramidin) lipidisaostumiin rasvakudoksessa, haimassa, munuaisten verisuonissa, maksassa, luurankolihaksissa ja sydämessä, mikä johtaa epikardiaalisen rasvakudoksen (EAT) lisääntymiseen.

EAT:n kasvu aiheuttaa sydämen rasvoittumiseen ja massan lisääntymiseen molemmissa kammioissa, mikä johtaa kammion hypertrofiaan, supistumishäiriöön, apoptoosiin, fibroosiin ja heikentyneeseen vasemman kammion diastoliseen toimintaan.

Insuliiniresistenssi ja sydäntaudit

Kohonnneet LDL-tasot, tupakointi, korkea verenpaine ja tyypin 1 ja 2 diabetes ovat tunnettuja sydän- ja verisuonitautien riskitekijöitä, mutta insuliiniresistenssi, hyperglykemia ja inflammaatio voivat myös ennakoida haitallisia sydän- ja verisuonitapahtumia.

Insuliiniresistenssi liittyy aineenvaihdunnan häiriöihin, kuten hypertriglyseridemiaan sekä mataliin HDL-tasoihin. Lisäksi insuliiniresistenssiä on havaittu noin 30%:lla potilaista, joilla on diagnosoitu verenpainetauti (hypertensio).

Vuonna 1996 toteutetussa insuliiniresistenssin ateroskleroositutkimuksessa (IRAS) tutkijat osoittivat suoran yhteyden insuliiniresistenssin ja ateroskleroosin välillä. Jatkotutkimuksessa 2938 potilaan kohortissa määriteltiin insuliiniresistenssi tärkeäksi sydäninfarktin riskitekijäksi.

Vuonna 2012 tehty 65 tutkimuksen ja yhteensä 516 325 henkilön meta-analyysi, osoitti, että HOMA-indeksillä arvioituna insuliiniresistenssi ennustaa hyvin sydän- ja verisuonitauteja.

Archimedes-mallin ja 20–30-vuotiaiden nuorten diabetesta sairastamattomien aikuisten populaation seurannan perusteella tutkijat päätyivät johtopäätökseen, että insuliiniresistenssin estäminen populaatiotasolla voisi vähentää 42% sydäninfarkteista simuloidun 60 vuoden seurantajakson aikana.

Vaikka useat tutkimukset tukevat ajatusta siitä, että sydän- ja verisuonitaudit liittyvät insuliiniresistenssiin, on myös eräitä kiisteltyjä raportteja.

Insuliiniresistenssin lisäksi insuliiniresistenssiin liittyvällä kompensoivalla hyperinsulinemialla voi olla kriittinen rooli ateroskleroottisten plakkien muodostumisessa muuttamalla estrogeenireseptoreihin liittyvää geeniekspressiomallia, kuten eläinmalleissa on havaittu.

Hyperglykemia aiheuttaa muutoksia aineenvaihdunnan- ja solujen toiminnoissa: dyslipidemia (veren huono lipiditasapaino), hypertensio, endoteelin toimintahäiriöt, oksidatiivinen stressi ja muutokset sydämen aineenvaihdunnassa näyttävät liittyvän hyperglykemiaan.

Noin 50–70% sydänlihaksen tarvitsemasta ATP:stä  tuotetaan (pitkäketjuisten) rasvahappojen hapetuksella ( β-oksidaatio). Glykolyysin osuus terveessä sydämessä on alle 10% ATP:n kokonaistuotannosta.

Sydän käyttää energiantuotantoon ensisijaisesti pitkäketjuisia rasvahappoja, mutta sydämellä on kyky vaihtaa toiseen energiasubstraattiin ATP:n tuottamiseksi sydämen energiantarpeen varmistamiseksi. Myös substraattikuljettimilla, GLUT4 (glukoosille) ja CD36 (rasvahapoille), on merkitys tässä substraatin käyttöasteen dynaamisessa tasapainossa.

Loukkaantumisen aikana sydän siirtyy rasvahappojen käytöstä energia-substraateina kohti glukoosia, mutta tämä metabolinen joustavuus heikentyy insuliiniresistenssin aikana, jolloin rasvahappo on ainoa polttoaineen lähde.

Tämä muutos indusoi lipidien imeytymisen ja kertymisen lisääntymistä sydämessä tuottaen lipotoksisuutta. Tässä mielessä tasapaino lipidien hajoamisen ja glukoosin hapettumisen välillä voi vähentää diabeettista kardiomyopatiaa.

Insuliiniresistenssi ja dyslipidemia

Insuliiniresistenssin ja tyypin 2 diabeteksen (diabeettinen dyslipidemia) aiheuttamalle dyslipidemialle on tunnusomaista lipidien kolmikko:

  1. korkeat plasman triglyseriditasot
  2. matalat HDL-tasot

  3. pienten tiheiden matalatiheyksisten lipoproteiinien (sdLDL) pitoisuuden kasvu sekä liiallinen aterianjälkeinen lipidemia

Hypertriglyseridemia lisää sydän- ja verisuonitautien ilmaantuvuutta miehillä 32% ja naisilla 76%.

10 038 ihmisellä, joilla oli normaali verenpaine tai pre-hypertensio, tehty tutkimus osoitti dyslipidemian olevan vahva ennuste tyypin 2 diabeteksen kehittymiselle.

Usein diabeettinen dyslipidemia kehittyy vuosia ennen tyypin 2 diabetesta, mikä viittaa siihen, että epänormaali lipidimetabolia on varhainen sydän- ja verisuonitautien indikaattori tyypin 2 diabeteksessa.

Lihavuus on maailmanlaajuinen epidemia, joka liittyy läheisesti tyypin 2 diabeteksen sekä sydän- ja verisuonitautien (CVD) kehittymiseen.

Lihavuuteen liittyvä viskeraalinen ja epikardiaalinen rasva ovat sydänsairauksien riskitekijöitä. Lihavuudella on merkittävä vaikutus lipoproteiiniprofiilin ja systeemiseen ja verisuonitulehdukseen sekä endoteelin toimintahäiriöön liittyvien tekijöiden modifioinnissa.

Epänormaalit lipidien ja apolipoproteiinien pitoisuudet voivat aiheuttaa muutoksia lipoproteiinihiukkasten tuotannossa, konversiossa tai kataboliassa.

