1

Koronapäiväkirja – tiistaista torstaiyöhön 24.-27.3.2020

83., 84. ja 85. päivä: Uusimaa on kiinni ja tiet suljettu!

Yritän välttää uutisten toistoa, joten kommentoin vain lyhyesti median laajasti uutisoimat jutut. Koronaviruspandemia on uutismylly, joka tuottaa taukoamatta masentavaa sisältöä. Katsotaan, jos onnistuisin louhimaan jotain täydentävää ja vähemmän uutisoitua sälää internetin syvyyksistä.

Uutisointi COVID-19-pandemian ympärillä on toistaiseksi melko varovaista ja lepsua. Tällainen vuotava uutisankka voi tarjota vain harmittomia pintasipaisuja maailmasta, joka on lasista tehty.

Kuin akvaariossa

Koronavirus, novel-koronavirus, SARS-CoV-2 ja COVID-19

Nämä käsitteet huutavat huomiota iltapäivälehtien otsakkeissa. Sanoilla on tarkasti rajattu merkitys, mikä säilyi pitkään arvoituksena minulle. Olen käyttänyt tähän asti näitä sanoja kuin synonyymejä, mutta tästä eteenpäin yritän loihtia termit oikeaan kontekstiin.

Ihmisten välillä leviäviä koronaviruksia tunnetaan seitsemän. Näistä tutuimmat ovat SARS ja MERS (ja nyt SARS-CoV-2). Kaikista lievistä kausiflunssista jopa 10-30 % johtuvat ihmisen koronaviruksista (HcoV-229E ja HcoV-OC43).

Tavallista kausiflunssaa aiheuttavia viruksia tunnetaan noin 200 ja muutamat näistä kuuluvat siis coronaviridae-sukuun.

Novel (uusi)-koronavirus on viimeisin tunnistettu ihmisten välillä leviävä koronavirustyyppi. Viruksen virallinen nimi on SARS-CoV-2 (Severe Acute Respiratory Syndrome – Coronavirus-2) ja se voi aiheuttaa taudin nimeltä COVID-19 (eli Corona-Virus-Disease-19). Numero viittaa taudin tunnistamisvuoteen.

Viruksen nimi, ”korona”, viittaa kruunuun. Elektronimikroskooppien kuvissa virus muistuttaa hieman auringon koronaa eli kruunua. SARS-CoV-2 on osa eläimillä ja ihmisillä yleistä Coronaviridae-virusperheettä. SARS-CoV-2 kuuluu suuriin RNA-viruksiin. Viruksen genomi on 26 000-32 000 emäksen mittainen.

COVID-19 oireet

COVID-19 leviää pisaratartuntana lähikontakteissa tai kosketustartuntana esimerkiksi erilaisilta pinnoilta. Yskä voi levittää virusta jopa 5 metrin säteelle ja aivastus vieläkin pidemmälle.

Ilmassa virus elää kolmisen tuntia, kosteilla pinnoilla sekä teräs- ja muovitasoilla kolme vuorokautta ja pahvissa 24 tuntia. Taudin oireet alkavat keskimäärin 5 päivää tartunnan saamisesta ja kestävät 12-32 vuorokautta. Taudin itämisaika on ihmisestä riippuen kuitenkin 2-14 vuorokautta.

COVID-19 nostaa tavallisesti korkean kuumeen. Kuiva hakkaava yskä, hengenahdistus,painon tuntu rintakehällä, voimakas kurkkukipu, polte kurkussa ja henkitorvessa, sekä päänsärky kuuluvat yleisimpiin oireisiin, Rauhasten turpoaminen, väsymys ja kylmät väreet ovat myös varsin yleisiä. Tavallisesti tautiin ei kuulu vuotava nenä, mutta vuotava nenä ei poissulje COVID-19-infektiota. Joillain sairastuneilla esiintyy muiden oireiden lisäksi ripulia ja oksentelua.

Keuhkokuume ja ARDS

Oireet voivat johtaa keuhkokuumeeseen ja pahimmillaan ARDS-oireyhtymään (Acute Respiratory Distress Syndrome), joka edellyttää tehohoitoa. ARDS on äkillinen hengitysvaikeusoireyhtymä, eli äkillisesti ilmaantuva keuhkovaurio, jonka seurauksena on vaikea happeutumishäiriö.

ARDS:n syntymekansimina on laaja-alainen keuhkorakkuloiden ja keuhkojen hiussuonten seinämien vaurio, joka alkaa muutamia päiviä kestävällä eksudatiivisella vaiheella, jolloin neste tihkuu vaurioituneista verisuonista keuhkokudokseen ja aiheuttaa keuhkojen turvotusta. Tämän jälkeen seuraa eksudaattien organisoitumista ja keuhkorakkulasolujen proliferaatiota, joka voi kestää joitain viikkoja. Lopulta keuhkovaurio etenee keuhkofibroosiin eli sidekudosmuodostukseen ja keuhkojen arpeutumiseen.

ARDS voi kehittyä esimerkiksi keuhkokuumeesta, mutta myös epäsuorasti elimistön voimakkaan tulehdusvasteen seurauksena, esimerkiksi sepsiksessä.

High risk cases have been squared-in by the presence of high blood pressure, a d-dimer blood test greater than 1, and having an adverse SOFA sepsis score. One is safe 3 days after no fever with resolved respiratory symptoms and also with improved chest CT scan plus two negative PCR tests, separated by one day. Viral shedding can occur for up to 37 days after onset of symptoms. Viral RNA can persist in the blood for up to 29 days and does not correlate with symptoms.”

Diagnoosi

Taudin toteamiseksi potilaan keuhkoista voidaan ottaa röntgenkuva ja/tai tietokonetomografia (CT-scan). Tietokonetomografian avulla keuhkoista voidaan tunnistaa viruksen aiheuttama keuhkokuume.

SARS-CoV-2-virukseen viittaa molemmissa keuhkoissa nähtävät viruksen aiheuttamat solutuhot, joihin ei liity lymfadenopatiaa tai pneumotooraksia. (Toivottavasti meni oikein!). Lievemmissä infektioissa rintakehän kuvat ovat normaalit.

Varsinainen diagnoosi varmistetaan PCR-menetelmällä (Polymerase Chain Reaction), jonka avulla voidaan tunnistaa SARS-CoV-2-viruksen RNA.

SARS-CoV-2 on hitonmoinen örkki

Maailmaan mahtuu monia äkäisiä viruksia. Monet tappavat nopeasti, toiset hitaammin ja kivuliaammin. Jotkut virukset leviävät vikkaammin kuin ilkeät juorut.

Ebola on sotkuinen tapaus. Verenvuotokuume. Ebola tappaa suuren osan tartunnan saaneista niin nopeasti, että tartunnan saaneet eivät tavallisesti ehdi levittää virusta kovinkaan kauas. Tämän vuoksi ebola-epidemiat ovat hirveitä, julmia, pelottavia ja usein hyvin paikallisia. Ebola on myös suhteellisen voimaton kehittyneiden maiden terveydenhuoltojärjestelmiä ja hygieenisuutta vastaan. Se menestyy köyhissä ja kehittymättömissä ympäristöissä.

SARS-CoV-2 on virusten ”Alien – kahdeksas matkustaja” ja ”The Thing – Se jostakin”. Se on julma, juonikas, aggressiivinen ja äärimmäisen tarttuva.

Vajaassa neljässä kuukaudessa uusi koronavirus on valloittanut koko maailman kaukaisimpia saarivaltioita myöten. Se kulkee kädestä käteen ja hyppii ihmisestä toiseen liikennevälineissä, konserteissa, kaupoissa, ravintoloissa ja vilkkailla kaduilla.

SARS-CoV-2 odottaa, vaanii ja piileskelee viikkoja ennen kuin se aloittaa eksponentiaalisen leviämisen. Se on mestari keuhkojen vaurioittamisessa; parempi kuin tupakka tai asbesti yhteensä. SARS-CoV-2 on helvetin pätevä siinä, mitä se tekee.

SARS-CoV-2 on paljon pelottavampi kuin mikään, mitä kauhuelokuvissa näytetään. Tartunta voi olla voimakas tai lievä ja se on pelottavaa. Osa ihmisistä voi nimittäin sairastua hengenvaarallisesti vain tunneissa, kun toiset levittävät tartuntaa oireettomina pari viikkoa.

COVID-19 on vaarallinen iäkkäille, verenpainetautia ja sydän- / verisuonitauteja sairastaville, diabeetikoille ja muita kroonisia tauteja sairastaville.

COVID-19-infektio voi olla rajumpi sellaisille, joiden veriryhmä on A, kun O-veriryhmässä oireet ovat tutkimushavaintojen perusteella lievemmät. Mistä tämäjohtuu. Sitä voidaan arvailla. Sattuma? Ehkä.

Olemme saapuneet tuntemattomille vesille

Taivaanrannassa meitä odottaa parvi mustia joutsenia. Avautva maisema on outo, surrealistinen ja unenomainen. Tulevaisuus syöksyy meitä vastaan taivaanrannassa raivoa keräävien myrskyjen voimalla.

Kukaan ei tiedä millaiseen maailmaan saavumme kun tämä on ohi. Onko huomisen maailma ystävällinen vai vihamielinen? Ainakaan se ei ole sellainen, miksi sen kuvittelimme vielä muutama viikko sitten. Kohtaamamme pandemian kokoluokka on ennen kokematon.

COVID-19 muuttaa maailmaa arvaamattomilla tavoilla. Geopolitiikka liittolaissuhteet, poliittiset ja taloudelliset järjestelmät sekä ideologiat menevät uusiksi kun tästä selvitään. Tämä ei tapahdu heti, mutta muutos on jo alkanut.

Moderni maailma ja globaali talous ovat pelottavan haavoittuvia näkymättömien virusten aiheuttaman pandemian edessä.

Ravinnon perustuotanto on monissa maissa jo ajettu alas. Lähes kaikki maailman valtiot ovat riippuvaisia vienistä, tuonnista, toisista valtioista ja globaalista markkinataloudesta. Nyt tämä järjestelmä heikkenee.

Yhdysvalloissa pelätään, että COVID-19 pandemia voi aiheuttaa 40 miljoonan ihmisen suurtyöttömyyden. Pelkästään tämän viikon aikana 3,3 miljoonaa amerikkalaista jäi työttömäksi ja kriisi on vasta alussa.

Tällaiselle maailmaa koettelevalle muutokselle ei löydy vertailukohtia edes historiasta. SARS-CoV-2 voi olla pahempi kuin vuoden 1930 suuri lama ja mahdollisesti kuolettavampikuin maailmasodat yhteensä. Tämä aika jättää maailmaan arven, joka säilyy kollektiivisessa muistissa vuosisatoja.

Pandemia päättyy aikanaan ja talous kääntyy kasvuun. Uusia innovaatioita ja työpaikkoja syntyy nopeasti.

Vuosikymmenen looppu voi jo olla nopean kasvun aikaa. Tulevat vuosikymmenet ovat luultavasti parempia, rikkaampia ja oikeudenmukaisempia kuin pandemiaa edeltäneet vuosikymmenet.

Niin kävi 1930-luvun laman ja maailmansotien jälkeen. Vaikka eihän se tietenkään niin yksinkertaista ja suoraviivaista ole. Jokainen sukupolvi joutuu kohtaamaan omat kipupisteensä ja hasteensa. Niin on ollut ennen ja niin on tulevaisuudessa.

Meistä on tullut statisteja

CNN:n mukaan Phoenixin alueelta kotoisin ollut noin 60-vuotias mies kuoli ja hänen vaimonsa päätyi kriittiseen tilaan, kun pariskunta pyrki hoitamaan koronavirustaan itsenäisesti klorokiinifosfaatilla, jota tyypillisemmin käytetään malarian hoitoon.Yksi arizonalaispariskunta huomasi, että heidän lemmikkikarppinsa akvaarion puhdistamisessa käytetty pesuaine sisältää samaa klorikiini-nimistä ainetta, jota Trump erityisesti ylisti ratkaisevaksi avuksi koronataistelussa.”

Taistelu koronavirusta vastaan akvaarionpuhdistusaineella päättyi tapppioon; mies menehtyi ja nainen on sairaalassa kriittisessä tilassa. Kehätuomareiden tuomio ei ole yksimielinen. Typeryyttä tai ei, mies tappoi keuhkoja tuhoavan viruksen. Kloriini siis toimi, mutta ei toivotulla tavalla.

Omissa akvaarioissamme me olemme pandemian statisteja. Odotamme akvaarionpesunestettä, joka pesisi tämän painajaisen pois ja voisimme jälleen kulkea vapaina ja tavata muita akvaarioistaan vapautuneita ihmisiä ilman näkymättömän tappajan uhkaa.

Näin tämä menee, vaan menköön

Sosiaali- ja terveysministeriön ylijohtaja Päivi Sillanaukee kertoi maanantai-iltana ministeriön avaavan huoltovarmuusvarastot. Näihin on varastoitu huomattava määrä mm. polttoaineita ja lääkintätarpeita. Tällaiseen turvaudutaan, koska suurissa sairaaloissa on jo ollut pulaa mm. reagensseistä, hengityssuojista ja muista suojavälineistä.

Suomen kriisinkestävyyden turvaa ruokahuollon 80-prosenttinen kotimaisuusaste ja lääkealan kuukausien kulutustarpeisiin riittävät velvoitevarastot.

Eeva Ahtisaarella todettiin koronatartunta muutamia päiviä sitten. Nyt varmistui, että myös entinen presidentti Martti Ahtisaari on saanut tartunnan. Hyvin surullinen tilanne, sillä ex-presidenttipariskunta osallistui taannoin Naisten päivän juhlakonserttiin. Tilaisuuden järjestäminen osoitti poikkeuksellista piittaamattomuutta tällaisena aikana. Monet tapahtumaan osallistuneet saivat mahdollisesti tartunnan.

Keskiviikkona 25.3.2020 koronavirukseen oli aamupäivän aikana menehtynyt kaksi potilasta. Torstaina kuolleita on jo viisi. Suomessa viralliset tartuntojen määrät pyörivät keskiviikkona kahdeksansadan korvilla, mutta lienevät jo yli tuhat. Todellisuudessa tartuntoja on monikymmenkertainen määrä. Ruotsissa kuolonuhrien määrä harppasi parissa vuorokaudessa ensin kahdestakymmenestä neljäänkymmeneenneljään ja nyt jo seitsemäänkymmeneenseitsemään.

Tyhjenevät kadut

Monet jännittivät fiktiivisen Walking Dead-sarjan juonenkäänteitä. Tämän päivän maailmassa kuolleet kävelevät ja tartuttavat eläviä viattomasti hymyillen ruuhkabusseissa, työpaikoilla ja kauppakeskuksissa. Tartunta ei edellytä puremista, verta ja kaaressa purkautuvia ruumiinnesteitä. Kaunis romanttinen kohtaaminen kahvilassa riittää. Onneksi nuoret ja terveet ovat tälle vitsaukselle vähemmän alttiita ja kestävät sen yleensä hyvin.

Prinssi Charles on sairastunut. Espanjassa on menehtynyt kuluneiden 24 tunnin aikana 738 ihmistä, eli 200 enemmän kuin vastaavana ajanjaksona edellispäivänä. Koronavirus leviää Espanjassa jo nopeammin kuin Italiassa.

Yhdysvalloissa postilaitos uhkaa ajautua konkurssiin, kertoo Politico. Terve teini-ikäinen menehtyi Los Angelesissa ja toinen Panamassa.

”Los Angelesin pormestarin Eric Garcettin mukaan kyseessä oli teini-ikäinen henkilö, jonka terveydentila oli hyvä. Hän haluaa viestittää nuorille, että koronavirus voi osua heidänkin kohdalleen.”

Intia on määrännyt koko kansan, eli noin 1,3 miljardia ihmistä kolmen viikon mittaiseen karanteeniin. WHO:n asiantuntijan mukaan Intian panos oli aivan ratkaiseva isorokon ja polion nujertamisessa. Intia ei vain nyt ole suurin ongelma; suurin ongelma on USA.

Trumpin tviittaillessa poikkeustoimien lakkauttamisesta ja paluusta normaaliin jo pääsiäisenä tartunnat ja kuolemantapaukset tuplaantuvat Yhdysvalloissa kolmen päivän välein. New York ja Washingtonin osavaltio kulkevat epidemian kärjessä, mutta muut osavaltiot seuraavat kehitystä.

Venäjällä Putin antoin kansalaisille viikon loman, mutta on todennäköistä, että tulevan viikon aikana Venäjälle julistetaan poikkeustila. Tämä tapahtuu ennen tartuntojen ja kuolemantapausten todellisten määrien julki vuotamista. Venäjän todellinen koronatilanne selvinnee ensi viikolla.