Nämä muutokset voivat myötävaikuttaa liikalihavuuden lisääntyneeseen basaaliseen lipolyysiin ja rasvahappojen vapautumiseen verenkiertoon, mikä johtaa proaterogeeniseen fenotyyppiin.

Insuliiniresistenssi ja liporoteiinieprofiilien muutokset

VLDL, hyvin matalatiheyksinen lipoproteiini, kootaan ja tuotetaan substraattien saatavuuden perusteella maksassa.

Insuliini säätelee tiukasti VLDL-tuotantoa. Maksan VLDL-tuotanto indusoituu paastotilassa, mikä johtaa lisääntyneeseen VLDL-pitoisuuteen veressä.

Eri lähteistä peräisin olevien lipidien lisääntyminen, kuten verenkierron vapaat rasvahapot, triglyseridipitoisten lipoproteiinien endosytoosi ja de novo lipogeneesi mahdollistavat apoB:n translaation jälkeisen stabiloinnin ja tehostavat VLDL-hiukkasten kokoonpanoa ja eritystä.

Tämä johtaa VLDL:n ja vapaiden rasvahappojen uotantoon. Lipoproteiinit kuljettavat energiaa maksan ja rasvakudoksen välillä. Vastauksena insuliinin eritykseen VLDL-synteesi estetään plasman triglyseriditason rajoittamiseksi. Normaalisti insuliini edistää PI3K-aktivaation avulla apoB:n hajoamista, mutta insuliiniresistenssin aikana tämä hajoaminen on heikentynyt.

Yhdistelmä:

  1. käytettävissä olevien rasvahappojen ylimäärä

  2. apoB: n rajoitettu hajoaminen

  3. apoB: n suurempi stabiloituminenVLDL-synteesin kasvu selittää insuliiniresistenssissä havaitun hypertriglyseridemian

Insuliiniresistenssi vähentää myös lipoproteiinilipaasiaktiivisuutta, joka on tärkeä VLDL-puhdistuman välittäjä. Tällä vaikutuksella on vähäinen vaikutus plasman triglyseriditasoon, vaikka se on myös mekanismi, jota myös muutetaan.

Tyypin 2 diabetesta sairastavilla potilailla VLDL:n, IDL:n ja LDL:n imeytyminen maksassa vähenee, mikä johtaa näiden lipoproteiinien viipymisaikojen pitenemiseen plasmassa.

SdLDL: n muodostuminen ja alentuneet HDL-tasot liittyvät läheisesti insuliiniresistenssiin. Ateroskleroosiriskien (ARIC) prospektiivisessa tutkimuksessa sdLDL: n plasmatasoihin liittyi sepelvaltimotaudin (CHD) riski. Lisäksi VLDL-tasot ovat tärkein LDL-koon ennustaja.

SdLDL: n muodostuminen riippuu sekä kolesteryyliesterin siirtoproteiinin (CETP) että maksan lipaasin osallistumisesta. CETP helpottaa triglyseridien siirtymistä VLDL:stä LDL:ään ja HDL:ään, tuottaa triglyseridipitoisen LDL:n ja johtaa matalaan HDL-C:hen.

Triglyseridipitoinen LDL on maksalipaasin substraatti, mikä lisää triglyseridipitoisen LDL:n lipolyysiä, mikä johtaa sdLDL: n muodostumiseen. Erilaisia mekanismeja on ehdotettu selittämään sdLDL:n lisääntynyttä aterogeenistä vaikutusta.

Näitä mekanismeja ovat:

  1. alempi affiniteetti LDL-reseptoriin

  2. helpotettu pääsy valtimon seinämään

  3. valtimon retentio

  4. suuri hapettumisherkkyys

  5. pidempi puoliintumisaika

Lisääntyneet sdLDL-tasot edustavat lisääntynyttä määrää aterogeenisiä hiukkasia, mikä ei välttämättä heijastu LDL-tasoilla, koska sdLDL-hiukkaset sisältävät vähemmän kolesterolia.

HDL-hiukkasten triglyseridirikastus CETP:llä yhdistettynä maksalipaasin lipolyyttiseen vaikutukseen johtaa plasman HDL-C:n ja apoA-I:n vähenemiseen, mikä vaikuttaa pienen tiheän HDL:n muodostumiseen ja johtaa näiden hiukkasten lisääntyneeseen kataboliaan.

Vuonna 1932 ei-diabeetikoilla tehdyssä retrospektiivisessä tutkimuksessa raportoitiin, että triglyseridin ja HDL-kolesterolin suhde voi ennustaa insuliiniresistenssin ja metabolisten sairauksien todennäköisyyden. Lisäksi on osoitettu lipidien kerääntymistuotteiden ja triglyseridien glukoosindeksin korrelaatio insuliiniresistenssin ja CVD:n kanssa.

Insuliiniresistenssi johtaa lisääntyneeseen vapaiden rasvahappojen (FFA) vapautumiseen rasvasoluista. Plasman paasto-FFA:n kohonnut suhde insuliinipitoisuuteen on rasvakudoksen insuliiniresistenssi. Rasvakudoksen insuliiniresistenssin on raportoitu olevan riskitekijä aortan venttiilin kalkkeutumisessa, mikä ennustaa sydän- ja verisuonitaudit.

Insuliiniresistenssi, verenpainetauti ja endoteelin häiriöt

Kliiniset tutkimukset ovat osoittaneet, että noin 50 prosentilla hypertensiivisistä koehenkilöistä on komorbidi hyperinsulinemia tai glukoosi-intoleranssi, kun taas vähintään 80 prosentilla tyypin 2 diabetesta sairastavista potilaista on komorbidi hypertensio.

Komorbiditeetti tarkoittaa kahden tai useamman itsenäisen sairauden esiintymistä samanaikaisesti. Komorbidi sairaus tai häiriö voi olla seurausta perussairaudesta tai suorassa yhteydessä siihen. Tämä johtuu usein erilliseksi luokiteltujen ongelmien yhteisestä taustatekijästä.

Komorbidit häiriöt ovat silti usein vaikeammin hoidettavissa kuin yksittäisesti esiintyvät häiriöt, sillä hoitoa suunniteltaessa on otettava huomioon kunkin häiriön yksittäiset ominaispiirteet ja niiden yhdistelmien variaatiot. – Wikipedia

Verenpainetaudin ja diabeteksen yhdistelmää sairastavilla potilailla on selvästi korostunut sydän- ja verisuonitautien riski.

On ehdotettu, että poikkeavuudet vasodilataatiossa, verenkierrossa ja reniini-angiotensiini-aldosteronijärjestelmässä (RAAS) voivat liittyä hypertensioon ja insuliiniresistenssiin. Lisäsyynä verenpainetautiin insuliiniresistentillä potilaalla on sympaattisen hermoston yliaktiivisuus, joka edistää myosyyttien hypertrofiaa, interstitiaalista fibroosia ja heikentynyttä verisuonten supistumista, johon liittyy lisääntynyt myosyyttien apoptoosi (solukuolema).

RAAS-järjestelmässä angiotensinogeeni muuttuu reniiniksi angiotensiini I:ksi, joka sitten ACE:n (angiotensiiniä konvertoivan entsyymin) avulla muutetaan angiotensiini II:ksi (Ang II). Lopuksi Ang II vaikuttaa sekä AT1- että AT2-reseptoreihin. AT1-reseptori välittää kaikki Ang II:n klassiset vaikutukset, kuten verenpaineen nousu, verisuonten supistuminen, lisääntynyt sydämen supistuvuus, munuaisten natriumpitoisuus, veden reabsorptio ja aldosteronin vapautuminen lisämunuaisen kuoren zona glomerulosasta lisämunuaisessa.

Yksi aldosteronin rooleista on lisätä natriumin reabsorptiota distaalisessa nefronissa. Tämän vaikutuksen tarkoituksena on ylläpitää natriumtasapainoa aktivoimalla apikaalisen epiteelin natriumkanava ja basolateraalinen Na +, K + -ATPaasi. Aldosteronilla on kuitenkin vaikutuksia myös munuaisiin, verisuoniin ja sydänlihakseen, millä voi olla patofysiologisia seurauksia.

Tutkimukset ovat osoittaneet, että hyperglykemia lisää angiotensinogeenin, ACE:n ja Ang II:n transkriptiota. Tyypin 2 diabetesta sairastavilla on havaittu RAAS:n ylöspäin säätely sydän- ja verisuonijärjestelmässä. Ylössäädelty RAAS voi vaikuttaa monien diabeettisten komplikaatioiden, kuten mikrovaskulaaristen ja makrovaskulaaristen sairauksien, kehittymiseen. Lisäksi on osoitettu, että Ang II:n ylössäätely ja mineralokortikoidireseptorin aktivointi aldosteronilla voivat edistää insuliiniresistenssia aktivoimalla mTOR – S6K1-signaalinsiirtoreitti indusoimalla fosforylaatio IRS:n seriinitähteissä.

Diabeettisen kardiomyopatian kehittymiseen liittyvät mekanismit

Normaalisti insuliinin signalointi säätelee glukoosin ja lipidien aineenvaihduntaa sydämessä. Insuliiniresistenssi aiheuttaa metabolisen häiriön, joka johtaa korkeaan lipidihapetukseen ja matalaan glukoosihapetukseen.

Reniini-angiotensiini-aldosteronijärjestelmän (RAAS) aktivaatio voi aiheuttaa mitokondrioiden toimintahäiriöitä, endoplasmisen verkkokalvon stressiä ja oksidatiivista stressiä. Tämä voi johtaa epänormaaliin Ca2 + -käsittelyyn ja alhaiseen ATP-tuotantoon, mikä johtaa kardiomyosyyttien kuolemaan.

RAAS:n aktivaatio ja hyperinsulinemia voivat synergistisesti stimuloida MAPK-reittiä, jolla on verisuoniseinää vahingoittava vaikutus, koska se indusoi endoteelin toimintahäiriöitä ja edistää näin ateroskleroosia.

Tutkimuksissa on pohdittu, että insuliinin ja Ang II:n signaalinsiirtoreitit jakavat useita alavirran tehosteita ja kommunikoivat useilla tasoilla. RAAS:n (Ang II ja aldosteroni) ja yliravitsemuksen aktivaatio edistää endoteelin toimintahäiriötä lisäämällä nikotiiniamidiadeniinidinukleotidifosfaatti (NADPH) -oksidaasin välittämää ROS-tuotantoa, mekanismia, joka myös kohottaa verenpainetta.

Itse asiassa ROS johtaa redox-herkkien kinaasien, kuten S6K1:n ja mTOR:n, aktivoitumiseen, aiheuttaen insuliini-PI3K-signalointireitin, fosforylaation kautta IRS-1: n seriinitähteissä. Viimeksi mainittu mekanismi estää Akt-fosforylaation, Glut-4-translokaation sarkolemmaan ja typpioksidin (NO) tuotannon alavirran signaloinnin endoteelissä.

Lisäksi hypertensioon ja tyypin 2 diabetekseen liittyy myös endoteelin esisolujen määrän väheneminen ja toimintahäiriöt, jotka ovat kiertäviä luuytimestä peräisin olevia kantasoluja, joilla on tärkeä rooli verisuonten seinämän endoteelikorjauksessa.

Joissakin kliinisissä ja kokeellisissa tutkimuksissa on osoitettu, että RAAS-esto paransi insuliinin signalointia ja insuliiniherkkyyttä, mutta toisissa ei ole osoitettu mitään hyödyllistä vaikutusta. Tämä ero voidaan selittää joko eroilla kokeiden suunnittelussa tai tutkimuspopulaatioissa.

Yhteenvetona voidaan todeta, että TOR / S6K: n aktivointi RAAS:lla tai yliravitsemuksella johtaa insuliiniresistenssiin, jolla on metabolisia ja biologisia seurauksia. Se johtaa myös heikentyneeseen sydänlihaksen glukoosikäyttöön ja diastolisen rentoutumisen vähenemiseen.

Insuliiniresistenssi ja endoteelin toimintahäiriöt

Funktionaalisen endoteelin eheys on tärkeä verisuonten terveyselementti. Typpioksidia (NO) pidetään kehon tehokkaimpana endogeenisena vasodilataattorina (verisuonten laajentajana), ja NO:n biologisen hyötyosuuden väheneminen on endoteelin toimintahäiriön tunnusmerkki.