Trumpin pohdinnat USA:n palauttamisesta normaaliin, kun virus leviää hallitsemattomasti, ovat useiden asiantuntijoiden mielestä vastuuttomia.

Arvioiden mukaan karanteeneista ja rajoituksista luopuminen voisi johtaa jopa 2,2 miljoonan ihmisen kuolemaan tulevien kuukausien aikana. Uhrataanko nämä ihmiset talouden vuoksi? Yhdysvalloissa on nyt jo eniten todettuja tartuntoja maailmassa. Todettuja tartuntoja on jo enemmän kuin Kiinassa ja Italiassa.

Lyhyt katsaus lääkekokeista

Tulokset ensimmäisistä Covid-19-lääkkeitä koskevista organisoiduista tutkimuksista ovat valmistuneet, mutta toistaiseksi parannuskeinoa ei ole löydetty.

Kun COVID-19 lähti leviämään tammikuussa, lääkärit – ensin Kiinassa ja sitten Yhdysvalloissa, Italiassa ja Ranskassa – aloittivat helposti saatavilla olevien lääkkeiden testit COVID-19-tartunnan saaneiden hoidossa.

Ensimmäiset lääketieteellisten tutkimusten tuloksista SARS-CoV-2 viruksen hoitoon sovellettavien lääkkeiden vaikutuksista on julkaistu. Tähän mennessä on valmistunut kolme kliinistä tutkimusta, joissa on käytetty antiviraalisia läöäkkeitä.

Toistaiseksi COVID-19-tartunnan hoitoon ei ole hyväksyttyjä lääkkeitä, joten vakavien tapausten hoitoon ei ole olemassa tehokkaita lääkkeitä. Hoitona annetaan happiterapiaa hengityslaitteilla, sekä hengittämiseen liittyvää tukihoitoa. Jotkut potilaat saavat tavallisia antibiootteja mahdollisiin bakteeritulehduksiin.

Ympäri maailman tehdään lääketutkimuksia vuorokauden ympäri sadoissa tutkimuslaitoksissa. Tutkimukset selvittävät uuden koronaviruksen hoitomuotoina kaikenlaisia vaihtoehtoja C-vitamiinista perinteiseen kiinalaiseen lääketieteeseen. CellTrials.org on listannut COVID-19 tutkimukset, joita on jo yli 250. Pelkästään Kiinassa tehdään valtavasti tutkimustyötä lääkkeen ja rokotteen kehittämiseksi. Yksi tuloillaan oleva lääke on Gilead-yhtiön kokeellinen viruslääke Remdesivir, mutta se valmistunee vasta lähitulevaisuudessa.

Jätän kääntämättä nämä selvitykset, koska ne tällaisenaan antavat täsmällisemmän kuvan. Käännöksiin tulee helposti asiavirheitä.

Lähde on MIT

Chloroquine or hydroxychloroquine

The hype: President Donald Trump praised the malaria drug, saying it had shown “tremendous promise” against Covid-19. “I think it’s going to be very exciting,” he said. “I think it could be a game-changer, and maybe not.”

The report: Hydroxychloroquine and azithromycin as a treatment of COVID-19: results of an openlabel non-randomized clinical trial

The data: During early March, French doctors at IHU-Méditerranée Infection in Marseille, France, treated Covid-19 patients with hydroxychloroquine, a version of the 90-year-old malaria drug chloroquine. They tried giving 200 milligrams of hydroxychloroquine three times per day, over 10 days, to 26 patients, and some got the antibiotic azithromycin, too. In their report, treated patients had less virus in their system after six days than other patients at a different center, who didn’t get the treatment. The study’s conclusions aren’t firm because so few patients were involved and the study was not rigorously designed, although chloroquine has also been tried in China with rumors of success.

So does the drug work? Scientists say there’s not enough evidence to say. “Anecdotal reports may be true, but they are anecdotal,” Anthony Fauci, head of the National Institute of Allergy and Infectious Diseases, said during a briefing at the White House. “It was not done in a controlled clinical trial. So you really can’t make any definitive statement about it.”

In the absence of other options, Governor Andrew Cuomo of New York said his state, now a global epicenter of Covid-19, had obtained 70,000 doses of hydroxychloroquine and 750,000 doses of chloroquine, as well as azithromycin (also called Zithromax). “The trial will start this Tuesday,” said Cuomo over the weekend. “There is a good basis to believe they could work. The president ordered the FDA to move and the FDA moved.”

Chloroquine has risks, because it can affect heart rhythm. No one should take it without a prescription.

Favipiravir

The hype: News reports last week claimed Chinese officials had touted this antiviral medicine made in Japan as “clearly effective.”

Patient being discharged from Leishenshan Hospital to observational facility.

AP Images

The report: Favipiravir versus Arbidol for COVID-19: A Randomized Clinical
Trial

The data: While favipiravir, an antiviral made by Toyama Chemical (part of Fuji Film), generated hopeful headlines, the report from doctors at China’s Wuhan University makes more modest claims. They organized a study of 240 “ordinary” patients (meaning they had pneumonia but were not the worst cases) around Hubei province. Half got favipiravir and half got umifenovir (or Arbidol), an antiviral used in Russia, and they were watched to see which group recovered faster. The doctors found that patients’ fevers and coughs went away faster on favipiravir, but similar numbers in each group ended up needing oxygen or a ventilator. On the basis of these findings, they concluded that favipiravir is the “preferred” of the two drugs.

Favipiravir, which is known by the trade name Avigan in Japan, inhibits viruses from copying their genetic material. It was originally discovered while searching for drugs to treat influenza.

Lopinavir and ritonavir

The hype: Doctors reached into the cabinet of advanced anti-HIV medications, hoping for a quick success.

NIAID

The report: A Trial of Lopinavir–Ritonavir in Adults Hospitalized with Severe Covid-19

The data: This is the largest, best-organized study of a treatment for Covid-19 so far, but it didn’t find a benefit. In January, doctors in China randomly assigned 199 patients with pneumonia either to get the HIV medicines lopinavir and ritonavir twice a day for two weeks, or to receive only standard care. Then they watched to see who improved or got discharged from the hospital. Unfortunately, no benefit was seen from the treatment. Nearly 20% of the patients died. The team wonders if the drug combo, sold in the US by AbbVie to treat HIV infection under the trade name Kaletra, could still prove beneficial for less sick patients.

The key drug here is lopinavir, a protease inhibitor, which has been shown in lab and animal tests to have effects against Middle East respiratory syndrome coronavirus, or MERS. Ritonavir acts to increase the first drug’s availability in the body.


Kolmannes koronatartunnan saaneista on ”hiljaisia kantajia”

Kiinassa yli 43 000 oireetonta ihmistä oli antanut positiivisen koronavirusnäytteen helmikuun loppuun mennessä ja asetettu karanteeniin. On epäselvää, mikä rooli oireettomalla leviämisellä on globaalissa pandemiassa kirjoittavat Josephine M, Linda Lew ja Lee Jeong-ho South China Morning Post -lehdessä (SCMP).

Kiinan viranomaistilastojen mukaan”hiljaisten kantajien”, eli ihmisten, joilla on todettu koronavirustartunta, mutta jotka ovat oireettomia tai hyvin vähäoireisia – määrä voi olla jopa kolmannes kaikista tartunnan saaneista.

Tutkijat eivät ole päässeet yksimielisyyteen siitä, mikä rooli oireettomien kantajien tartunnoilla on taudin leviämisessä. Potilaalla ilmenee oireita yleensä viidessä päivässä, vaikka inkubaatioaika voi olla joissain harvinaisissa tapauksissa jopa kolme viikkoa.

Ongelma oireettomien tartuttajien kohdalla on se, että eri valtiot ja järjestöt tilastoivat vahvistetut tapauksensa eri tavalla. Maailman terveysjärjestö (WHO) luokittelee kaikki positiivisen testin omaavat ihmiset vahvistetuiksi tapauksiksi riippumatta siitä, kokevatko he mitään oireita. Samoin toimii Etelä-Korea. Kiinan hallitus muutti luokitteluohjeitaan 7. helmikuuta ja laski vahvistetuiksi tapauksiksi vain potilaat, joilla oli oireita. Yhdysvallat, Iso-Britannia, Italia, Suomi ja monet muut valtiot eivät edes testaa ihmisiä. Poikkeuksena ovat terveydenhuollon työntekijät, jotka altistuvat jatkuvasti infektiolle.

.Kiinan ja Etelä-Korean tapa testata kaikki, joilla on ollut läheinen yhteys tartunnan saaneen kanssa – riippumatta siitä, onko henkilöllä oireita – saattaa selittää miksi nämä kaksi maata ovat tarkistaneet viruksen leviämistä myös oireettomien tartunnankantajien kautta. Hong Kong laajentaa testausta kaupungin lentokentälle saapuville, vaikka matkustajilla ei olisi oireita. Useimmissa Euroopan maissa ja Yhdysvalloissa testataan vain oireista kärsiviä ja infektioiden määrä kasvaa nopeasti.

Yhä useammat tutkimukset kyseenalaistavat WHO:n raportin, jonka mukaan oireeton leviäminen on ”erittäin harvinaista”. Alkuaan Maailman terveysjärjestö raportoi Kiinaan suuntautuneen kansainvälisen valtuuskunnn matkan jälkeen, että oireettomien infektioiden osuus on vain 1-3 % kaikista tapauksista. Tämä on ollut Suomessa THL:n lähestymistapa. Se on osoitettu vääräksi. Oireeton leviäminen on 10-30 kertaa tavallisempaa, kuin WHO:n raportti olettaa.

”Uusien koronavirus (Covid-19) -tapausten lukumäärä lisääntyy nopeasti koko maailmassa. Kiinassa uudet tapaukset eilen saattavat viitata epidemian toiseen aaltoon.

Kiinan viranomaistilastojen ja Kiinan ulkopuolisten tapausten tilastollinen ero osoittaa, että huomattava osa tapauksista on alidiagnosoitu”, Hokkaidon yliopistossa työskentelevän epidemiologian tutkijan Hiroshi Nishiuran johtama asiantuntijaryhmä kirjoitti helmikuussa International Journal of Infectious Diseases -lehteen.

Tutkimuksensa perusteella Nishiura laski Wuhanista evakuoitujen oireettomien japanilaisten potilaiden osuudeksi 30,8 prosenttia, mikä on samansuuntainen Kiinan viranomaistietojen kanssa.

Myös Etelä-Korean tilastot tukevat päätelmää, jonka mukaan oireettomat tartunnan kantajat levittävät koronavirusta.Yli 20 prosenttia Korean tautien torjunta- ja ehkäisykeskuksille ilmoitetuista oireettomista tapauksista pysyi oireettomina myös karanteenissa vietetyn ajan.

”Etelä-Koreassa esiintyy huomattavasti enemmän oireettomia tartunnan saaneita kuin muissa maissa. Tämä voi selittyä laajalla testauksella”, Etelä-Korean CDC: n johtaja Jeong Eun-kyeong kertoi lehdistötilaisuudessa 16. maaliskuuta.

Yksi kiinnostava havainto perustuu tietoihin, otka on kerätty Diamond Princess -risteilyalukselta. Karanteenissa Jokohaman edustalla olleen aluksen kaikki matkustajat ja henkilökunta testattiin koronaviruksen varalta. 712 laivalla olleella ihmisellä todettiin koronatartunta, mutta näistä 334 oli oireettomia.

EU:n raportin mukaan oireettomien tartunnansaaneiden osuus Italiassa on 44 %, mutta suurimmassa osassa maata oireettomia ei testata. Hong Kongissa 14.3. tilastoiduista 138 vahvistetusta diagnoosista 16 oli oireettomia tai vähäoireisia, kertoo Hong Kongin yliopiston mikrobiologian laitoksen professori Ho Pak-leung.

Luvut viittaavat merkittävästi suurempaan asymptomaattisten tapausten määrään kuin Kiinan toistaiseksi julkistamat tiedot osoittavat. Kiinan viranomaisten mukaan 11. helmikuuta 44 672 vahvistetun tapauksen joukossa oli 889 oireetonta potilasta. WHO arveli, että oireettomien kantajien merkitys taudin leviämisessä on epäselvä, mutta ei pitänyt merkitystä suurena. Monet tutkijat arvelevat nyt, että oireettomien ja presymptomaattisten taudin kantajien merkitystä on aliarvioitu.

WHO: n mukaan oireettomien leviämisten merkitys taudin leviämisessä ei ollut selvä, mutta kantajat, joilla ei ollut oireita, eivät todennäköisesti ole keskeinen tekijä yleisesti.

Jotkut tutkijat kysyvät kuitenkin, onko oireettomia ja presymptomaattisia tartuntoja aliarvioitu.

Texasin yliopiston tekemässä tutkimuksessa arvioitiin, että ihmiset, jotka eivät oireilleet, tartuttivat noin 10 prosenttia tutkituista 450 tapauksesta 93 Kiinan kaupungissa. Hong Kongin yliopiston Ho:n mukaan eräillä oireettomilla potilailla esiintyy näytteissä saman verran viruksia kuin oireilevilla potilailla.

Hongkongin yliopiston epidemiologian ja biostatistiikan professori Benjamin Cowling sanoi, että on olemassa vahvaa näyttöä siitä, että tartunnan saaneet henkilöt voivat välittää tartunnan ennen oireiden ilmenemistä. ”On raportteja tartunnasta noin kaksi päivää ennen oireiden puhkeamista”, hän sanoi.

Njooh. Katsellaan kuin tämä pandemia tästä selviää. Tämä teksi jäi sekavaksi koosteeksi, mutta tehdään seuraavasta parempi. Ohessa jotain kiinnostavia linkkejä.

https://www.technologyreview.com/collection/coronavirus/

https://medium.com/@tomaspueyo/coronavirus-the-hammer-and-the-dance-be9337092b56

https://www.scmp.com/news/china/society/article/3075567/people-blood-type-may-be-more-vulnerable-coronavirus-china-study

https://www.latimes.com/world-nation/story/2020-03-13/china-japan-korea-coronavirus-reinfection-test-positive?utm_source=quora&utm_medium=referral

https://dynamic.hs.fi/a/2020/usatalous/?utm_campaign=tf-HS&utm_term=1&utm_source=tf-other&share=2c927277a2b1a0e25f47fc9570d4c39a

https://www.forbes.com/sites/brucelee/2020/03/21/how-does-the-covid-19-coronavirus-kill-what-happens-when-you-get-infected/?utm_source=quora&utm_medium=referral#7da80e546146




Koronapäiväkirja – maanantai 23.3.2020

Korona on tullut taloon. Ainakin luulen niin. Heräsin kesken unien ja jossain naapurissa lapsi yskii rajusti. Lapsen yskäkohtaukset jatkuvat pitkään, sitten on lyhyt hiljainen tauko ja kohtaus alkaa uudestaan. Tätä on jatkunut tunnin verran. Olen surullinen lapsen ja koko perheen vuoksi. Tuo ei kuulosta ollenkaan mukavalta.

Masentavaa maanantaita!


Jos tästä masentavasta maailmanajasta pitäisi jotain hyvää keksiä, niin ainakin Stranger Thingsin neljännen kauden traileri on vihdoin julkaistu ja sarja tulee katsottavaksi joulukuussa. Stranger Things palauttaa meidät yksinkertaisempaan aikaan.

Uskon, että neljäs tuotantokausi paljastaa, mitä Tsernobylissä oikeasti tapahtui. Kaikki oli helpompaa, kun amerikkalaiset olivat hyviä ja kommunistit pahoja. Nyt selkeitä jakolinjoja ei enää ole. Sovitaanko, että COVID-19 on perseestä. Vihataan sitä yhdessä. Ihan täysillä.

Johns Hopkins -yliopiston tilastojen mukaan kuolleiden määrä yli kaksinkertaistui viikon aikana. Viime sunnuntaina uhreja oli kuutisen tuhatta ja eilen yli 13 000 Italiassa menehtyneitä on jo 5500. Tahti on hirvittävä.

– Elämässä tulee hetkiä, jolloin joudutte tekemään uhrauksia ei vain itsenne, vaan myös ympäristönne, kanssaihmistenne ja maanne vuoksi. Sellainen hetki on nyt, Stefan Löfven vetosi ruotsalaisiin.

Ruotsi varautuu nopealla aikataululla ankarampiin toimiin koronavirusepidemian hillitsemiseksi. Angela Merkel hoitaa tehtäviään kotikaranteenissa mahdollisen virusaltistuksen vuoksi. Espanjalainen oopperatähti Placido Domingo on sairastunut koronaan.