Endoteelin toimintahäiriö vaikuttaa sydän- ja verisuonitauteihin, kuten hypertensio, ateroskleroosi ja sepelvaltimotauti, jotka myös aiheutuvat insuliiniresistenssistä.

NO osallistuu verisuonten seinämän homeostaasiin verihiutaleiden aggregaation, leukosyyttien adheesion eston ja anti-inflammatoristen ominaisuuksien avulla. Fysiologisissa olosuhteissa insuliinin NO-tuotannon konstitutiivisella stimulaatiolla voi olla tärkeä rooli verisuonten terveyden ylläpidossa, koska se kykenee rentouttamaan verisuonen sileää lihasta.

Insuliiniresistenssitilassa insuliinin stimuloima NO-synteesi on kuitenkin heikentynyt selektiivisesti ja kompensoiva hyperinsulinemia voi aktivoida MAPK-reitin, mikä johtaa verisuonten supistumiseen, tulehdukseen, lisääntyneeseen natriumin ja veden kertymiseen, mikä johtaa verenpaineen nousuun.

Insuliiniresistenssi endoteelisoluissa lisää protromboottisia tekijöitä, tulehdusta edeltäviä markkereita ja vapaita happiradikaleja, mikä johtaa adheesiomolekyylin 1 (ICAM-1) ja verisuonisolujen adheesiomolekyylin 1 (VCAM-1) solunsisäisten tasojen nousuun.

Endoteelin toiminnan ja insuliinin aineenvaihdunnan välinen suhde on erittäin tärkeä. Tämä johtuu siitä, että insuliiniresistenssin ja endoteelin signaalihäiriöiden välinen yhteys edistää tulehdusta, häiritsee endoteelin tasapainoa vasodilataattorin ja vasokonstriktorimekanismien välillä ja lisää kardiovaskulaarista riskiä.

Tutkimuksessa, joka tehtiin ei-diabeetikoilla, joilla epäillään sydänlihasvaurioita, raportoitiin, että HOMA-IR:llä mitattu insuliiniresistenssi korreloi voimakkaasti endoteelin toimintahäiriöiden ja prognostisen arvon kanssa.

Krooninen hyperglykemia sydän- ja verisuonitaudeissa

Lisääntynyt sydän- ja verisuonitautiriski tyypin 2 diabetesta sairastavilla potilailla on tunnettu jo pitkään. Diabetesta sairastavilla potilailla on lisääntynyt verisuonten sairastuvuus ja kuolleisuus, mikä alentaa heidän elinajanodotettaan noin 5–15 vuodella.

Lisäksi on osoitettu, että sydän- ja verisuonitautien ilmaantuvuus on 2–8 kertaa suurempi tyypin 2 diabetesta sairastavilla henkilöillä kuin diabeetikoilla, ja tämä tauti aiheuttaa suurimman osan kuolemista.

Jälkimmäisen tueksi epidemiologiset ja patofysiologiset tutkimukset viittaavat siihen, että hyperglykemia (kroonisesti korkea verensokeri) voi olla suurelta osin vastuussa sydän- ja verisuonitaudeista.

Verensokerin on raportoitu ennakoivan luotettavasti ateroskleroosia, ja yli 90 mg / dl: n verensokeritaso voi johtaa ateroskleroosiin kaulavaltimossa. Pitkän aikavälin seurantatiedot tyypin 1 ja 2 diabetesta sairastavilta potilailta viittaavat siihen, että hyperglykemia on diabetekseen liittyvien sairauksien ja CVD:n riskitekijä.

Salvin et al. Havaitsi, että yhden yksikön nousu glykosyloidussa hemoglobiinissa tai HbA1C:ssä voi lisätä sydän- ja verisuonitautien riskiä 18%.

Jopa selkeän diabeteksen puuttuessa glukoosihomeostaasin heikkeneminen voi vaikuttaa sydämen autonomiseen toimintaan, mikä johtaa korkeaan sydänsairauksien riskiin.

Hyperglykemian haitalliset vaikutukset kardiomyosyyteihin voidaan selittää ilmiöllä, jota kutsutaan hyperglykeemiseksi muistiksi. Ilmiössä hyperglykeeminen stressi jatkuu pitkään verensokeritason normalisoitumisen jälkeen.

Glukoosivaihtelut ja hyperglykemia laukaisevat tulehdusreaktioita mitokondrioiden toimintahäiriöiden ja endoplasmisen verkkokalvon kautta. Tämä edistää vapaiden reaktiivisten happiradikaalien kertymistä, mikä puolestaan aiheuttaa soluvaurioita.

Hyperglykemia voi myös lisätä tulehdusta edistävien ja hyytymistä estävien tekijöiden ilmentymistä, mikä edistää leukosyyttien tarttumista endoteelisoluihin. Se indusoi apoptoosia ja heikentää typpioksidin vapautumista, mikä johtaa endoteelin toimintahäiriöön. Tästä syystä tulehdus johtaa insuliiniresistenssiin ja β-solujen toimintahäiriöihin, mikä pahentaa edelleen hyperglykemiaa.

Lisäksi glukoosivaihteluiden ja hyperglykemian tuottamat muutokset voivat aiheuttaa pitkäaikaisia epigeneettisiä modifikaatioita NF-KB: n promoottorissa, jonka näyttää vaikuttavan lisääntyneestä oksidatiivisesta stressistä.

Toinen pysyvän hyperglykemian haitallinen vaikutus on pitkälle edenneiden glykaation lopputuotteiden (AGE) sukupolvi, jotka ovat proteiinien ja lipidien ei-entsymaattisia glykaation tuotteita sokereille altistumisen seurauksena.

Yleensä AGE:t kertyvät verisuonen seinämään, mikä vaikuttaa solunulkoisen matriisin (ECM) rakenteelliseen eheyteen (tunnetaan myös nimellä matriisisoluvuorovaikutukset). Jälkimmäinen aiheuttaa endoteelivaurioita ja vähentää NO-aktiivisuutta. Kaiken kaikkiaan AGE:t edistävät diabeettisten komplikaatioiden, kuten retinopatian, nefropatian sekä sydän- ja verisuonitautien etenemistä.

Insuliiniresistenssi ja muutokset sydänmetaboliassa

Sydänseinämän paksuin kerros on sydänlihassoluista koostuva sydänlihas, joten luurankolihassolujen fysiologian tarjoama tieto auttaa selittämään sydämen aineenvaihduntaa.

Nisäkkään sydämen on supistettava lakkaamatta; mikä tarkoittaa, että optimaalisen toiminnan energiantarve on valtava. Tämä on mielenkiintoinen ilmiö, koska sydämen lihaksessa ei ole ATP-varausta.

Energiaa varastoidaan sydämen lihassoluihin kolmessa muodossa:

  1. Ensimmäinen on fosfokreatiini (PCr), joka voi nopeasti luovuttaa korkean energian fosfaatit ATP:n tuottamiseksi ADP:stä. PCr: stä saatavissa oleva energia on suhteellisen vaatimaton, sitä käytetään vain erittäin nopeiden harjoitusten aikana

  2. Toinen on glykogeeni, joka muodostaa solussa endogeenisen energiamuodon. Lihaksen glykogeenivarastokapasiteetti on rajallinen. Sen etuna on kuitenkin se, että se kuluttaa paljon vähemmän happea kuin rasvahapot ja on helposti saatavilla käytettäväksi polttoaineena lihaksissa.

  3. Kolmas muoto on triglyseridit ja vapaat rasvahapot (FFA). Niiden hapettuminen on vähemmän tehokasta verrattuna glykogeeniin, vaikka ne sisältävät enemmän energiaa.
    On yleisesti hyväksyttyä, että vapaat rasvahapot ovat hallitsevia substraatteja, joita käytetään aikuisen sydänlihaksessa ATP:n tuotantoon mitokondriossa. Siten 60-70% sydämen työn ylläpitoon tarvittavasta energiasta tulee vapaiden rasvahappojen β-oksidaatiosta. Verenkierron vapaiden rasvahappojen tasot määräävät suurelta osin vapaiden rasvahappojen imeytymisen sydämessä. Kun FFA on imeytynyt, sen metaboliaa säätelee pääasiassa transkriptiotasolla ligandiaktivoitujen transkriptiotekijöiden perhe, nimittäin peroksisomiproliferaattorin aktivaattorireseptori a (PPAR-a).

Sydämen aineenvaihduntaverkosto on ravinnon, paaston ja intensiivisen liikunnan suhteen erittäin joustava energiasubstraattien käytössä. Kardiomyosyytit, eli sydänlihassolut pystyvät käyttämään glukoosia ja laktaattia, aminohappoja, sekä ketoaineita.

Glukoosinottoa välitetään glukoosikuljettimien kautta. Kuljettimia on kahta erilaista tyyppiä, Na2 + -kytketty kantajajärjestelmä ja helpottavat glukoosikuljettimet (GLUT). GLUT1 ja GLUT4 ovat tärkeimmät toimijat sydämen glukoosikuljetuksissa.

GLUT4 edustaa tärkeintä mekanismia, joka säätelee glukoosin sisäänpääsyä sykkivässä sydämessä. GLUT1:llä on vähäisempi rooli, koska se on ensisijaisesti paikallaan plasmamembraanilla ja vastuussa sydämen glukoosin perusinsuliinista.

GLUT4:ää esiintyy enimmäkseen solunsisäisissä rakkuloissa lepovaiheissa ja se siirtyy plasmamembraaniin insuliinistimulaation yhteydessä. Imeytymisen jälkeen vapaa glukoosi fosforyloituu nopeasti glukoosi-6-fosfaatiksi (G6P), joka myöhemmin pääsee moniin metaboliareitteihin.

Glykolyysi edustaa glukoosin aineenvaihdunnan pääreittiä, joka tuottaa pyruvaatin myöhempää hapetusta varten. Glykolyysin ohella G6P voidaan myös kanavoida glykogeenisynteesiin tai pentoosifosfaattireittiin (PPP). PPP on tärkeä NADPH-lähde, jolla on kriittinen rooli solun oksidatiivisen stressin säätelyssä ja jota tarvitaan lipidisynteesiin.

Vastauksena lisääntyneeseen energiantarpeeseen sydämen lihassolut luottavat aluksi hiilihydraattien hapettumiseen. Esimerkiksi stressin, kuten liikunnan, iskemian ja patologisen hypertrofian alaisena, glukoosin substraattipreferenssiä voidaan muuttaa. Stressin aikana GLUT4-ilmentymisen nopea kasvu on varhainen adaptiivinen vaste, joka viittaa siihen, että tämän sopeutumisen fysiologisena tehtävänä on parantaa lihasten glykogeenivarastojen täydennystä.

Kun glykogeenipitoisuus on korkea, sydän käyttää ensisijaisesti glykogeenia energiasubstraatin lähteenä, mutta kun glykogeenivarastot ovat vähäisiä, se muuttuu rasvahappojen hapettumiseksi. Tämä induktio voidaan estää suurella hiilihydraattiruokavaliolla palautumisen aikana. Aineenvaihdunnan hallinta palautumisessa glykogeenitasojen avulla korostaa sen merkitystä aineenvaihdunnan lihasten varaan.

Insuliiniresistenssissä sydän on rikkaassa rasvahappo- ja glukoosiympäristössä. Ylimääräinen insuliini edistää vapaiden rasvahappojen lisääntynyttä imeytymistä sydämessä klusterin erilaistumisproteiinin 36 (CD36) säätelyn seurauksena. Se on voimakas vapaiden rasvahappojen kuljettamiseen ja säätelyyn vaikuttava proteiini. Tämä lisää solunsisäisiä rasvahappoja ja PPAR-a-ilmentymistä. Viimeksi mainittu lisää geeniekspressiota rasvahappojen hapettumisen kolmessa vaiheessa lisäämällä (1) FFA-kuljettajien synteesiä solussa, (2) proteiineja, jotka tuovat FFA:ta mitokondrioon, ja (3) entsyymejä rasvahappojen hapetuksessa.

Toisaalta glukoosin käytön eston takia kardiomyosyytteihin kertyy glykolyyttistä välituotetta, mikä indusoi glukotoksisuutta

Kun diabetes etenee tai kun sydämeen kohdistuu lisärasituksia; metabolista sopeutumista voi esiintyä, ja aineenvaihdunnan joustavuus heikkenee huomattavasti. Sydän heikentää kykyään käyttää rasvahappoja, lisää vapaiden rasvahappojen kulkeutumista ja johtaa lipidien (keramidit, diasyyliglyserolit, pitkäketjuiset asyyli-CoA:t ja asyylikarnitiinit) kertymiseen sydänlihakseen.