Yhdysvalloissa Donald Trumpin kannattajiin kuuluva senaattori Rand Paul on myös sairastunut. Hän on ollut näkyvästi mukana julkisen talouden menojen leikkaamiseen tähtäävässä ja Obamaa halveksivassa oikeistoradikaalissa teekutsuliikkeessä.

Rakkaudella Venäjältä

Kaiken tämän keskellä Venäjä lähetti eilen yhdeksän lentokoneellista armeijan kalustoa ja noin sadan virusekspertin ryhmän Italiaan. Tuo on jotenkin äärimmäisen hämmentävää. Yhdysvalloissa senaatin demokraatit kaatoivat kahden biljoonan dollarin apupaketin riittämättömänä.

Pikatesteistä ei ole käytännössä mitään hyötyä

Suomalaistutkimuksen mukaan koronaviruksen vasta-aineet kehittyvät 4-9 vuorokautta tartunnan jälkeen. Koska pikatestit mittaavat vasta-aineita verestä, ne antavat suurella todennäköisyydellä virheellisen tuloksen. Pikatesti näyttää positiivista vain, kun vereen on kehittynyt vasta-aineita. Näin varoittaa Tyksin laboratoriotoimintojen ylilääkäri Pentti Huovinen. Pikatestistä ei näin ole apua taudin diagnostiikassa, vaikka siitä voi olla apua kun varmistetaan sellaisia tautiin sairastuneita, joilla oireet ovat kestäneet kauemmin. Huovisen mukaan pikatesti ei ole niin luotettava kuin nyt käytössä oleva PCR-testi.

”Mitä tämä sitten merkitsee? Sitä, ettei akuuttia koronavirusta epäiltäessä pikatestiä juuri kannata tehdä. Virheellinen negatiivinen tulos johtaa harhaan. Testiä voi kuitenkin käyttää osoittamaan, onko potilas jo sairastanut koronaviruksen aiheuttaman COVID-19-taudin. Se on hyödyllinen tieto esimerkiksi tutkittaessa viruksen laukaisemaa immuunivastetta.” – IS

Ongelmana ovat myös väärät positiiviset. Melkein kaikkien veressä on tavallista kausiflunssaa aiheuttavien koronavirusten vasta-aineita, joihin pikatestit voivat reagoida.

Toivon pilkahdus

Lainaan Berkeleyn yliopiston fysiikan professoria, Richard Mulleria.

Koronavirukseen on olemassa mahdollinen parannuskeino. Tästä ei juuri vielä puhuta, koska ihmisissä ei haluta herättää aiheetonta toivoa. Seuraava kaavio on julkaistu viisi päivää sitten arvovaltaisesssa lääketieteen ammattilaisille suunnatussa Antimicrobial Agents -lehdessä.

Taulukko kuvaa kontrolloitujen lääketestien tuloksia (kokeessa testattiin hydroxychloroquine- ja azithromycin-lääkkeiden vaikutuksia koronaan sairastuneilla). Vihreä käyrä on jännittävä: Kun mainittuja lääkkeitä käytettiin yhdessä vakavaan koronatartuntaan sairastuneiden potilaiden hoidossa, kahdeksan potilaan kaikki oireet paranivat viidessä päivässä. Ylin käyrä kuvaa kontrolliryhmää. Tutkimus on kokonaisuudessaan täällä.

Molempia lääkkeitä on käytetty pitkään ja turvallisesti mm. malarian hoidossa, joten myös niiden sivuvaikutukset tunnetaan hyvin. Yhdysvaltojen johtava terveysviranomainen Anthony Fauci pohtii näinä päivinä näiden lääkkeiden hyväksymistä koronaviruksen sairastuttamille potilaille. Trump painostaa Faucia hyväksymään lääkkeet, mutta hyväksyntä koronatartuntojen hoitoon tarvitaan myös FDA:lta. Lääkärit voisivat toki Yhdysvalloissa määrätä näitä lääkkeitä koronapotilaille jo nyt, mutta ilman FDA:n hyväksyntää, he altistaisivat itsensä mahdollisille oikeustoimille.

Fauci totesi tiedotustilaisuudessa, että lisää kokeita tarvitaan. Tutkimuksen tilastollisen luotettavuuden kannalta tämä ei ole totta. Kahdeksan ihmistä parani viidessä päivässä, kun vain yksi kontrolliryhmän henkilö parani spontaanisti. Todennäköisyys, että tämä tapahtuu sattumalta, on pienempi kuin 1%.

Suurempia ryhmiä ei tarvita lääkkeiden tehon osoittamiseksi. ”Pienet otannat” voivat olla pätevä kritiikki marginaalisiin tuloksiin, mutta nämä tulokset eivät ole marginaalisia. Positroni löydettiin yhdellä havainnolla; nähtiin vain 1 positroni, mutta se riitti. Anderson sai Nobel-palkinnon yhdestä havainnostaan. Jos sinulla on yksi positroni, se riittää osoittamaan, että se on olemassa. Pienet luvut eivät välttämättä tarkoita heikkoa tilastoa. Toivon, että tohtori Fauci ymmärtää tämän.

Varovaisuuteen voi olla syynä talidomidin varhaisen hyväksymisen aiheuttamat kauhistuttavat synnynnäiset epämuodostumat 1950-luvulla. Talidomidin jälkeen lääketieteellinen yhteisö on ollut varovaisempi uusien lääkkeiden hyväksymisessä.

We therefore recommend that COVID-19 patients be treated with hydroxychloroquine and azithromycin to cure their infection and to limit the transmission of the virus to other people in order to curb the spread of COVID-19 in the world.”

Mutta tietenkään tämä ei ole näin helppoa

Viikonloppuna
Trump puolestaan säikäytti lääkärit, kun hän ehdotti koronan hoitamiseksi kahden sellaisen lääkeaineen yhteiskäyttöä, joiden yhteiskäyttö voi pahimmillaan pysäyttää sydämen.

Trump twiittasi, että hydroksiklorokiini ja atsitromysiinin yhteiskäyttö voisi olla yksi suurimmista käänteistä lääketieteen historiassa.

Hydroksiklorokiinia käytetään muun muassa nivelreuman hoitoon, atsitromysiiniä puolestaan infektioiden, kuten keuhkoputkentulehduksen, hoitoon.

Niiden yhteiskäytöstä on saatu lupaavia tuloksia koronaviruksen hoitamisessa, mutta Trump vetää lääkäreiden mukaan mutkia suoraksi.

Moni lääkäri onkin muistuttanut, ettei lääkkeiden yhteiskäytön toimivuudesta ole vielä suuren kokoluokan kliinisiä kokeita, mutta sen sijaan lääkeaineiden yhteisvaikutus synnyttää vakavia rytmihäiriöitä, jotka voivat olla pahimmillaan kuolettavia. Lähde: IS


Planeetan kirkkaimmat aivot työskentelevät kellon ympäri


Tämän vuoden ensimmäisten 80 päivän aikana julkaistiin 1245 tieteellistä artikkelia koronaviruksesta (SARS-CoV-2).

Vielä ei tiedetä saavatko koronaviruksen sairastaneet immuniteetin virusta vastaan, ja jos saavat, kauanko immuniteetti kestää, kertoo koronavirusta tutkiva Matt Frieman (Marylandin yliopiston lääketieteellinen koulukunta).

I think there’s a very likely scenario where the virus comes through this year, and everyone gets some level of immunity to it, and if it comes back again, we will be protected from it — either completely or if you do get reinfected later, a year from now, then you have much less disease.”

Frieman kertoo, että jos virus palaa vuoden päästä, ei voida mitenkään tietää olemmeko sille immuuneja vai emme. Kausittaiset koronavirukset aiheuttavat 10-30 prosenttia lievistä flunssista ja niille ei ole kehittynyt immuniteettia tai laumasuojaa.

Rochesterin yliopiston Ann Falsey kertoo, että melkein kaikilla on neljän tavallisen koronaviruksen vasta-aineita veressä. Kun ihminen sairastuu koronavirukseen, vasta-aineiden määrä kasvaa, mutta tartunnan jälkeen vasta-aineiden määrä laskee ja sairauden jälkeen ihminen altistuu jälleen virukselle.

Falseyn mukaan useimmat hengitysteiden virukset tuottavat vain lyhytkestoisen immuniteetin. Kokeissa on osoitettu, että jopa ihmiset, joiden veressä on koronaviruksen vasta-aineita, voivat sairastua.

”Tutkimme eräitä yleisiä koronaviruksia. Meillä on näytteitä 30 vuoden ajalta, kantoja, jotka on otettu talteen 30 vuotta sitten, ja ne eivät ole kovinkaan erilaisia kuin ne, jotka kiertävät nyt”, sanoo virologi Vineet Menachery Teksasin yliopistosta.

Mutta myös kausittaiset koronavirukset todennäköisesti mutatoituvat ajan myötä kehon puolustuskyvyn välttämiseksi, Frieman kertoo. Sitä, miltä nämä muutokset näyttävät, ei tiedetä, koska tutkijat eivät tee koronavirusten vuosittaisia seurantoja.

On mahdollista, että jostain syystä kehon immuunivaste kausittaisiin koronaviruksiin ei vain ole vahva tai jokin infektion vaikutus estää kehon kykyä kehittää pitkäaikaista immuniteettia.

”Ehkä vasta-aineet eivät ole suojaavia, ja ehkä siksi, vaikka niitä veressä onkin, ne eivät toimi kovin hyvin”, Frieman sanoo.

Tunnetut ihmisen koronavirukset, kuten vaikea akuutti hengitysoireyhtymä (SARS) ja Lähi-idän hengitysoireyhtymä (MERS), voivat aiheuttaa vakavampia sairauksia, ja periaatteessa ei tiedetä, voiko kyseisiin infektioihin sairastua uudestaan. Toisaalta ainakin osalle SARS:in sairastaneista kehittyi pitkäkestoinen ja vahva immuunivaste.

Toinen vakava koronavirus, MERS, kehittyi Lähi-idässä vuonna 2012. ”Meillä ei ole käytännössä mitään tietoa reinfektiosta, koska kahdeksan vuoden aikana on ollut vain 2500 tapausta”, kertoo Iowan yliopiston Stanley Perlman, joka toteaa, että todennäköisyys saada uusi infektio samasta viruskannasta ei ole suuri, koska 35 % sairastuneista kuoli ja selviytyneille kehittyi immuniteetti kyseiselle virukselle.

Stanley Perlman sanoo, että tämä pandemia on todella suuri juttu. Hän on varma, ettei nykyinen COVID-19-virus tartuta ihmisiä toistamiseen, mutta ei uskalla arvella kauanko immuniteetti kestää. (1)

Ei hyvältä näytä


On kyllä ärsyttävää olla pahan ilman lintu, mutta olen hyvin huolissani siitä, että tuudittaudumme aiheettomaan turvallisuudentunteeseen. Oheinen inhottava taulukko todistaa, että Britanniassa kuolleisuusmäärät seuraavat varsin läheisesti Italian kuolleisuustilastoja, mutta pari viikkoa jäljessä.

Vaikka monet seurasivat koronaviruksen leviämistä ympäri maailmaa kuukausien ajan välinpitämättöminä, viime viikolla suurin osa meistä vihdoin tajusi, että se vaikuttaa väistämättä elämäämme. Imperial College:n äskettäinen analyysi sai monet amerikkalaiset, mukaan lukien monet asiantuntijat, paniikkiin. Raportissa ennustetaan, että 2,2 miljoonaa ihmistä voisi kuolla Yhdysvalloissa. Mutta analyysi antaa myös aihetta toivolle.

Jatketaan huonoilla uutisilla. Hyviä uutisia kun  ei tahdo enää löytyä.

Imperial College -ryhmän raportissa selvitelläään niiden toimenpiteiden vaikutuksia, joita voimme toteuttaa tartuntakäyrän tasoittamiseksi ja COVID-19-viruksen sairastuttamien potilaiden määrän vähentämiseksi.

Jos emme tee mitään ja annamme viruksen riehua vapaasti, kuolemantapauksia voi tulla jopa kolme kertaa niin paljon kuin sydän- ja verisuonitautit tappavat vuosittain. Lisäksi raportissa arvioidaan, että tartuntojen huippu osuu kesäkuun puoliväliin. Raportin hätkähdyttävin ennuste on, että kesäkuun puolivälissä SARS-CoV-2 voi tappaa jopa 55 000 ihmistä päivässä.

Koska teemme jotain, tätä ei todennäköisesti tapahdu. Suljemme koulut ja yritykset ja sitoutumme sosiaaliseen (todella, fyysiseen) eristäytymiseen, etätöihin jne. Mutta tämä ei raportin mukaan riitä. Jopa sen jälkeen kun olemme tehneet nämä asiat, analyysissä ennustetaan, että virus sairastuttaa enemmän ihmisiä kuin sairaalat pystyvät hoitamaan. Analyysin mukaan kaikkien toimien jälkeenkin SARS-CoV-2 voi tappaa yli miljoona brittiä.

Miksi Imperial College ennustaa näin rajua tilannetta länsimaihin, kun epidemia näyttää helpottavan Aasiassa? Olemme erilaisessa vaiheessa. Aasian maat ovat ryhtyneet taudin tukahduttamiseen; länsimaat ovat aloittaneet taudin leviämisen hillitsemisen.

Tukahduttamisella tarkoitetaan toimia, jolla vähennetään pandemian tarttuvuutta. Tätä asiantuntijat kutsuvat R0: ksi (R-nollaksi). COVID-19:n R0 on välillä 2 – 3, mikä tarkoittaa, että jokainen tartunnan saanut tartuttaa keskimäärin kaksi tai kolme muuta. Alle yhden R0 osoittaa, että jokainen tartunnan saanut henkilö levittää tartuntaa vain yhdelle tai harvemmalle. Näin taudin eteneminen pysähtyy ja kääntyy vähitellen laskuun.

Tukahduttaminen voidaan toteuttaa vain testaamalla riittävän monia ihmisiä, jopa sellaisia, joilla ei ole oireita. Testaus antaa mahdollisuuden eristää tartunnan saaneet, jotta he eivät voi tartuttaa muita. Meidän on oltava täsmällisiä ja valmiita tiukkoihin karanteeneihin ja liikkumisen vapauden rajoituksiin. Tällä hetkellä ei ole olemassa valmiutta testata riittävän monia. Testausinfrastruktuuri on puutteellinen. Siksi vaihtoehtona on hidastaa taudin etenemistä. Sen pysäyttämiseen ei ole olemassa keinoa. Hidastamalla taudin etenemistä myös taudin tarttuvuutta kuvaava R0 laskee.

Ensisijainen lähestymistapamme on sosiaalinen etäisyys – ihmisten pyytäminen pysymään erillään toisistaan. Tämä on tarkoittaa myös koulujen, ravintoloiden ja baarien sulkemista. Ihmisten on pyrittävä työskentelemään kotoaan käsin ja välttämään suuria ihmisryhmiä. Jotta tämä onnistuu, ihmisten on toimittava järkevästi ja vältettävä kaikkia ylimääräisiä kohtaamisia muiden kanssa.
Tartuntojen leviämisen hidastaminen parantaa terveydenhoitojärjestelmän mahdollisuuksia.

Nämä toimet eivät auta sairastuneita. Koska tartunnan saaneiden oireiden ilmeneminen voi kestää jopa kaksi viikkoa ja toisille ei tule oireita ollenkaan, tämän menetelmän toimivuus välittyy viiveellä.

Imperial College -raportti antaa aiheen varovaiseen optimismiin. Analyysissä todetaan, että skenaariossa, jossa taudin etenemisen hillitsemiseksi ei tehdä mitään,m monet ihmiset kuolevat ja kuolevat nopeasti. Tehokkaalla tartuntojen etenemisen hillitsemisellä sairastuneiden ja kuolleiden määrät laskevat merkittävästi.

Todellinen kauhu alkaa syksyllä ja lannistaa meidät ensi talvena, kun COVID-19 palaa

Se on mahdollista, ehkä jopa todennäköistä. Näin tapahtui Espanjan taudin kanssa vuonna 1918. Kevät oli huono. Kesällä sairaiden lukumäärä väheni ja aiheutti väärän turvallisuuden tunteen. Sitten seuraavana talvena helvetti pääsi irti. Vuoden 1918 lopulla kymmeniä miljoonia ihmisiä kuoli.