Tämä lipidien kertyminen voi vaikuttaa solujen kuolemaan (apoptoosiin), heikentää mitokondrioiden toimintaa, sydämen hypertrofiaa ja supistushäiriöitä. Esimerkiksi diasyyliglyseroli ja rasva-asyylikoentsyymi (CoA) indusoivat epätyypillisen PKC: n aktivaation, mikä johtaa heikentyneeseen insuliinin signalointiin.

Keramidit, jotka yhdistävät lipidien aiheuttaman tulehduksen insuliinin signaloinnin estoon, toimivat lipotoksisten signalointireittien avainkomponentteina. Toisaalta korkea lipidipitoisuus voi aiheuttaa supistushäiriöitä insuliiniresistenssistä riippumatta. Seurauksena oleva sydänlihaksen energiantuotannon vika heikentää myosyyttien supistumista ja diastolista toimintaa. Nämä muutokset aiheuttavat toiminnallisia muutoksia, jotka johtavat kardiomyopatiaan ja sydämen vajaatoimintaan.

Glukoosin puuttuessa maksassa syntyvät ketoaineet pääsevät verenkiertoon, ja elimet, kuten aivot, munuaiset, luurankolihakset ja sydän, käyttävät niitä energiasubstraatteina. Sydänlihaksen polttoaineenvaihdunnan ja bioenergian häiriöt vaikuttavat sydän- ja verisuonitauteihin, koska aikuisen sydän vaatii paljon energiaa supistumiseen.

Sydän- ja verisuonitauteissa sydämen kyky käyttää rasvahappoja, sydämen ensisijaista polttoainetta, on heikentynyt

Tässä tilanteessa sydän käyttää vaihtoehtoisia reittejä, kuten ketoaineita, polttoaineena ATP:n tuotannossa. Edelleen kiistellään siitä, kuinka hyvin sydänlihas sopeutuu tähän energiasubstraatin muutokseen.

Viime aikoina on osoitettu, että syklinen ketoaineiden käyttö energiasubstraattina ylläpitää sydämen nuoruutta vanhoilla hiirillä. Toisaalta on raportoitu, että isokalorinen (yhtäläisen energian sisältävä) ketogeeninen ruokavalio (hyvin vähän hiilihydraatteja ja runsaasti rasvoja ja / tai proteiineja) pidentää elinikää.

Ketogeenisen ruokavalion vaikutus voidaan välittää tukahduttamalla pitkäikäisyyteen liittyvä insuliinin signalointi ja mTOR-reitti sekä aktivoimalla peroksisomiproliferaattorilla aktivoitunut reseptori a (PPARa), pääsäädin, joka kytkee päälle ketogeneesiin osallistuvat geenit.

Useat raportit viittaavat siihen, että ketogeeniseen ruokavalioon voi liittyä sydän- ja verisuonitautien riskitekijöiden, kuten liikalihavuuden, diabeteksen, valtimoverenpaineen ja kolesterolitasojen, esiintyvyyden väheneminen. Toisaalta monien raporttien mukaan sydän- ja verisuonitautien riskitekijöiden väheneminen vastasi painonlaskua käytetystä ruokavaliosta riippumatta.

Muut tekijät, jotka vaikuttavat diabeettisen kardiomyopatian patogeneesiin

Muita diabeettisen kardiomyopatian patogeneesiin vaikuttavia tekijöitä ovat metaboliset poikkeavuudet, joihin liittyy mitokondrioiden toimintahäiriöitä, endoplasman verkkokalvon stressiä ja heikentynyttä Ca2 + -käsittelyä. Reaktiivisten happiradikaalien (ROS) liiallinen tuotanto johtaa proteiini-, DNA- ja kalvovaurioihin. Lisäksi ROS:lla on haitallisia vaikutuksia endoplasmiseen verkkokalvoon.

Oksidatiivinen stressi ja endoplasman verkkokalvon stressi voivat aiheuttaa solunsisäisen Ca2 + -tason nousun. Mitokondrioiden ylimääräinen Ca2 +:n otto johtaa Ca2 +:n ylikuormitukseen ja mitokondrioiden läpäisevyyden siirtymähuokosten avautumiseen, mikä johtaa myöhemmin mitokondrioiden toimintahäiriöihin ja solujen apoptoosiin. Tämä vaikuttaa myös diabeettisen kardiomyopatian patogeneesiin.

Sokerit ohjaavat sepelvaltimotautia insuliiniresistenssin ja hyperinsulinemian kautta: uusi paradigma

I know of no single acceptable study that shows a high intake of sugar in a population that is almost entirely free from heart disease.’1—John Yudkin

Sepelvaltimotauti (CHD) aiheuttaa joka kuudennen kuolemantapauksen Yhdysvalloissa. Sepelvaltimotauti johtaa lopulta akuuttiin infarktiin (MI). Yhdysvalloissa tapahtuu vuosittain melkein miljoona akuuttia sydäninfarktia, ja noin 15% potilaista kuolee sydäninfarktin seurauksena.

Oireeton hyperglykemia on sydän- ja verisuonitautien ja infarktin riskitekijä. Hyperglykemia voi kehittyä akuutin infarktin aikana myös potilaille, joilla ei ole diabetesta. Hyperglykemian voi aiheuttaa insuliinin erityksen väheneminen, insuliiniresistenssin kehittyminen sekä katekoliamiinien (adrenaliini, noradrenaliini ja dopamiini), kortisolin ja kasvuhormonin lisääntyminen.

Monilla infarktipotilailla on diagnosoitu tai diagnosoimaton diabetes, jossa akuutti stressi pahentaa diabeettista tilaa ja johtaa hyperglykemiaan. Erään tutkimuksen mukaan 73%:lla akuutin infarktin saaneista potilaista oli epänormaali glukoositoleranssi ja 50%:lla diabetes. 6 kuukauden kuluttua infarktista 43%:lla oli epänormaali glukoositoleranssi, mikä on noin kolminkertainen määrä terveisiin verrokkeihin nähden.

Hyperglykemia ei siis näytä olevan akuutti tai väliaikainen löydös potilailla, joilla on ollut infarkti. Monilla potilaalla on havaittavissa jatkuvasti epänormaali glukoositoleranssi.

Whitehall-tutkimus (prospektiivinen kohorttitutkimus), johon osallistui 18 403 potilasta, osoitti, että verensokeri 2 tuntia suun kautta otetun glukoositoleranssitestin jälkeen liittyi iän mukaan mukautettuun kardiovaskulaariseen kuolleisuuteen 7,5 vuoden jälkeen.

Ei-diabeetikoilla 2 tunnin veri glukoosipitoisuus 96 mg / dl tai korkeampi liittyi kaksinkertaiseeb sydän- ja verisuonitautien kuolleisuuden riskiin.

Suun kautta otettavaan glukoosin aiheuttama korkea insuliinivaste on todettu perifeeristen-, aivo- ja sepelvaltimoiden ateroskleroosipotilailla.

Australian Busseltonissa tehdyssä tutkimuksessa, insuliinipitoisuudet tunnin kuluttua 50 g:n glukoosiannoksen jälkeen korreloivat merkittävästi 60-vuotiaiden ja sitä vanhempien miesten 6 vuoden CVD-ilmaantuvuuteen ja 12-vuotiseen CVD-kuolleisuuteen.

Sekä Helsingin poliisitutkimuksessa että Pariisin siviilipalveluksessa olevien tutkimuksessa paastotilassa otetun 75 g tai 90 g oraalisen glukoosiannoksen jälkeinen insuliinipitoisuuden kasvu korreloi infarkti- ja sydäntautikuolemiin 5 vuotta myöhemmin 30–59-vuotiailla miehillä.

Insuliini-glukoosisuhteella oli selvin yhteys sydän- ja verisuonitauteihin. Kaikissa kolmessa tutkimuksessa insuliinin suhde sydän- ja verisuonitautiin oli riippumaton muista muuttujista, kuten lipidit, verenpaine ja verensokeri.

Puhdistetun sokerin aiheuttama insuliinivaste on jopa tärkkelyksen insuliinivastetta suurempi. Tämä on vakuuttava osoitus siitä, että lisättyjen sokereiden (sakkaroosi sekä runsaasti fruktoosia sisältävä maissisiirappi) liiallinen käyttö voi johtaa lisääntyneeseen sydän- ja verisuonitautieriskiin kohonneiden insuliinitasojen kautta.

Insuliinin ja hiilihydraattehin rooliin aterogeneesissä viittaava näyttö on vahva. Tämä järjestelmä yhdistää ateroskleroosin diabetekseen, lihavuuteen, hyperlipidemiaan ja mahdollisesti verenpainetautiin. (Stout ja Vallance-Owen)

Yli 50 vuoden ajan on ollut tiedossa, että hyperkolesterolemiaa ja hyperlipatemiaa sairastavilla ihmisillä on yleensä epänormaali hiilihydraattien aineenvaihdunta. Kohonneet insuliinitasot johtavat usein hyperlipidemiaan.

Insuliinin on todettu lisäävän lipogeneesiä (glukoosin muuttamista triglyserideiksi, eli varastorasvaksi) ja stimuloivan sileiden lihassolujen lisääntymistä. Hyperinsulinemia on itsenäinen sydänsairauksien riskitekijä. Insuliiniresistenssi ennustaa hyvin kardiovaskulaarisia riskejä. Näin ollen kaikki ruokavalion tekijät, jotka heikentävät glukoosinsietokykyä tai edistävät insuliiniresistenssiä, lisäävät todennäköisesti myös akuutin infarktin, sydän- ja verisuonitautien (CHD) ja CHD-kuolleisuuden riskiä.

Runsaasti lisättyä sokeria (erityisesti teollisesti käsiteltyä fruktoosia) sisältävä ruokavalio johtaa insuliiniresistenssiin. Lisättyjen sokereiden liiallinen kulutus on vaikuttava tekijä CHD- ja CVD-kuolleisuudessa.

Ihmisillä, joiden ruokavaliossa päivittäisestä energiasta alle 10% saadaan lisätyistä sokereista, on lähes kolme kertaa pienempi sydän- ja verisuonitautien riski, kuin ihmisillä, joiden ruokavalio sisältää 25% tai enemmän energiaa lisätyistä sokereista.

Eläin- ja ihmistutkimuksissa on havaittu, että tärkkelyksen, glukoosin tai molempien yhdistelmän isokalorinen (yhtäläisen energiapitoisuuden) korvaaminen sakkaroosilla tai fruktoosilla lisää paastoinsuliinipitoisuutta, heikentää insuliiniherkkyyttä, lisää paastoglukoosipitoisuutta, lisää glukoosi- ja insuliinivasteita sakkaroosikuormitukseen ja vähentää solun insuliiniin sitoutumista.

Toisin sanoen kalori on kalori, mutta lisättyjen sokereiden kulutus on selvästi haitallisempaa kuin tärkkelys ja/tai glukoosi, koska lisätyt sokerit heikentävät insuliiniherkkyyttä ja glukoositoleranssia.

Rottien ruokinta sakkaroosilla johtaa heikentyneeseen glukoositoleranssiin ja rasvakudokseen, joka on vähemmän herkkä insuliinin vaikutuksille.Eläimiltä ja ihmisiltä saadut tiedot viittaavat siis siihen, että lisättyjen sokereiden liiallinen kulutus johtaa insuliiniresistenssiin ja hyperinsulinemiaan.

Akuutin sydäninfarktin aikana sydän siirtyy ensisijaisesta rasvahappojen käytöstä energiana glukoosin käyttämiseen. Koska insuliini helpottaa glukoosinottoa soluihin, insuliiniresistenttien potilaiden ennuste on huonompi.

Insuliiniresistenssin aste liittyy sydäninfarktin vakavuuteen. Sydäninfarktin saanet diabeetikot kuolevat todennäköisemmin kuin ei-diabeetikot. Runsas lisättyä sokeria sisältävä ruokavalio edistää insuliiniresistenssiä ja diabetesta, ja voi siten johtaa sydäninfarkteihin ja lisätä sydänkuolleisuuden riskiä.