Jos samanlainen toinen aalto toistuu COVID-19:n kanssa, olemme pulassa tai sanalla sanoen kusessa. Ei sitä voi kauniimmin määritellä. Tilanne on humanitäärisesti ja taloudellisesti jo nyt hirvittävä, mutta tilanne pahenee päivä päivältä, emmekä ole vielä lähelläkään pohjaa.

Jos toinen aalto pyyhkii ylitsemme ensi syksynä, kun olemme jo tuhlanneet käytettävissä olevat resurssit ja voimavaramme, uhrien määrä voi nousta kymmeniin miljooniin. Kuten aiemmin kerroin, virologit eivät usko, että ihmisille kehittyisi pidempiaikainen immuniteetti koronavirusta vastaan. Se pn suuri huolenaihe. Ehkä tässä kuitenkin kannattaa elää päivä ja ongelma kerrallaan. En tiedä.

Tämä perkele jatkuu mahdollisesti puolitoista vuotta (18 kk)! On todennäköistä, että kesällä epidemia helpottaa ja kerää voimia syksyä varten. Tämä on brittiläisten asiantuntijoiden kanta. Jos siis palaudumme arkeen kesän jälkeen, vaarassa on, että virus virkoaa ja tartuttaa 40-70 prosenttia väestöstä. Huokaus.

Ennen rokotetta ja tehokasta lääkitystä on vain huonoja vaihtoehtoja. Asiantuntijoiden mukaan tämä karanteenivalmius pitää ylläpitää jopa 18 kuukautta. Se tuhoaa talouden ja monia yhteiskunnan perusrakenteita. Vaihtoehtona on, että miljoonat kuolevat.

Hitto. Ihan kuin kirjoittaisin jotain scifi-dystopiaa, mutta ikävä kyllä Imperial College on arvovaltainen ja luotettava asiantuntijalähde. Jos arviot eivät ole täsmälleen oikein, ne ovat varmasti suuntaa antavia. Voimme toki toivoa ja rukoilla, että tämä epidemia ei herää syksyllä.

Vai olisiko sittenkin kolmas vaihtoehto? Jos onnistutaan kehittämään nopeita ja luotettavia testejä, jotka ovat kaikkien saatavilla, voidaan väestö seuloa säännöllisesti. Näin tartunnan saaneet voidaan eristää ja useimmat ihmiset voivat elää täysin normaalia elämää. Kouluja ja ravintoloita voitaisiin avata – meillähän baarit eivät ole kiinni.

On varauduttava ja rakennettava terveysasemia, jotka voivat aikaisessa vaiheessa seuloa väestöstä infektion saaneita ja eristää heidät karanteeniin. Tämä ehkäisisi tehokkaasti sairauden leviämistä sairastuneiden välityksellä esimerkiksi sairaalasta toiseen.

Pelkästään nämä vaiheet eivät vieläkään riitä

Lääketieteellistä infrastruktuuria pitää vahvistaa. Tarvitaan enemmän lääkäreitä ja hoitohenkilökuntaa. Tehtaiden on valmistettava suojavarusteita, kumihanskoja, hengityssuojia jne., jotta terveydenhuoltohenkilökunnan turvallisuus voidaan taata. Tähän on investoitava sekä älyllisesti että taloudellisesti, että tutkijat saavat sellaisen rokotteen kehitettyä, joka päättää tämän painajaisen. Tarvitaan rokote, joka päättää pandemian ja suojelee miljardeja ihmisiä.

Lähteenä käytin paljolti Aaron E. Carrollin (pediatrian professori, Indianan yliopisto) ja

Ashish Jha’n (globaalin terveyden profesori, Harvardin yliopisto) kirjoittamaa Atlantic-lehdessä 19.3.2020 julkaistua artikkelia.




Koronapäiväkirja – perjantai-lauantai-sunnuntai 20.-22.3.2020

Liityin kymppikerhoon. Eieiei! Lentokoneet eivät tietenkään lennä. Sellainen ajatus on ihan hullu. Liityin kymppikerhoon vaa’alla. Olen pudottanut painoa ketogeenisellä ruokavaliolla tasan kymmenen kiloa joulukuun 2. päivän jälkeen. Tätä pitää juhlia. Saatan tempaista hampurilaisen ja kalsarikännit.

Olo on mainio. Aivojen toiminta ei romahtanut glukoosinpuutteen seurauksena, kuten eräät vääräleuat informaatioverkossa varoittelivat. Aivojen kirkkaudesta voi kiistellä, mutta tuotteliaisuuteni on varmasti lisääntynyt. Sen voi todeta kirjoitusaktiivisuudestani Ruokasodassa. Jutut ovat yhtä debiilejä, kuin aiemmin, mutta ainakin niitä syntyy tavattoman nopeasti.

Suomi on maailman onnellisin maa kolmatta kertaa peräkkäin. Kuka olisi uskonut? Eivät ainakaan suomalaiset. Mutta kuka ei olisi onnellinen, kun ihmisiä ei enää tarvitse enää kohdata kasvokkain ja kaduilla näkee vain nuoria, terveitä ja kauniita ihmisiä?

Poislukien hertsikka, jossa kauppakeskuksen avajaiset veti paikalle puolet Herttoniemen asukkaista. Mahdollisuus ilmaiseen ämpäriin kumoaa kaikki suomalaisten pelot. Mikään ei tapa suomalaisten jonottamisen halua. Edes keuhkorutto, korona, ydinonnettomuus ja sota yhdessä ei meitä estä, jos on olemassa pienikin mahdollisuus saada ilmainen ämpäri.

Vain jääkiekon maailmanmestaruuskisat pitävät meidät kotona. Nyt kun lätkän MM-skabat, futiksen EM-skabat ja viisut on peruttu, suomalaiset villiintyivät köhimään koronoissaan karaokebaareissa. Hyvä pössis!

Kun Masa on koronassa yskinyt kolme neljännestä keuhkoistaan olohuoneen lattialle, Masan olo on vielä melko hyvä ja työkuntoinen. Stindekin rimpuili letkuista 41 asteen kuumeessa hoitohenkilökuntaa harhautellen radalle, kun oli ihan pakko vetää Moottoritie on kuuma. Kikan skidit makaa kuumeisina ja hallusinoi lämpimästä ruoasta ja äidin rakkaudesta, mutta onneksi korkeaa verenpainetta sairastava isoäiti-Pirkko vahtii muksuja aina, kun Kikka vetää Populuksessa Sukkulan Venukseen. Se pitää laulaa kahdesti illassa. Arkisin ja viikonloppuisin. Koronan kanssa tai ilman koronaa. Aivan sama.

Se on suomalaista sisua se. Me suomalaiset voidaan olla maailman onnellisin kansa, mutta kyllä me ollaan myös helvetin dorkia. Ehkä tyhmät ovat onnellisimpia? Intiakin on aika onnellinen, kun bussiraiskaukseen syyllistynyt nelikko teloitettiin pitkän odottelun jälkeen, mutta ei puhuta siitä nyt. Torilla tavataan! Yläfemmat, halitaan ja pussaillaan.

Tähän loppuu iloiset asiat. Olen helppoheikki ja huithapeli tuuliviiri. Ei minua kiinnosta ennakoida ongelmia. Elän päivän ja ongelman kerrallaan. Siksi minulla ei olisi varaa huudella puskista, mutta huutelen kuitenkin. Olen melkein aina väärässä kun haluaisin olla oikeassa ja oikeassa silloin kun haluaisin olla väärässä. Nyt pelkään, että olen oikeassa.

Leidit lavalla

Suomen hallitus pelaa tällä hetkellä yhtä suurella itsevarmuudella ja luottamuksella kuin jääkiekon maailmanmestaruusjoukkueet 1995, 2011 ja 2019. Tämä kasvattaa varmasti markkinoiden ja kansalaisten luottamusta hallituksen kykyihin. Pelinä on upporikas ja rutiköyhä.

Ikävä kyllä hallituksen kyvykkyys on vain osittain totta. Demarit ja vasemmisto eivät halunneet ryhtyä aggressiivisiin toimiin koronatartuntojen hillitsemiseksi. Hallitus otti härkää sarvista vasta, kun poliittinen paine kasvoi liian suureksi. Ilmeisesti myös tasavallan presidentillä oli arvovaltansa pelissä. Se on hyvä, koska kriittisinä aikoina kansa tarvitsee poliittista johtajuutta.

Valmiuslakia ennen demareiden ja vasemmiston luottamus asenneilmapiiriltään pölyttyneeseen, kekkoslovakialaiseen Terveyden- ja hyvinvoinnin laitokseen oli järkähtämätöntä laitoksen toistuvista arviointivirheistä huolimaatta.

THL ei tietenkään periydy viime vuosituhannelta tai taistolaisuuden kultakaudelta. Se jatkaa siitä mihin Kansanterveyslaitos ja Stakes jäivät.

Kyse on Posti-Itella-Posti tyylisestä snadisti harhauttavasta strategiasta, jonka idea on, että toimivat järjestelmät ajetaan alas, palveluja heikennetään, rahoitusta leikataan ja hikoillaan velvoitteista aivan liian vähäisellä työvoimalla ja budjetilla. Tämä onnistuu vain korottamalla johdon palkkoja ja viemällä johto kannustushenkiselle virkistysmatkalle vaikkapa Amerikan Ihmeellisiin Yhdysvaltoihin.

Postin menestystarina olkoon kaikille opiksi hyvästä omistajaohjauksesta ja laadukkaasta johtamisesta. Hoidetaan tämä koronahomma yhtä hienosti!

THL on toki parantanut otteitaan, mutta pohjalta ei pääse alemmaksi.

THL:n ennusteet ja arviot ovat kriisin alusta lähtien menneet rankasti  penkin alle. Sellainen ei ole hyväksyttävää viranomaistoimintaa. Vastuu on suuri.

Turha ja perusteeton optimismi maksaa ihmishenkiä.

On painotettava, että syy THL:n epäonnistumisiin johtuu suurelta osin asiantuntijoiden määrän vähennyksistä ja rahoituksen leikkauksista. Ne ovat olleet poliittisia valintoja. Näistä valinnoista kannamme koko kansana vastuun nyt. Kiitti Juha!

Tämän kriisin jälkeen THL tarvitsee kipeästi uudistuksia. Laitos pitää siivota ja tuoda tälle vuosituhannelle. Lääketiede on kehittynyt ja tieto on lisääntynyt, mutta THL on jätetty vanhan maailman vangiksi.

Tietenkin epidemiaa voi hoitaa myös rukoilemalla, kuten Yhdysvalloissa tehdään.

 Me emme enää elä maailmassa, jossa totuuden määrittelee suuri johtaja tutkimusten ja faktojen sijaan.

”– Olemme pyörittäneet skenaariota myös Imperial Collegen arviolla, joka tarkoittaisi noin 40000:ta kuollutta. Meistä ei kukaan usko siihen. Arviomme mukaan Suomessa esiintyy paljon enemmän lievää tautimuotoa, sanoi THL:n ylilääkäri Tuija Leino STT:lle torstaina.” – IS

Aivan niin. THL on pelannut lottoa luottavaisesti väärillä numeroilla ja hävinnyt koko ajan. Demari-Vasemmisto-THL-ketju elää fantasioiden maailmassa, jossa ikäviä asioita ei tapahdu ja kaikki on harasoo. Ongelmat eivät kosketa meitä suomalaisia, koska meillä on lievempi tautimuoto. Onko? Ihan oikeasti! Mistä helvetistä te sen tiedätte? Sen kun näkisi.

Muistatteko vielä, miten Neuvostoliiton virallisen linjan mukaan Tsernobylin onnettomuus ei ollut vakava ja onnettomuuden hoito oli hyvin hallinnassa? NL muutti tiedottamistaan vasta, kun säteily havaittiin Ruotsissa asti. Suomalaiset eivät uskaltaneet mainita säteilystä mitään, vaikka havaitsivat sätelyn ennen ruotsalaisia.

Toivon, että pian päästään informaation osalta samalle kartalle muun maailman kanssa. Italia pelasi venäläistä rulettia jahkailemalla ja lepsuilemalla. Italia hävisi. Lähes 800 italialaista on menehtynyt pelkästään viimeisten 24 tunnin aikana. Perjantaina Italiassa kuoli muistaakseni noin 670 ihmistä. Espanjassa päivittäinen kuolleisuus lasketaan sadoissa.

Koska virheistä opitaan? Tilanne pahenee Suomessakin. Ehkä selviämme paremmin kuin Italia ja Espanja, mutta THL:n ennusteet 0,05-0,1 % kuolleisuudesta eivät ikävä kyllä taida olla tästä maailmasta. Tehohoidon kapasiteetti luultavasti ylittyy, vaikka tehohoitopaikkojen määrä on kolminkertaistettu.

”Viikonlopun hirvittävät uutiset lähes 800 ihmisen kuolemasta yhdessä vuorokaudessa Italiassa todistavat väkevästi, että valittu tie on oikea. Italia viivytteli rajoitustoimissa, teki niitä tipoittain. Lombardian katastrofi oli valmis.” IS



Kaksi strategiaa


Lieventäminen: hidastetaan mutta ei välttämättä pysäytetä epidemiaa.

  • Kun kaikki eivät sairasta samaan aikaan, hoitoresurssit riittävät paremmin.
  • Tehokkailla toimilla voidaan vähentää hoitohuippua 2/3 ja vähentää kuolematapaukset puoleen.

Tukahduttaminen: pyritään kääntämään epidemian kasvu laskuun, vähentämään tapausten määrää alhaiseksi ja pitämään tilannetta määräämättömän ajan.

  • Vaatii koko väestön sosiaalista eristämistä, sairastuneiden eristämistä kotiin ja joko heidän perheidensä karanteenia tai koulujen sulkemista tai molempia.
  • Toimia pitää jatkaa kunnes on rokote, mihin voi kestää puolitoista vuotta.
  • Jos toimia höllätään, virus voi palata ärhäkkäämpänä.

Mahdolliset rajoittamiskeinot

1. Epäiltyjen sairastuneiden eristäminen kotiin
Jos oireita, 7 vrk kotona; kodin ulkopuoliset kontaktit vähenevät 75 %. Oletus että 70 % noudattaa.
2. Epäiltyjen perheenjäsenten kotikaranteeni 14 vrk
Kotikontaktit +50 %, ulkomaailmakontaktit -75 %. Oletus että puolet noudattaa.
3. Ikäihmisten ja muiden sairaiden sosiaalinen eristäminen
Vähentää kontakteja 50 % töissä, kotikontaktit +25 %, muut -75%. Oletus että 75 % noudattaa.
4. Koko väestön eristäminen
Vähentää kontakteja -75 % työn, kodin ja koulun ulkopuolella. Työkontaktit -25 %. Kotikontaktit +25 %.
5. Koulut ja yliopistot kiinni
Kotikontaktit +50 %, muut +25 %. Voi johtaa isovanhempien lapsikontakteihin ja vanhempien työpoissaoloihin, myös terveydenhoidossa.
6. Yleisötapahtumien kieltäminen
Ei pidetty raportissa tehokkaana keinona, koska kontaktit ovat melko lyhytaikaisia, jolloin tartuntariski on pienempi.

Kontaktit

  • Raportissa arvioidaan, että kolmasosa tartunnoista syntyy kotona, kolmasosa koulussa tai töissä ja kolmasosa muualla yhteiskunnassa.
  • Huom! Koululaisilla on koulussa arviolta tuplasti kontakteja verrattuna muihin.
  • Huom! Britanniassa vietetään enemmän aikaa pubeissa kuin Pohjoismaissa, joten ruotsalaistutkijat ovat todenneet ettei jaottelu päde Ruotsiin, mikä lienee sama meilläkin.

Tarttuvuus ja hoito

  • Itämisaika 5,1 päivää
  • Tartuttavuusajan oletetaan olevan 6,5 päivää ja alkavan 12 tuntia ennen oireiden puhkeamista; oireettomilla 4,6 päivää tartunnan saamisesta. Oireettomat tartuttavat vähemmän.
  • Wuhanin epidemian varhaisen leviämisen perusteella oletetaan, että kukin tartunnan saanut tartuttaa 2,4 ihmistä.

  • 81 % saa tartunnan. 40–50 %:a tapauksia ei tunnisteta (oireettomia tai lievät oireet).

  • 2/3 tapauksista voidaan eristää.

  • Tapauksista 80 % lieviä. 4,4 % vaatii sairaalahoitoa (keskimäärin 8 vrk), ja sairaalahoitoa vaativista 30 % vaatii tehohoitoa (16 vrk). Tartunnan saaneista kuolisi 0,9 prosenttia.

Lähde: IS

Italialaislääkärien viesti on selkeä: sulkekaa kaikki, kun vielä ehditte!

Vuodenvaihteessa maailma katsoi epäuskoisena Kiinan kamppailua mysteerivirusta vastaan. Kiinan toimet tuntuivat äärimmäisiltä, jopa totalitaristisilta. Viesti viranomaisilta oli rohkaiseva: ei se tänne tule ja jos tulee, niin vain yksittäisiä tapauksia.

Kaksi kuukautta myöhemmin tilanne oli muttunut merkittävästi. Kiinan rajut vastatoimet, karanteenit ja ihmisten eristäminen käänsivät epidemian kurssin. Nyt Kiinassa uusia tapauksia todetaan harvakseltaan, mutta epidemia tasoittui ja on hellittämässä.

Tänään suuri osa maailmasta turvautuu Kiinan esimerkkiin. Tätä virusta vastaan voidaan taistella vain hillitsemällä sen leviämistä. Maaliskuun 15. päivä jää ylimielisyyden ja typeryyden merkkipaaluksi. Koronavirukseen sairastuneiden määrä Kiinan ulkopuolella ylitti Kiinassa todetut tartunnat.

Sellaiseen ei uskottu, eikä täällä pohjolan perukoilla uskota vieläkään. Karaokebaareissa syljetään lauluja samaan mikkiin. Hiihtokeskusten afterski-bileissä tartunnat leviävät samaa tahtia kumottujen oluiden kanssa. Oireet tulevat, mutta vasta 2-14 päivän kuluttua.

Tutustukaa oheiseen malliin, joka on ladattu Visual Capitalist.com -verkkosivulta. Meidän käyrämme Suomessa kulkee pelottavan samansuuntaisesti Italian käyrän kanssa. Me olemme pari viikkoa jäljessä, mutta tilanteen vakavuuteen olisi aika herätä. Italiassa ei herätty ja nyt siellä kuollaan massoittain. Ylimielisyys ja typeryys: eihän meillä täällä kehittyneissä pohjoismaissa voi noin tapahtua. Kyllä voi.

Oheinen kaavio mallintaa viruksen leviämistä 39 valtiossa, jossa on todettu yli 100 tartuntaa. Maita vertaamalla nähdään, että joissain maissa koronaviruksen hillitsemisessä on onnistuttu paremmin ja toisissa huonommin.

Suomen kehityskaari noudattaa pelottavan läheisesti Italian ja Ranskan jo toteutunutta viruksen leviämistä. Tilanne näyttää erityisen huolestuttavalta Yhdysvaltojen, Espanjan ja Saksan kohdalla.

Kiinassa ja Etelä-Koreassa taudin leviäminen on saatu aisoihin ja Japanissa, jossa elää karkeasti 22 kertaa enemmän ihmisiä kuin Suomessa, tartunnan saaneita on vain noin tuplasti enemmän kuin Suomessa.

Kertokaa taas, että, että hengityssuojat ovat hyödyttömiä. Kiinalaisen tutkimuksen mukaan hengityssuojat eivät ole hyödyttömiä.Harvardin yliopiston virustutkijan mukaan jopa kotitekoiset suojat suojaavat pisaratartunnoilta.Miksi terveet lääkärit käyttävät hengityssuojia, jos niistä ei heille ole hyötyä?

Vastaus on: Hengityssuojat ovat kevään muoti-ilmiö. Uudet mallit esitellään Milanon muotimessuilla kevään aikana. Syksyllä siirrrytään koko pään peittäviin kypäröihin, kaasunaamareihin sekä kumiin, lateksiin ja kokomuovisiin asusteisiin. Vakavasti: aasialaiset eivät ole tyhmiä. Eikä ole tyhmää käyttää hengityssuojaa, vaikka se ei sataprosenttista suojaa takaa.

Tartuntojen nopea tuplaantumistahti tarkoittaa ongelmia myös rikkaille valtioille. Mitä nopeammin tartunnat lisääntyvät, sitä kovemmalle koetukselle terveydenhuoltosektori joutuu.

Toivottavasti taudin torjuntaan tähtäävät toimet otetaan pian vakavasti. Valmiuslakien käyttöönotto ei tarkoita ylimääräistä lomaa. Vastuu epidemian vastaisessa kamppailussa on meillä kaikilla.

Silti toukokuun puolessa välissä sairastavia voi Suomessa olla satoja tuhansia. Se on massiivinen haaste suomalaiselle terveydenhuollolle. Lombardiassa tartuntojen määrä tuplaantui noin kolmen päivän välein, sairaalat ylikuormittuivat ja tehohoitoa tarvitsevien määrä kasvoi 10 prosenttiin. Kuolonuhreja on useita satoja vuorokaudessa. Tietenkin tätä kirjoittaessani luvut muuttuivat. Nyt Suomessa on jo 626 vahvistettua tartuntaa.

Vaikka kaikkia tämän seurannan maita yhdistää yhteinen tavoite, jokaisella maalla on oma lähestymistapansa ja ainutlaatuiset haasteensa väestön turvallisuuden takaamiseksi. Tärkeintä on saada tartuntojen määrä hidastumaan, jotta sairaalat eivät ylikuormitu.

Lopuksi toivoisin hallitukselta jotain järkeä koulujen käytäntöihin. Opettajia ei voida velvoittaa tarjoamaan samanaikaisesti lähi- ja etäopetusta. Se, että varhaiskasvatuksessa lapset yhä ovat koulussa (1-3 luokka) tai päivähoidossa, ja että tähän annetaan jatkuvasti ristiriitaisia ohjeita, vetää mattoa muiden toimien alta.

Ei myöskään pitäisi väittää, että oireettomat kantajat eivät tartuta muita. Kyllä tartuttavat tutkimusten mukaan. Myös se, että koronatartunnan saaneet ja sairastaneet palaavat liian aikaisin töihin on todellinen riski (1). Mitä hyötyä on paikata vuotavan veneen pohjasta muutama reikä, kun paikattujen reikien tilalle porataan uusia. Me olemme uppoavassa veneessä.

”People infected with the novel coronavirus are mainly contagious before they have symptoms and for about a week after symptoms start. That’s the finding of a new study. It followed nine people in Germany who contracted COVID-19.”





Koronapäiväkirja – keskiviikko ja torstai 18-19.3.2020

77. ja 78. päivä

Eksyin keskiviikkona uutisiin. Oli vaikea valita, mistä kirjoitan, joten en lopulta kirjoittanut mitään. Paperille piirsin muutaman typerän huomion. Pandemiauutisten läpi kahlaaminen on oikeastaan aika surullista ja vastenmielistä.

Teen tätä tätä nyt tahdottomasti ja velvollisuudesta itseäni kohtaan. Tarkoitukseni oli rykäistä päivittäin ajatuksia ja havaintoja kronologiseksi ja rehelliseksi muistirungoksi. Jatketaan siis.

Toivon, että voitte hyvin! COVID-19 ei enää ole teoreettinen, uutisten epidemia, vaan todellinen ja hyvin vakava sairaus. Lukujen ja numeroiden takana on ihmisiä. Median luettelemilla numeroilla on kasvot, perheitä, ystäviä ja sukulaisia. Ajatuksissani on erityisesti läheisten ja rakkaiden hyvinvointi. Lämmin halaus Eevalle, Emmalle ja pojille. Pikaista paranemista kaikille sairastuneille!

Raastava matka pimeyteen ja yön valtakuntaan on vasta alussa. Meidän on kuljettava tämä tie yhdessä, mutta se ei ole helppo tie. Kauhukuvilla pelottelu ei ole aiheellista, mutta uutiset eivät anna aihetta optimismiin. Nyt tiedämme, mitä on odotettavissa ja millaisen perkeleen kanssa tässä painitaan.

Suomen hallitus ja viranomaiset ovat oikeastaan tehneet sen, mitä tehtävissä on. Jotain hienosäätöä saatetaan vielä tehdä. Luotan terveydenhuoltoon, josta minulla on paljon hyviä kokemuksia. Uskon, että yhteiskuntamme selviää tästä, vaikkakaan ei ilman kärsimystä. Jokainen meistä ottaa varmasti iskuja vastaan enemmän kuin ansaitsee.Sitä tuskin voi välttää.

THL julkaisi ennusteen

THL:n mallinnuksen mukaan edessä voi olla 188 vaikeaa päivää. Tuon verran epidemian lasketaan kestävän keskiviikkona voimaan astuneen valmiuslain vaikutukset huomioonottaen. Kouluja joudutaan pitämään kiinni todennäköisesti koko kevät. Kukaan ei tällaista toivo, mutta tämä on vain siedettävä ja kannettava yhdessä.

Ennusteen mukaan 42 % suomalaisista voi sairastua koronaviruksen aiheuttamaan hengityselinten sairauteen tulevien kuukausien aikana. Tautihuippu osuu näillä näkymin toukokuun puolivälin tuntumaan.

Tämä on se optimistisin arvio. Poikkeusolojen toimet laskevat tautihuippua, mutta venyttävät epidemian kestoa. Jos mitään ei olisi tehty, epidemia päättyisi ehkä jo 95 vuorokaudessa, mutta sairastuneita olisi jopa 65 % suomalaisista.

Maailmalta tulevien tietojen perusteella tiedetään, että noin 10 % sairastuneista tarvitsee sairaalahoitoa ja jopa 5 % tehohoitoa. Tarttuvuuden laskeminen matalammalle tasolle ehkäisee sairaaloiden ja terveydenhuoltosektorin ylikuormittumista. Kun tartuntahuippu laskee, sairastuneiden määrä tasaantuu pidemmälle ajalle ja vakavammin sairastuneille riittää hoitopaikkoja. Tämä on ainakin tavoite.

Tavallisesti epidemia kulkisi Suomen läpi noin kolmessa kuukaudessa, mutta tehdyillä ratkaisuilla epidemian vauhti hidastuu ja se voi kestää jopa puoli vuotta tautihuipun jäädessä matalammaksi ja paremmin hallittavaksi. Tällainen on hyvin poikkeuksellista.

Myös Britanniassa julkaistiin ennusteita

Boris Johnsonin hallituksen rohkea ajatus laumaimmuniteetista on kokenut täydellisen tieteellisen tyrmäyksen. Tosiasiat kumoavat kauniitkin teoriat.

Imperial College London latasi rumat tosiasiat raporttiin. Tutkijoiden ankaran varoituksen seurauksena brittihallituksen oli muutettava koronastrategiaa. Aluksi valittu laumaimmuniteettiin nojaava strategia olisi todennäköisesti kaatanut koko Britannian terveydenhuoltosektorin (NHS) ja esimerkiksi tehohoidon kapasiteetti olisi ylittynyt ainakin kahdeksankertaisesti.

Imperial College Londonin analyysin mukaan Iso Britanniassa koronavirusepidemia voi ilman sosiaalisia rajoituksia aiheuttaa jopa 510 000 ihmisen kuoleman ja Yhdysvalloissa jopa 2,2 miljoonan ihmisen kuoleman.

Britanniassa toimitaan nyt laaditun koronastrategian mukaan kuten kaikissa vastuullisissa valtioissa Euroopassa. Sosiaalisen eristäytymisen, karanteenien, yleisten tilojen sulkemisen ja liikkumisen rajoittamisen avulla tautihuippua venytetään niin, että terveydenhuoltosektori ei ylikuormitu ja mahdollisimman monet vakavasti sairaat saavat tarvitsemansa hoidon. Myös Britannia sulkee koulut perjantaista alkaen. Lontoossa valmistaudutaan samanlaisiin toimiin, joihin ollaan turvauduttu jo monissa Euroopan kaupungeissa. Kaupat, ravintolat, museot, nähtävyydet jne. suljetaan ja ihmisiä kehotetaan pysymään kotona. Britanniassa ainakin kolmella parlamentin jäsenellä on todettu koronavirus.

Imperial College Londonin analyysi on aiheuttanut vipinää myös Yhdysvalloissa, sillä sen mukaan kuolonuhrien määrä USAssa voi nousta pariin miljoonaan, jos taudin etenemistä ei hillitä.

Facebook ja Twitter ovat aloittaneet koronauutisoinnin tiukan moderoinnin, jotta sosiaalisessa mediassa leviävän disinformaation määrä saadaan laskuun. Samaan aikaan EU kertoo, että Venäjä on aloittanut massiivisen disinformaatiokamppanjan Euroopassa. Myös suomalaisilla keskustelupalstoilla on viestejä, joiden tarkoitus on aiheuttaa epåluottamusta ja epäsopua. Ovatko ne viestejä Pietarista, en tiedä. Valko-Venäjän presidentin mukaan koronavirusepidemia on eurooppalainen psykoosi, johon paras lääke on raskas työ pelloilla.

Facebook tarjoaa Maailman terveysjärjesötlle (WHO) ilmisia tiedonantoja alustallaan. Näin viralliselle ja tutkimusten tukemille tiedoille luodaan kanavia myös sosiaaliseen mediaan.

Italialaisille toivon jaksamista. Keskiviikon aikana Italiassa menehtyi 475 ihmistä koronavirukseen. Italia on tällä hetkellä pimeyden ydin. Espanjan tilanne pahenee hyvin nopeasti. Kiinassa ankarat toimet kantavat nyt hedelmää. Keskiviikkona Kiinassa ei todettu yhtään uutta sairastumista. Suomessa koronatartunnan saaneita oli keskiviikkona 359 ja torstaina nelisensataa.

Taudin eteneminen maailmalla

Mitä tekee Euroopan unioni?

EU on valtavan kritiikin kohteena, koska se vaikuttaa kokoaan heikommalta toimijalta tämän kriisin suhteen. Tähän liittyy eräs olennainen virhearviointi. EU on lähinnä sopimuksiin perustuva lakia säätävä kaupallisen yhteistyön organisaatio, jolta puuttuu oma armeija, poliisi ja terveydenhuoltosektori. Jäsenmaat ovat halunneet säilyttää terveydenhoitoon liittyvät asiat osana omaa suvereniteettiaan, joten EU:lle ei ole rakennettu valmiuksia tällaisen kriisin ratkaisuun.

Keskiviikkona Ranska suunnitteli 345 miljardin euron tukipakettia taloudelle. Yhdistynyt kuningaskunta kertoi 350 miljardin punnan avustuspaketista. Tshekkien on käytettävä hengityssuojainta yleisillä paikoilla. Serbia julisti ulkonaliikkumiskiellon ilta kahdeksan ja aamu viiden väliselle ajalle. Belgia suljettiin 18. maaliskuuta ja 5. huhtikuuta väliseksi ajaksi. Britanniassa julkinen liikenne voidaan palauttaa yksityisomistuksesta valtion omistukseen, jotta liikennöinti voidaan kaikissa tilanteissa turvata.

Kasvava joukko vaikutusvaltaisia eurooppalaisia on allekirjoittanut vetoomuksen, jossa toivotaan EU:n ottavan suuremman vastuun koronavirusepidemiasta:

A EUROPEAN ANSWER TO THE CORONAVIRUS THREAT
TO PROVE THAT THE EU IS A TRUE COMMUNITY WITH A SHARED FUTURE

We European citizens understand that Covid-19 is a common threat, that may hurt one country sooner than another, but will eventually hurt us all, and can impact our daily life and economy almost like a war.

We European citizens are worried and scared by this threat; and even more by the cacophony, selfishness and self-destructive short-sightedness of the different, un-coordinated national responses; by the lack of foresight of our national leaders, who pretend not to know that our interdependence requires a single European answer with strict containment measures of the pandemics, and an EU-wide plan to re-start the European economy afterwards.

We European citizens denounce the current EU as an incomplete Res Publica, thus ill-equipped to face this challenge, with little competences and powers to face the pandemics. We welcome the timely decision by the Commission to provide 25 billion euro and financial flexibility to cope with this threat. Maybe it is the most it can do, but it is not enough.

We call upon the European Commission and Parliament to propose, and on the national governments to adopt (starting with the Eurogroup meeting of March 16, and a following extraordinary European Council to be called soon after) the following urgent measures, also using the Lisbon Treaty passerelle clause and simplified Treaty revision provisions:

  1. Make public health and the fight against epidemics a shared competence of the EU, subject to the ordinary legislative procedure, and provide the Commission with extraordinary powers to coordinate the response to the epidemics, as a federal government should do.

  2. Enlarge the scope of the European Stability Mechanism to finance the immediate strengthening of the European and national health systems to cope with the pandemics, which threatens the lives of European citizens, and thus also the economic and financial stability of the EU.

  3. Abolish the compulsory balanced budget provision for the EU and create a EU Safe Asset to be issued to finance an EU-wide plan to promote EU economic recovery and social cohesion during and after the emergency.