Diabeetikoilla on suurempi sydäninfarktin, sydäntautien ja sydänkuolleisuuden riski kuin diabetesta sairastamattomilla. Tätä riskiä ei selitä muut muuttujat, kuten tupakointi, kolesteroli, verenpaine tai kehon rasvan jakautuminen.

Potilailla, joilla on diagnosoitu äskettäin diabetes, on myös suurempi sydäninfarktin riski. Diabeetikoilla on enemmän sepelvaltimoiden ateroskleroosia kuin ei-diabeetikoilla. Erityisesti vasemman sepelvaltimon kapeneminen ja parantuneiden transmuraalisten ventrikulaaristen arpien esiintymistiheys on diabeetikoilla verrokkeja yleisempää.

Framingham-tutkimus osoitti, että diabeetikoilla on likimäärin kolminkertainen riski kuolla sydän- ja verisuonitautiin verrattuna väestöön keskimäärin, sekä lisääntynyt aivohalvauksen, sydänsairauden ja perifeerisen valtimosairauden riski.

Korkeampi verenpaine tai korkeammat lipoproteiiniarvot eivät selitä sydänsairauden lisääntynyttä esiintyvyyttä diabeetikoilla

Runsaasti lisättyä sokeria sisältävän ruokavalion on osoitettu lisäävän diabeteksen esiintyvyyttä, kun taas vähäisempi sokerin saanti assosioituu pienempään diabetesriskiin.

Lisätyt sokerit edistävät insuliiniresistenssiä. Akuutin sydäninfarktiin kokevat ovat todennäköisemmin insuliiniresistenttejä. Lisättyjen sokereiden liiallinen kulutus on sydän- ja verisuonitautien riskitekijä.

Me olemme kasvaneet uskossa, että kohonnut kolesteroli selittää sydän- ja verisuonitautien syntymekanismia, mutta se ei suinkaan ole ainoa tai ehkä edes merkittävin riskitekijä.

Sydänsasairauksissa havaitaan kolesterolin ohella monia muita kliinisiä poikkeavuuksia, kuten kohonnut glukoosi (hyperglykemia), insuliini (hyperinsulinemia), triglyseridit, virtsahappo ja matalat korkean tiheyden lipoproteiinikolesterolin (HDL) tasot. Kaikki nämä CHD-riskitekijät aiheutuvat tai pahenevat ihmisillä ja eläimillä, kun he noudattavat runsaasti sokeria sisältävää ruokavaliota.

Lisättyjen sokereiden liiallinen kulutus on tärkein sydänsairauksien aiheuttaja

Korkean glykeemisen kuorman ruokavalion noudattaminen vain muutaman viikon ajan kasvatti sydäntautien ja perifeeristen verisuonitautien riskitekijöitä kolmanneksella tutkimukseen osallistuneista.

Tämä viittaa siihen, että sokerin liiallinen kulutus ja sitä seuraava insuliiniresistenssi ja / tai hyperinsulinemia lisäävät sydän- ja verisuonitautien sekä monien muiden sairauksien, kuten verenpainetaudin, diabeteksen, lihavuuden ja kihdin riskiä.

Mielenkiintoista on, että tupakoinnin, joka on sydänsairauksien riskitekijä, on todettu aiheuttavan hyperinsuliniaa, mikä viittaa siihen, että sekä lisättyjen sokereiden liiallinen kulutus että tupakointi altistavat sydänsairauksille samalla mekanismilla (hyperinsulinemian kautta; vaikka molemmat aiheuttavat myös inflammaatiota, oksidatiivista stressiä ja lisääntynyttä verihiutaleiden puuroutumista).

Viimeisten 200 vuoden aikana keskimääräinen lisättyjen sokerien saanti on kasvanut vajaasta kahdesta kilosta lähes 60 kiloon vuodessa. Se, että diabeetikoilla on kasvanut okklusiivisen valtimosairauden riski, ja että ei-diabeetikoilla, joilla on verisuonisairaus, on myös selvästi kohonneet insuliinitasot, viittaa siihen, että insuliiniresistenssilla on merkittävä vaikutus sydäntautien patogeneesissä.

Kun otetaan huomioon, että runsaasti lisättyä sokeria sisältävä ruokavalio voi aiheuttaa ihmisille insuliiniresistenssin ja hyperinsulinemian, ja toisaalta lisättyjen sokerien vähentäminen voi parantaa näitä aineenvaihdunnan häiriöitä, on vakuuttavaa näyttöä siitä, että lisättyjen sokereiden (runsaasti fruktoosia sisältävä maissisiirappi ja sakkaroosi) runsas saanti on keskeinen sydäntautien vaikuttaja.

Puhdistettu sokeri verrattuna rasvaan, tärkkelykseen, glukoosiin tai tärkkelyksen ja glukoosin yhdistelmään, edistää suurempia haittoja ihmisen glukoositoleranssille ja insuliiniherkkyydelle.

Vieläkin uskotaan, että tärkein ruokavalion sydän- ja verisuonitautien riskiä kasvattava yksittäinen ravintoaine on tyydyttynyt rasva. Lisättyjen sokerien (sakkaroosi- tai pöytäsokeri ja runsasfruktoosinen maissisiirappi) liialliseen kulutukseen liittyy myös lisääntynyt sydän- ja verisuonitautien riski sekä sydän- ja verisuonitaudeista johtuva kuolleisuus.

Korkean glykeemisen kuorman lisättyjä sokereita sisältävä ruokavalio kasvattaa sydäntautien riskitekijöitä jo muutaman viikon aikana. Vielä tärkeämpää on, että ruokavalion, jossa on vähän lisättyjä sokereita ja puhdistettuja hiilihydraatteja, on havaittu korjaavan nämä aineenvaihduntahäiriöt.

Todisteet osoittavat, että lisätyt sokerit kasvattavat sydän- ja verisuonitautien riskiä enemmän kuin tyydyttyneet rasvat, jotka itse asiassa ovat viimeisimpien tutkimusten mukaan sydänterveyden kannalta neutraaleja. Asiasta on siis vähintään kaksi perusteltua mielipidettä. Sokereiden haitallisuutta korostava näyttö on lisääntynyt ja tyydyttyneiden rasvojen maine on vastaavasti puhdistunut.