  4. Move fiscal issues to the ordinary legislative procedure and provide the EU with fiscal powers to adopt new own resources – such as the carbon tax (and carbon tariffs), the digital tax, the financial transaction tax – to finance the EU budget (or the Euro-area Budgetary Instrument, if the decision could be reached only at the Euro-area level).

  5. Immediately approve the next Multiannual Financial Framework increasing the budget to at least 1,3% of the EU GDP, as requested by the European Parliament, on the basis of the current structure of the budget financing; and with the provision to reach 2% with the new own resources, to ensure the provision of crucial EU-wide public goods.

  6. Turn the planned Conference on the future of Europe into a fully-fledged European Convention to draft a new Constitutional Pact among the EU citizens and Member states.

We European citizens believe this is the defining hour for the EU. Social perception of the EU will be shaped for years by its response to this crisis. This is the time to prove the EU is a community of values with a shared destiny, a life-line for its citizens and member states in the face of a turbulent global world with political, economic and health threats. It is time for bold common steps to overcome fear. It is time for European unity, not for national division.

EU kuitenkin työskentelee koronakriisin taltuttamiseksi. Se on josopinut ulkorajojen ja Schengen-alueen rajojen sulkemisesta ainakin 30 päiväksi. Euroopan unioniin kohdistuva kritiikki on lähtöisin EU:n huonosta tiedottamisesta ja ihmisten tietämättömyydestä. Seuraavassa katsaus EU:n toimiin epidemian terveydellisten ja taloudellisten haittojen lieventämiseksi.


ECDC, EU ja SARS-CoV-2


Koronavirustyöryhmä

Euroopan komissio koordinoi puheenjohtaja Ursula von der Leyenin johdolla EU-maiden toimia koronavirusepidemian torjunnassa. Koronavirustyöryhmä pyrkii lievittämään epidemian sosioekonomisia vaikutuksia Euroopan unionin jäsenvaltioissa.

Työn koordinointiin osallistuu kahdeksan

  • Johtava varapuheenjohtaja Valdis Dombrovskis – vastuualue: ihmisten hyväksi toimi
  • Johtava varapuheenjohtaja Margrethe Vestager – vastuualue: Euroopan digitaalinen valmius talous
  • Paolo Gentiloni – vastuualue: makrotalous
  • Thierry Breton – vastuualue: sisämarkkinat
  • Stella Kyriakides – vastuualue: terveys
  • Ylva Johansson – vastuualue: rajavalvonta
  • Janez Lenarčič – vastuualue: kriisinhallinta
  • Adina Vălean – vastuualue: liikenne ja matkustaminen


Euroopan tautienehkäisy- ja valvontakeskus (ECDC) antaa teknistä tukea EU:n tasolla toteutettaville toimille, joilla reagoidaan tautiuhkiin. ECDC tuottaa riskiarviointeja ja päivittää epidemiologisia tietoja. Euroopan komission kanssa se voi tukea eri maita ja kansainvälisiä järjestöjä sekä toteuttaa vastatoimia epidemian leviämisen estämiseksi.

Komissio koordinoi EU-maiden kanssa toimintaa EU:n tasolla valtioiden rajat ylittävistä terveysuhkista annetun päätöksen mukaisesti kolmen mekanismin avulla

  1. varhaisvaroitus- ja reagointijärjestelmä
  2. terveysturvakomitea
  3. terveysturvakomitean tiedotusverkosto

Näillä mekanismeilla tuetaan yhteistyötä, tietojenvaihtoa, tautien seurantaa sekä covid-19-epidemiaan liittyvien valmius- ja vastatoimien koordinointai.

Euroopan komissio perusti 17.3.2020 covid-19-asiantuntijaryhmän, joka koostuu epidemiologeista ja virologeista. Ryhmän tehtävänä on laatia EU:n suuntaviivat tieteeseen perustuviksi koordinoiduiksi riskinhallintatoimenpiteiksi. Ryhmän puheenjohtajana toimii komission puheenjohtaja Ursula von der Leyen.

Covid-19-asiantuntijaryhmä antaa komissiolle neuvoja:

  • miten muotoillaan kaikille jäsenvaltioille osoitettavat vastatoimet
  • miten tunnistetaan ja korjataan huomattavia puutteita ja epäjohdonmukaisuuksia toimissa, joilla hillitään koronaviruksen leviämistä, sekä kliinisessä hallinnassa ja kliinisessä hoidossa
  • priorisointi terveydenhuollossa, pelastuspalvelussa yms. sekä EU:n tasolla järjestettävissä tai koordinoiduissa tukitoimenpiteissä
  • ja suosittelee poliittisia toimenpiteitä, joilla voidaan puuttua COVID-19:n pitkän aikavälin seurauksiin ja lievittää niitä.

Valtioiden rajat ylittäviä terveysuhkia koskevassa päätöksessä säädetään lääketieteellisten vastatoimien yhteishankinnan mahdollisuudesta. Koska rajat ylittäviin terveysuhkiin on voitava valmistautua asianmukaisesti, EU-toimielimet ovat yhdessä yhteishankintasopimuksen allekirjoittaneiden maiden kanssa käynnistäneet yhteishankintamenettelyn hankkiakseen:

  • viruslääkkeitä
  • rokotteita
  • lääketieteellisiä vastatoimia rajat ylittäviä vakavia terveysuhkia vastaan.

Euroopan komissio on käynnistänyt henkilönsuojaimia koskevan nopeutetun yhteishankintamenettelyn 20 EU-maan kanssa. Asiaa koskeva tarjouskilpailukutsu on lähetetty usealle markkina-analyysin perusteella valitulle yritykselle. Näin pyritään parantamaan EU-maissa tarvittavien henkilönsuojainten tasapuolista saatavuutta ja minimoimaan mahdolliset puutteet. Hankintasopimus voitaneen allekirjoittaa huhtikuun alussa.

Pandemia ja talouden tukitoimet

Euromaiden valtiovarainministerit sopivat maanantaina käydyssä videokokouksessa tukitoimista koronaviruksen horjuttamalle taloudelle. Kokouksessa sovittiin, että euromaiden sallitaan poiketa velka- ja alijäämätavoitteista sallituissa joustorajoissa, kun valtioiden on rahoitettava ja lainoitettava yrityksiä koronaviruksen vuoksi.

Jäsenmaat voivat ohjata rahoitusta viruksen torjuntaan ja hoitoon. EU siis sallii yrityksille verohelpotuksia, vientitukia ja valtion takauksia. Kokouksessa hyväksyttiin 37 miljardin euron investointirahasto, josta tuetaan terveydenhuoltojärjestelmiä, pieniä ja keskisuuria yrityksiä ja työmarkkinoita. Tämän lisäksi Euroopan rakennerahastoista vapautetaan 28 miljardia euroa uudelleen suunnattavaksi samaan tarkoitukseen.

Komissio ja Euroopan investointipankki suuntaavat kahdeksan miljardia euroa sadantuhannen eurooppalaisen yrityksen lainoittamiseen. Tavoitteena on nostaa tämä summa 20 miljardiin euroon, jolla voitaisiin lainoittaa jopa 250 tuhannen eurooppalaisen yrityksen toimintaa. Investointipankin kautta vapautetaan lisäksi 10 miljardia euroa pk-yritysten investointeihin ja nopeutetaan EU-budjetin takaaman toisen 10 miljardin käyttöönottoa.

Euroopan keskuspankki (EKP) aloittaa 750 miljardin euron hätärahoituksen, kertoo pankin rahapolitiikasta päättävä neuvosto. Pankki alkaa ostaa markkinoilta sekä y ksityisen että julkisen sektorin lainoja. Ohjelma kestää siihen, että pandemia päättyy, mutta vähintään vuoden.

”EKP ilmoitti edellisen kerran viikko sitten koronaviruskriisin aiheuttamista poikkeustoimista. Pankki kertoi, että arvopapereita ostetaan 120 miljardilla eurolla lisää, kun syksyllä ilmoitettu määrä oli 20 miljardia kuussa. EKP pyrkii vahvistamaan myös yritysten lainahanojen pysymisen avoimena.

Epidemia on tuonut epävarmuutta varsinkin pienille ja keskisuurille yrityksille. Keskuspankki paransi sen takia kohdennettujen ja pidempiaikaisten jälleenrahoitusoperaatioidensa ehtoja pankeille. Samalla pankkien vakavaraisuussäädöksiä löysättiin.

Suomen Pankin pääjohtaja Olli Rehn vaati eilen Helsingin Sanomien haastattelussa EKP:tä ottamaan käyttöön kaikki sen toimivallan sallimat keinot, jotta koronaviruspandemian taloudellisia vaurioita voidaan vähentää.” YLE

Lopuksi

Joidenkin tutkimusten mukaan koronaviruksen itämisaika on keskimäärin 5,1 päivää. Yhdysvalloista tulevien tietojen mukaan oireettomat levittävät sairautta. Huolestuttavin tutkimus julkaistiin arvostetussa lääketieteellisessä julkaisussa, Lancetissa. Sen mukaan ihminen voi levittää virusta keskimäärin 20 vuorokautta, vaikka sairauden oireet helpottaisivat. Pahimmissa tapauksissa jo parantuneilla oli viruksia vielä 37 vuorokautta tartunnan jälkeen. Jos näin on, sairauslomalta töihin palaavat ihmiset levittävät yhä virusta ja tällainen skenaario olisi todella pelottava. Täytyy seurata millainen debatti aiheesta syntyy. Tutkimus oli melko pieni, joten siitä ei ehkä tarvitse vetää kovin rajuja johtopäätöksiä. Pysykää terveinä!

Keskiviikko


Torstai




Koronapäiväkirja – tiistai 17.3.2020

76. päivä

Vuosia sitten horjuin. Kompuroin aivan kirjaimellisesti. Unohdin kuinka juostaan. Huono tasapaino sai minut tanssahtelemaan vain pysyäkseni jaloillani. Etenin aina harha-askelin. Nyt otan toisenlaisia harha-askelia.

Sain tammikuussa 2008 multippeliskleroosidiagnoosin. Aivojen magneettikuvat, verikokeet ja selkäydinnestenäytteet tukivat diagnoosia. Elimistöni oli sairastunut, mutta mieli janosi elämää ja kokemuksia. Henkinen matka multippeliskleroosiin oli vasta alkanut.

Kompuroin ja kaaduin uudestaan ja uudestaan. Keho turtui kipuun ja vammoihin. Ihminen on hyvin sopeutuvainen. Kun maailma supistuu semihermeettiseksi kuplaksi, mieli rakentaa kuplaan kokonaisen maailmankaikkeuden, jossa se elää omaa taianomaista elämäänsä.

Löysin sisältäni tarkkailijan. Rakentamassani kuplassa maailma näytti toisenlaiselta. Opin katsomaan elämää ulkopuolisen silmin ja etäältä. Jokainen päivä avautui kuin kirjan sivu – täynnä jännittäviä tapahtumia, suuria ihmeitä ja ihmeellisiä seikkailuja. Ahmin maailmaa kuin jännittävää romaania, jossa tapahtumat muodostavat mutkikkaita toisiinsa kytkeytyviä juonirakenteita. Tällaisena näen maailman vieläkin. Tutkimukset ja uutiset ovat johtolankoja: paloja elämän suuressa palapelissä.

Luen maailmaa ja piirrän siitä karttaa, joka täyttyy merkeistä, vaikka se on yhä yhtä tyhjä kuin aloittaessani. Jokainen kirjoittamani sana on merkintä tähän kartaan. En tiedä, mitä merkit tarkoittavat ja mihin maailman suuri tarina minua vie, mutta yritän pysyä kartalla. Reaalimaailmasta on tullut abstraktio, mutta ymmärrykseni sen suhteen ei ole syventynyt.

COVID-19

COVID-19 pakottaa katsomaan maailmaa etäältä, sarjana toisiinsa kytkeytyviä tapahtumia

Maailmasta tulee peili. Se näyttää kuvia, joita katsoja peiliin heijastaa. Ahdistunut näkee ahdistusta ja surkeutta, optimisti onnistumisia ja kauneutta. Olen siinä siunatussa asemassa, että olen saanut harjoitella tätä pitkään. Minä näen maailman vähitellen avautuvana jännittävänä kertomuksena, jossa on sankareita ja konnia, kauneutta ja rumuutta, rakkautta ja vihaa. Me olemme osa tätä kertomusta, joka avautuu meille vähitellen.

Eristäytyminen ja etäisyys voivat ahdistaa. Aluksi loma omasta elämästä ja arjesta voi tuntua iloiselta ja mahtavalta, mutta pian oleminen muuttuu tylsäksi. Kun häiriötekijät ympärillä vähenevät, ihmisen on kohdattava itsensä. Omasta kokemuksesta tiedän, että ei se aina helppoa ole.

COVID-19 pakottaa meidät perusasioiden äärelle. Mikä elämässä on tärkeää?

On mieletön ajatus, että tuo paljain silmin näkymätön pieni auringon koronaa muistuttava muukalainen on melkein ratkaissut päästöjen vähentämiseen tähtäävät toimet tämän vuoden osalta. Koronavirusepidemia on vähentänyt hiilidioksidipäästöjä valtavasti jo nyt: lentokoneet eivät lennä, risteilyalukset pysyvät satamissa, joukkoliikenne on pysähdyksissä, suuri osa Kiinan tehtaista on kiinni jne. Maailma on ottanut hengähdystauon ja Greta Thunberg on hetkeksi kadonnut maailman mediamaisemasta.

Valoa on tunnelin päässä, mutta tunneli on pitkä ja ahdas

Asioilla on tapana järjestyä, ja siksi epätoivoon ei ole syytä vajota. Asiat ovat mitä ovat ja niiden kanssa pitää oppia elämään. Tapahtumat tapahtuvat ja tämä kestää sen mitä se kestää. Pyörät pyörivät yksittäisen ihmisen huolista ja ahdistuksesta riippumatta.Nyt tämä on täallaista ja huomenna jo toisenlaista.

Minusta on mahtavaa, että ensimmäisen kerran ihmiskunnan historian aikana kaikki ihmiset kamppailevat samaa vihollista vastaan. Jossain vaiheessa pandemian selkä taittuu ja virus kesytetään. Maailmassa on suuria ajattelijoita ja kirkkaita aivoja. Monet näistä aivoista työskentelevät tämän ongelman parissa vuorokauden ympäri.

Jos olisin valaistunut hengellinen opettaja, opettaisin, että nyt on oivallinen aika aloittaa pitkä romaani, ahmia pari sarjaaa njetflixistä, pelailla perheen lasten kanssa korttia ja lautapelejä, opiskella jokin kiinnostava juttu, tehdä kevätsiivous tai lopettaa tupakointi. Mutta minä vain arvailen. En kirjoita vakaumuksella ta varmuudella, vaan kaikella puutarhatontun kokoisen multippeliskleroottisesti orientoituneen idiootin epävarmuudella. Toinen harkinnan arvoinen vaihtoehto on vetää pää täyteen ja odottaa, että taivas huomenna putoaa niskaan.

Minä luotan, että maailma pelastuu ja hyvä voittaa. Kevät koittaa ja aurinko nousee varmasti vielä huomennakin. Mikä pahan tappaisi?

Warning: Coronavirus

COVID-19 kertaus

Koronavirus alkoi olemassaolevien tietojen mukaan joulukuussa 2019 Wuhanissa, Kiinassa.COVID-19 tulee sanoista Corona virus disease sekä vuodesta, jolloin virus havaittiin.

Viruksesta käytetään myös täsmällisempää nimeä, SARS-CoV-2, joka tulee sanoista Severe Acute Respiratory Syndrome-Corona Virus Disease-2. Kaikki hyvin tähän asti.

Mitä koronavirus aiheutta?

Koronavirus tunkeutuu hengityselinten epiteelisoluihin, monistuu niissä ja infektoi uusia soluja. Yleensä oireet ovat lieviä, mutta riskiryhmään kuuluvilla, iäkkäillä ja tupakoivilla keuhkojen hapenottokyky voi romahtaa.

Virus valtaa solun ja valjastaa sen kopioimaan virusta. Näin solun normaali toiminta loppuu. Solut reagoivat infektioon erittämällä sytokiinejä, jotka kutsuvat paikalle kehon oman immuunijärjestelmän. Tulehdusreaktion seurauksena keuhkojen toiminta heikkenee ja keuhkoihin kerääntyy nestettä.

Nykyiseen koronaviruspandemiaan on sairastunut vähintään 190 tuhatta ihmistä ympäri maailman. Todennäköisesti tartunnansaaneita on monikymmenkertainen määrä, sillä monet tapaukset eivät koskaan tule terveysviranomaisten tietoon.

Sairauteen on kuollut viimeisten tilastojen perusteella ainakin 7533 ihmistä.

Kiinan jälkeen Italia, Iran ja Eespanja ovat kohdanneet rajuimman iskun. Eurooppa on taudin keskus. Kiinassa epidemia on osoittanut laantumisen merkkejä ja tänään todettiin vain yksi uusi tapaus.

Epidemian kestosta on esitetty valistuneita arvauksia, mutta on luultavaa, että se kestää ainakin neljä kuukautta. Synkimpien arvioiden mukaan epidemia jatkuu pari vuotta.

Suomessa ja Euroopassa tilanne pahenee päivä päivältä. Hallitus ja viranomaiset päättivät eilen ottaa valmiuslain käyttöön: tämä antaa hallitukselle tarvittavia työkaluja koronavirusepidemian taloudellisten ja inhimillisten vaurioiden minimoimiseen. Koulut suljetaan huomisesta alkaen. Rajat menevät kiinni. Ihmisten liikkumista ja kokoontumisia voidaan tarvittaessa rajoittaa. Luvassa on ainakin alkuun 5 miljardin ensiapupaketti talouden toiminnan turvaamiseksi. Etlan edustajan mukaan todellinen tarve on kolminkertainen ja pitää suotavana, että Suomi ottaa edullista lainaa taatakseen yhteiskunnan ja talouden toimivuuden sekä ehkäistäkseen konkursseja ja suurtyöttömyyttä.

Taudin tarttuvuutta ja leviämistä määrittävä ns. serial interval on keskimäärin neljä päivää. Se asettuu jokseenkin samalle tasolle kuin useimmat influenssaepidemiat. Tämä tarkoittaa, että taudin tartuttua menee keskimäärin neljä vuorokautta oireiden alkuun. Tästä syystä koronavirus leviää hyvin tehokkaasti.

Eilen todettiin ensimmäinen koronavirustartunta Grönlannissa.

Tietenkin tästä tulee helvetin tylsää ja kamalan vaikeaa

Haluttomasti arvaan, että taloudellisesti hyvin monet joutuvat tämän kriisin seurauksena hyvin ahtaalle. Tilannetta ei helpota ylivilkkaat seinille hyppivät lapset yhtään sen enempää kuin hiljainen tai liian puhelias kumppani.

Karanteenissa tilat käyvät ahtaiksi ja seinät kaatuvat niskaan. Monia uhkaa mökkihöperyys. Päiviä voi piristää erilaisilla haasteilla. Tässä on eräs:

Einsteinin arvoitus

Pitkässä rivissä sijaitsee viisi taloa, jotka kaikki ovat keskenään eri värisiä. Joka talossa asuu sen omistaja, joka on eri kansallisuutta kuin yhdenkään toisen talon asukas. Talonomistajat nauttivat kaikki eri juomia, polttavat eri savukemerkkejä ja omistavat eri lemmikkieläimiä. Yksikään ei siis juo samaa juomaa, ei polta samoja savukkeita eikä pidä samaa lemmikkiä kuin yhdenkään toisen talon omistaja.

Vihjeet:

1. Englantilainen asuu punaisessa talossa.
2. Ruotsalaisella on lemmikkinään koira.
3. Tanskalainen juo teetä.
4. Vihreä talo on valkoisen talon vasemmalla puolella heti sen vieressä.
5. Vihreän talon omistaja juo kahvia.
6. Pall Mallia polttava omistaja pitää lemmikkinään lintuja.
7. Keltaisen talon omistaja polttaa Dunhill-savukkeita.
8. Keskimmäisen talon omistaja juo maitoa.
9. Norjalainen asuu talossa, joka sijaitsee ensimmäisenä vasemmalta.
10. Blends-savukkeita polttavan asukkaan naapurilla on kissa.
11. Hevosta lemmikkinään pitävä asuu Dunhillia polttavan naapurina.
12. Bluemastersia polttava talonomistaja juo olutta.
13. Saksalainen polttaa Prince-savukkeita.
14. Norjalainen asuu sinisen talon naapurina.
15. Blends-savukkeita polttava talonomistaja asuu vettä juovan naapurina.

Kysymys kuuluu: kenen lemmikkinä on kala?

Maailmalla tilanne ei ole parempi kuin meillä

Koronavirukseen sairastuneet täyttävät sairaalat myös Ruotsissa. Karoliinisen yliopistosairaalan hoitaja Sara Johnsrud kertoo hoitohenkilökunnan musertuvan työtaakan alle.

Kalifornia on käskenyt yli 65-vuotiaita pysymään kotona koronavirusepidemian vuoksi. Arnold Schwarzenegger kehottaa kaikkia tottelemaan Kaliforniaan asetettua sääntöä, jonka mukaan yli 65-vuotiaiden ja muiden riskiryhmiin kuuluvien tulee eristää itsensä muista ihmisistä. Koska Schwarzenegger on 72-vuotias, tulee myös hänen pysytellä visusti kotonaan.

Arnoldilla on kavereinnaan ainakin miniaasi, minihevonen ja koira. Minulla on kolme kissaa, joiden kanssa voin jakaa huoleni.

Italiassa terveydenhuolto on pahasti ylikuormittunut ja viimeisen vuorokauden aikana menehtyi 349 italialaista. Poikkeusolojen tarkoituksena on välttää Italian kohtalo. Toivotaan, että valmiuslaki toimii.

Ranska on ilmoittanut rajoituksista liikkumiseen. Kotoaan saa poistua vain töihin, kuntoileman, ruokakauppaan ja lääkäriin. Espanjan tilanne muistuttaa päivä päivältä enemmän Italiaa.

Italiassa koronavirukseen on viime vuorokauden aikana kuollut 349 ihmistä. Kaikkiaan kuolemantapauksia on yli 2 100, eniten Kiinan jälkeen. Koronavirustartuntoja on vahvistettu lähes 28 000. Neljä päivää aiemmin tartuntoja oli tavattu noin 15 100. THL:n mukaan Italian terveydenhuoltojärjestelmä on pahasti ylikuormittunut. – IS

Ruotsin pääministeri Stefan Löfven kertoi tiedotustilaisuudessa tänään, että hallitus suosittelee kaikkien lukioiden, aikuiskoulutuksen yksiköiden, korkeakoulujen ja yliopistojen siirtymistä keskiviikosta alkaen etäopetukseen. Ruotsi ei kuitenkaan sulje peruskouluja, esikouluja tai päiväkoteja. – Viimeisen tiedon mukaan Ruotsi voikin sulkea peruskoulut, mutta kuka noista ruotsalaisista ottaa selvää. Löfvenin mukaan Pohjoismaat tekevät samanlaisia päätöksiä, mutta hieman eri tahtiin.

Etlan ennusteen mukaan Suomen talous voi supistua tänä vuonna jopa 5 %. Sille ei voi mitään, koska koko maailma on samassa tilanteessa. Volkswagen ja Fiat-Chrysler sulkeavat suurimman osan Euroopan tehtaistaan. Yhdysvalloissa pörssikurssit syöksyivät nopeammin kuin kertaakaan kolmeenkymmeneen vuoteen. Mitään tällaista ei Wall Streetillä ole koettu sitten vuoden 1987 ”mustan maanantain”.

Talous on vapaassa pudotuksessa, mutta pohjalta on sitten hyvä ponnistaa uuteen kasvuun. Eikö? Monet asiat muuttuvat peruuttamattomasti.

Yhdysvalloissa Trumpin hallinto on reagoinut koronavirusepidemiaan ensimmäistä kertaa aikuisten oikeasti. Luvassa on merkittäviä taloudellisia helpotuksia yritysten verotukseen, tukipaketteja, taloudellista apua köyhille mm. 1000 dollarin shekki parin viikon sisällä, palkallista sairaslomaa koronavirukseen sairastuneille, testejä lääkäriasemilla ja ostoskeskuksissa, kehotus välttää yli kymmenen henkilön kokoontumisia ja pysyä mahdollisuuksien mukaan sisätiloissa jne.

Yhdysvalloissa aloitetaan ensimmäinen koronavirusrokotteen testi 45 aikuiselle jo tänään. Rokote ei sisällä SARS-CoV-2-virusta, vaan osan viruksen geneettistä koodia. Tutkimuksen järjestää ja rahoittaa National Institute of Health (NIH) ja se toteutetaan Seattlessa.

Hong Kongissa on havaittu, että koronaviruksen aiheuttamasta taudista parantuneiden keuhkojen hapenottokyky on merkittävästi heikentynyt. Joillain parantuneilla on todettu jopa 20-30 % alenema hapenottokyvyssä ja arpeumia keuhkoissa.

Euroopan unionia on kritisoitu siitä, että se on jättänyt Italian oman onnensa nojaan. Mielestäni Jaap Folmer selittää tämän hyvin:

”Healthcare was never part of the acquis. It is not a competence or responsibility of the EU. No money, power or sovereignty was ever handed over to Brussels by the member states -including Italy- to deal with these matters.”

Näin ankara epidemia tuli EU:lle ja koko maailmalle puskista. Irvileukaisimmat unionin vastustajat näkevät tässä Euroopan unionin heikkouden ja jopa lopun.

Jäsenmaat eivät kuitenkaan ole tehneet sopimuksia tai rahoittaneet unionia pandemian varalta. Vastuu terveydenhuoltoon liittyvissä kysymyksissä on haluttu säilyttää osana jäsenmaiden omaa päätäntävaltaa ja suvereniteettia.

Toisaalta EU reagoi nopeasti ja aloitti välittömästi toimet jäsenmaiden resurssien ja lääkintätarvikkeiden inventoimiseksi ja pandemian aiheuttaman taloudellisen iskun lieventämiseksi.

Kuvan lähde: Iltalehti

Valmiuslaki – mikä ja miksi?

Valmiuslain tarkoituksen on poikkeusoloissa suojata väestöä sekä turvata sen toimeentulo ja maan talouselämä, ylläpitää oikeusjärjestystä, perusoikeuksia ja ihmisoikeuksia sekä turvata valtakunnan alueellinen koskemattomuus ja itsenäisyys.

Valmiuslaissa säädetään mm., että jos valtioneuvosto, yhteistoiminnassa tasavallan presidentin kanssa, toteaa maassa cvallitsevn poikkeusolot, voidaan säätää valmiuslain II osan säännösten soveltamisen aloittamisesta. Näihin sisältyy yksittäisiä lisätoimivaltuuksia, jotka voidaan ottaa käyöttöön tilanteissa, joissa niiden käyttöönotto katsotaan välttämättömäksi.

Tärkein pointti valmiuslaissa on koko valtakuntaa koskevan päätöksenteon tehostaminen. Hallitus tekee poikkeusoloissa kaikkia koskevia päätöksiä. Normaalisti näistä päättää paikalliset viranomaiset.

Poikkeusoloja ovat valmiuslain mukaan:

1) Suomeen kohdistuva aseellinen tai siihen vakavuudeltaan rinnastettava hyökkäys ja sen välitön jälkitila;
2) Suomeen kohdistuva huomattava aseellisen tai siihen vakavuudeltaan rinnastettavan hyökkäyksen uhka, jonka vaikutusten torjuminen vaatii tämän lain mukaisten toimivaltuuksien välitöntä käyttöön ottamista;
3) väestön toimeentuloon tai maan talouselämän perusteisiin kohdistuva erityisen vakava tapahtuma tai uhka, jonka seurauksena yhteiskunnan toimivuudelle välttämättömät toiminnot olennaisesti vaarantuvat;
4) erityisen vakava suuronnettomuus ja sen välitön jälkitila;
5) vaikutuksiltaan erityisen vakavaa suuronnettomuutta vastaava hyvin laajalle levinnyt vaarallinen tartuntatauti.

Hallitus totesi, että kohdat 3 ja 5 ovat toteutuneet ja edellyttävät valmiuslakia. Lain puitteissa ihmisten kokoontumista ja liikkumista voidaan rajoittaa, lääkkeiden ostoa säännöstellä, rajat laitetaan kiinni jne. Kyllä niistä on jo puhuttu mediassa melkoisesti. Jatketaan tästä huomenna uusien juttujen kanssa.

Tilanne maailmalla




Koronapäiväkirja – maanantai 16.3.2020

Nukuin yllättävän hyvin ja heräsin viideltä aamulla. Kirjoittaminen maistui tervalta, joten olen lähinnä seurannut hallituksen tiedotustilaisuutta ja siihen liittyviä keskusteluja.

Eilen illalla ja yöllä tapahtui jälleen valtavasti. Kaikkea ei enää pysty mitenkään järkevästi prosessoimaan. Informaatiotulvaan on jo helppo hukkua. Yhdysvalloissa New York ja Los Angeles suljettiin julkisten tilojen, kuten ravintoloiden ja teattereiden osalta. Jo siitä voisi kirjoittaa pitkästi, mutta enpä kirjoita.

Tänään maanantaina oli suomalaisittain dramaattisin päivä sitten maailmansotien. Suomessa tunnustettiin poikkeusolot ja hallitus toimi poikkeuksellisen rohkeasti. Tämä tulee  varmasti vielä aiheuttamaan  itkua ja ärräpäitä, mutta nyt olen pelkästään kiitollinen siitä, että uhkaan vihdoin ja viimein suhtaudutaan riittävällä vakavuudella.

Sanna Marin kirjoitti nimensä pysyvästi Suomen historiaan. Tai ehkäpä pitäisi sanoa, että Sanna Marinin ensimmäinen hallitus, koska jo nyt uskallan ennakoida, että tämä ei jää Sanna Marinin ainoaksi hallitukseksi.

Aivan viime hetkillä nuorten naisten kokematon hallitus osoitti päättäväisyyttä, rohkeutta ja vastuunkantokykyä. Se, mitä tämän jälkeen tapahtuu, jää nähtäväksi.

Thomas Pueyo – Coronavirus: Why You Must Act Now (1)

Luin aamulla kiinnostavan artikkelin. Se toimii alustuksena ja pohjana tämänpäiväiselle päiväkirjamerkinnälleni. Referoin ja kommentoin tähän joitain artikkelin ydinkohtia.

Koronavirus tulee ja huomattavan suuri osa väestöstä sairastuu. Osa kuolee. Se on tosiasia. Koronavirus etenee eksponentiaalisella nopeudella. Se hiipii ja vaanii päiviä, jopa viikkoja, ja sitten yllättäen tartuntakäyrä nousee jyrkästi pystysuoraan ylös ja tauti on jo kaikkialla. Kukaan ei ole suojassa.

Sairaalat ja terveyskeskukset täyttyvät ja ylikuormittuvat. Lääkärit ja hoitohenkilökunta väsyy ja voi murtua paineen alla. Potilaita on pakko hoitaa sairaaloiden ja terveysasemien käytävillä. Osa sairastuneista jää ilman hoitoa.

Kun sairalaat ylikuormittuvat – ja ne ylikuormittuvat lähes varmasti – lääkäreiden on päätettävä kenelle annetaan happea ja kenen annetaan vain kuolla.

Näin tapahtui Kiinassa, näin tapahtuu Italiassa ja Espanjassa. Pian tämä tapahtuu myös meillä.

Kysymys ei ole siitä tapahtuuko tämä, vaan siitä tapahtuuko tämä tällä vai ensi viikolla!

THL:n pääjohtaja Markku Tervahauta arvelee, että tartunnansaaneita on jo 20-30 kertaa enemmän, kuin tilastot kertovat. Myös Yhdysvalloista ja Ranskasta on esitetty samanlaisia arvioita.

Minnesotan yliopiston tutkimuskatsauksen mukaan COVID-19 leviää nopeasti myös oireettomien taudinkantajien kuljettamana. Valitettavasti on huomattu, että toisin kuin kuviteltiin, lapset, nuoret ja aikuiset eivät ole vakavamman taudin ulottumattomissa. Myös nuoret voivat sairastua vakavasti.

Sekä Italiassa, että Hollannissa on tehohoidettavana useita alle 50-vuotiaita; nuorimmat ovat 16-vuotiaita. Ainakin yksi 20-vuotias on kuollut koronavirukseen. Idris ”Luther” Elba sairastui.

Sosiaalinen eristäytyminen (social distancing)

Ainoa keino vaikuttaa sairauden leviämiseen on sosiaalinen eristäytyminen. Thomas Pueyo kirjoittaa, että sosiaaliseen eristäytymiseen täytyy ryhtyä jo tänään. Huomenna on jo myöhäistä.

Sosiaalinen eristäytyminen on ainoa tapa hidastaa tautia ja estää sairaaloiden ja terveyskeskusten ylikuormittuminen. Näin taudin leviäminen jatkuu pidempään, mutta sairaalahenkilökunnan ja sairaaloiden kantokykyä ei ylitetä.

Sosiaalisella eristäytymisellä ja poikkeusolojen ohjeilla madalletaan siis tartuntojen käyrää. Käyrä venyy ajallisesti, mutta jokainen vakavasti sairas potilas saa tarvitsemansa hoidon ja väistämättömät hoidonpuutteen aiheuttamat kuolemantapaukset vähenevät.

Vastuu on kaikilla, vaikka yhteiskunta kantaa raskaimman taakan

Poliitikoilla, uskonnollisten yhteisöjen- ja yritysten johtajilla on mahdollisuus ja velvollisuus vaikuttaa taudin etenemiseen. Sosiaalinen eristäytyminen antaa arvokasta aikaa.

Toivon, että kukaan ei toimi niin vastuuttomasti kuin Trumpin kannattajiin kuuluva ”megakirkon” pastori Guillermo Maldonado Floridasta, joka kehottaa ihmisiä pakkautumaan kirkkoihin rukoilemaan:

“Do you believe God would bring his people to his house to be contagious with the virus? Of course not,” pastor Guillermo Maldonado said, according to the Miami Herald. “If we die, we die for Christ. If we live, we live for Christ, so what do you lose?”

Mihin menet Eurooppa?

Rajat sulkeutuvat kaikkialla maailmassa ja jopa rajojen sisälle syntyy rajoja. Tämä on osoittaa, kuinka poikkeuksellisista oloista on kyse. EU on luvannut joustoa budjettikuriin, kerää koronavirusrahastoa ja valmistautuu auttamaan jäsenvaltioita sellaisissa asioissa, joihin EU:lla on mandaatti.

Sosiaali- ja terveyskysymykset ovat jäsenvaltioiden oman lainsäädännön ja harkinnan piirissä. Jäsenvaltiot ovat luvanneet masiivisia tukipaketteja talouden, yrittäjien ja työllisyyden tukemiseksi. Myös EU on ilmoittanut, että pandemian aiheuttaman taloudellisen iskun lievittämiseksi tehdään kaikki voitava.

Kiina antoi Euroopalle ja muulle maailmalle aikaa välittömillä ja rajuilla toimilla, mutta ikävä kyllä Kiinan toimia epäiltiin, aivan kuten epäiltiin koronavirusepidemian mahdollisuutta rantautua Eurooppaan. COVID-19 kuitenkin pyyhkäisi Euroopan ja koko maailman yli kuin tsunami. Kaikki muuttui muutamassa päivässä.

Kuinka maailma herää tästä painajaisesta on arvoitus

Koronavirus etenee nyt eksponentiaalisesti. Tartunnansaaneita on kymmeniä kertoja enemmän, kuin virallisista tilastoista voi päätellä. Italia on se peili, johon meidän tulee peilata kehitystä. Espanja, Ranska ja Saksa kulkevat Italian viitoittamaa tietä. Pahin on vielä edessä. Siksi oli tärkeää, että hallitus tänään teki inhottavat, mutta rohkeat ja välttämättömät päätökset.

2-4 viikossa koko maailma pysähtyy. Suuri osa maailmasta on jo pysähtynyt. Ovet laitetaan kiinni ja lukitaan. Ulkona on kylmää ja pimeää. Näkymätön tappaja voi vaania missä vain. Pelko kasvattaa pelkoa, mutta tosiasioiden tunnustaminen on viisauden alku, kuten Paasikivi tiesi.

Tämä on nationalistien märkä uni: rajat laitetaan kiinni ja eristäydytään muusta maailmasta. Tietenkään tällaisessa tilanteessa ei ole muuta ratkaisua. Kenellekään tämä ei tule olemaan helppoa pidemmän päälle. Monet menettävät työnsä ja monet yritykset ajautuvat konkurssiin. Se on hyvin surullista.

Ulkorajojen sulkeminen ei tarkoita, etteikö myös maan sisäistä liikkumista voitaisi rajoittaa. Tshekissä jopa yksittäisiä kaupunkeja ja kyliä on asetettu eristykseen, joten kansallisten rajojen sulkemisesta voidaan vielä päätyä rajumpiin liikkumista rajoittaviin toimenpiteisiin.

Nyt sulkeutuu Suomi. Tämä on äärimmäisen kova toimenpide, mutta se on ainoa varma tapa säästää ihmishenkiä. Me haluamme välttää Italian ja Espanjan kohtalon.

Kiinassa karanteenit ja eristäminen katkaisivat epidemian selän. Muualla maailmassa COVID-19 on karannut hallinnasta. Italian kriisiä on perusteltu:

  1. maailman toiseksi vanhimmalla väestöllä
  2. italialaisten alhaisella käsienpesuaktiivisuudella
  3. viranomaisten liian hitaalla ja flegmaattisella toiminnalla
  4. italialaisten halailu- ja poskisuudelmakulttuurilla
  5. italialaisten yhteisöllisyydellä
  6. turismilla

Kiinassa COVID-19 levisi aluksi eksponentiaalisesti, kunnes rajujen toimenpiteiden ja karanteenien jälkeen taudin eteneminen talttui. Virus kuitenkin livahti tiiviin verkon läpi. Nyt taistelemme koronaviruspandemiaa vastaan, eikä kukaan voi sitä enää pysäyttää.

Ainoa tapa taistella tätä näkymätöntä tapaajaa vastaan on hidastaa taudin leviämistä, jotta lääkäreille ja sairaaloille jää aikaa, eikä koidu toivottoman raskasta potilasruuhkaa pienen ajan sisällä. Aikanaan tähän tautiin kehittyy ainakin osittainen immuniteetti. Ehkä sitä ennen kehitetään rokote. Asiantuntijoiden mukaan koronavirus on tullut jäädäkseen, mutta ehkä se tulevaisuudessa muistuttaa enemmän tavallista flunssaa.

Mitä nyt tiedetään?


Kaaviossa Etelä-Korean, Italian ja Iranin tautitapaukset peittävät näkyvistä pelottavan faktan. Se näkyy, kun zoomataan lähemmäksi kaaviota (toinen kaavio). Siitä nähdään, että tilanne Ranskassa, Saksassa, Espanjassa, Japanissa, Yhdysvalloissa, Sveitsissä ja Britanniassa noudattaa lähes samaa mallia kuin taudin eteneminen Italiassa, Iranissa ja Etelä-Koreassa.

Ennuste on synkkä.Oheinen kaavio osoittaa sen, miksi Kiinan toimintamalli on oikea: jokaisessa kiinan provinssissa tartuntojen määrät etenevät tasaisesti, vaikka ne olisivat voinut kasvaa eksponentiaalisesti. Näiden kaavioiden perusteella sosiaalinen eristäminen toimii, eikä tautitapaukset karkaa hallinnasta. Epidemia venyy, mutta pysyy hallinnassa. Näin sairaalat eivät ylikuormitu ja aikanaan epidemia helpottaa.

Yhdysvaltojen tilanne on huolestuttava. Washingtonin osavaltiossa koronavirustartunnat lisääntyvät eksponentiaalisesti. Huolta aiheuttava ”amerikkalainen ilmiö” on, että kuolleisuus tautiin oli eräässä vaiheessa 33 %. Tiedetään, että kuolleisus koronavirukseen on jotain 0,5 ja 5 prosentin väillä, joten miten se voisi olla 33 %?

Tutkimuksessa selvisi, että tauti oli jyllännyt osavaltiossa jo pidempään, mutta koska koronavirusta ei aktiivisesti testattu, tartunnan saaneet jäivät piiloon. Sairastuneiden koknaismäärä on mysteeri, mutta matemaattisten mallien perusteella voidaan todettujen tapausten perusteella laskea, että tauti on alkanut USA:ssa ennen Italiaa, ja että tartuntoja on monikymmenkertainen määrä todettuihin tapauksiin verrattuna. On luultavaa, että ythdysvalloissa tartunnan saaneita on jo 100-150 tuhatta ja koronavirukseen kuolleita saattaa todellisuudessa olla sadoista muutamaan tuhanteen, mutta ne ovat jääneet koronatutkan ulkopuolelle.

Washingtonissa kolmesta varmistetusta tapauksesta yksi kuoli, joten kuolleisuudeksi määräytyi 33%, mutta todellisuudessa tämä on vain jäävuoren huippu.

Entäpä tulevaisuus

Tartunnan saaneet ihmiset, jotka kuolevat, kuolevat keskimäärin 17,3 päivää tartunnan saamisen jälkeen. Niinpä Washingtonin osavaltiossa 29.2. kuollut henkilö sai tartunnan luultavasti joskus kahdennentoista päivän paikkeilla. Koska kaikkia tapauksia ei diagnosoida, niiden määrä voidaan laskea likimääräisesti:

”Now, use the average doubling time for the coronavirus (time it takes to double cases, on average). It’s 6.2. That means that, in the 17 days it took this person to die, the cases had to multiply by ~8 (=2^(17/6)). That means that, if you are not diagnosing all cases, one death today means 800 true cases today.”

Kun Washingtonin osavaltiossa 22 ihmistä oli kuollut koronavirukseen, tautitapauksia oli edellisen matemaattisen kaavan perusteella noin 16 000. Mutta ei vielä hätiköidä.

19 kuolemantapausta muodosti yhden ryppään, joka voidaan tasoittaa yhtälössä yhdeksi kuolemaksi. Näin tartunnan saaneiden määrä putoaa kolmeen tuhanteen. Kun vielä erilaiset muuttujat lasketaan yhtälöön, putoaa tartuntojen määrä hieman yli tuhannen tuntumaan. Se on kymmenkertainen määrä todettuihin tapauksiin verrattuna.

”France claims 1,400 cases today and 30 deaths. Using the two methods above, you can have a range of cases: between 24,000 and 140,000.”

Havaittujen tartuntojen määrä ei kerro totuutta tartuntojen määrästä. Todellisuudessa sairastuneita on monikymmenkertaisesti havaittuja tapauksia enemmän. Tähän ymmärtääkseni Markku Tervahauta viittasi. Mitä se sitten tarkoittaa? Se tarkoittaa, että pahin on vielä edessä, mutta nyt tehdyt toimenpiteet hidastavat taudin etenemistä ja ehkäisevät sairaaloiden ylikuormittumista.

Hallituksen linjaamat toimenpiteet:

1. Varhaiskasvatuksen toimintayksiköt ja niiden yhteydessä järjestettävä esiopetus pidetään toiminnassa. Näin turvataan yhteiskunnan toiminnan kannalta kriittisten alojen henkilöstön lasten pääsy varhaiskasvatukseen ja mahdollistetaan vanhemmille työssäkäynti. Valtioneuvosto linjaa, että ne vanhemmat ja huoltajat, joiden on mahdollista järjestää lapsen hoito kotona, menettelevät niin.

2. Koulujen, oppilaitosten, yliopistojen ja ammattikorkeakoulujen sekä kansalaisopistojen ja muun vapaan sivistystyön tilat suljetaan ja lähiopetus niissä keskeytetään. Poikkeuksellisesti kuitenkin järjestetään koulussa järjestettävä esiopetus sekä perusopetuksen 1-3 luokkien lähiopetus niiden vanhempien lapsille, jotka työskentelevät yhteiskunnan toiminnan kannalta kriittisillä aloilla. Lisäksi poikkeuksena järjestetään erityisen tuen päätöksen saaneiden oppilaiden lähiopetus sitä tarvitseville, kuitenkin niin että ne vanhemmat ja huoltajat, joiden on mahdollista järjestää lapsen hoito kotona, menettelevät näin. Edellä mainitut järjestelyt tulevat voimaan keskiviikkona 18.3.2020.

3. Lähiopetuksen sijaan kaikkien yliopistojen, ammattikorkeakoulujen sekä ammatillisen koulutuksen, lukiokoulutuksen ja perusopetuksen järjestäjien opetus ja ohjaus järjestetään mahdollisimman laajalti vaihtoehtoisilla tavoilla, muun muassa etäopiskelua, erilaisia digitaalisia oppimisympäristöjä ja -ratkaisuja sekä tarvittaessa itsenäistä opiskelua hyödyntäen.

4. Ylioppilastutkinnon kokeet toteutetaan 13.3.2020 julkaistussa tiivistetyssä aikataulussa 23.3.2020 mennessä huomioiden terveysviranomaisten antamat määräykset.

5. Rajoitetaan julkiset kokoontumiset kymmeneen henkilöön ja suositellaan välttämään tarpeetonta oleilua yleisillä paikoilla.

6. Suljetaan valtion ja kuntien museot, teatterit, Kansallisooppera, kulttuuritalot, kirjastot, kirjastoautot, Kansallisarkiston asiakas- ja tutkijasalipalvelut, harrastustilat ja -paikat, uimahallit ja muut urheilutilat, nuorisotilat, kerhotilat, järjestöjen kokoontumistilat, vanhusten päivätoiminta, kuntouttava työtoiminta ja työkeskukset. Suositellaan yksityisen ja kolmannen sektorin toimijoiden sekä uskonnollisten yhteisöjen toimivan samoin.

7. Kielletään vierailut vanhusten ja muiden riskiryhmien asumispalveluyksiköissä.

8. Kielletään ulkopuolisten vierailut hoitolaitoksissa, terveydenhuollon yksiköissä ja sairaaloissa pois lukien tapauskohtaisesti arvioiden kriittisesti sairaiden ja lasten oireettomat läheiset, saattohoidossa olevien läheiset sekä puoliso tai tukihenkilö synnytysosastolla.

9. Julkisen sektorin työnantajat määräävät ne julkisen sektorin työntekijät etätyöhön, joiden työtehtävät sen mahdollistavat.

10. Toimintaohjeena yli 70-vuotiaat velvoitetaan pysymään erillään kontakteista muiden ihmisten kanssa mahdollisuuksien mukaan (karanteenia vastaavat olosuhteet), poislukien kansanedustajat, valtiojohto ja kunnalliset luottamushenkilöt.

11. Lisätään sosiaali- ja terveydenhuollon kapasiteettia julkisella ja yksityisellä sektorilla. Samanaikaisesti vähennetään kiireetöntä toimintaa. Yksityisen sektorin kapasiteetti otetaan yhteiseen käyttöön tarpeen mukaan. Samaan aikaan joustetaan lakisääteisistä määräajoista ja velvoitteista.

12. Kasvatetaan korona-testauskapasiteettia. THL tukee alueita tältä osin.

13. Kriittisen henkilöstön osalta poiketaan työaikalain ja vuosilomalain säännöksistä sekä yksityisellä että julkisella sektorilla.

14. Varaudutaan velvoittamaan erityisesti sosiaali- ja terveydenhuollon sekä sisäisen turvallisuuden koulutettuja ammattihenkilöitä tarpeen mukaan töihin.

15. Ihmisten liikkumista voidaan rajoittaa henkeä ja terveyttä uhkaavan vakavan vaaran vuoksi.

16. Kansanterveyden ja terveysturvallisuuden vuoksi aloitetaan valmistelu Suomen rajojen sulkemiseksi pikaisella aikataululla kansainvälisiä velvoitteita noudattaen. Keskeytetään matkustaja- ja henkilöliikenne Suomeen niin pian kuin mahdollista, lukuun ottamatta Suomen kansalaisten ja Suomessa asuvien henkilöiden paluuta. Suomen kansalaisten ja Suomessa asuvien henkilöiden ei pidä matkustaa ulkomaille. Suomalaisille matkailijoille suositellaan välitöntä paluuta Suomeen. Pohjois- ja länsirajan yli sallitaan välttämätön työssäkäynti ja muu välttämätön asiointi. Tavara- ja rahtiliikenne jatkuu normaalisti.

17. Ulkomailta palaavat suomalaiset ja Suomessa pysyvästi asuvat henkilöt ohjataan kahden viikon karanteenia vastaaviin olosuhteisiin.

18. Ulkomailta palaavien tulee sopia työhön paluunsa ajankohdasta ja kahden viikon poissaolosta yhdessä työnantajansa kanssa.

19. Puolustusvoimat turvaa toimintansa jatkuvuuden ja valmiuden kaikissa tilanteissa. Muita viranomaisia valmistaudutaan tukemaan tarpeen mukaan.

Päätökset ja suositukset saatetaan voimaan valmiuslain, tartuntatautilain ja muun lainsäädännön mukaisesti. Hallituksen poikkeusolojen käytännöt ovat voimassa alustavasti 13.4. asti. Nämä ovat kovia, mutta olemassaolevien tietojen valossa välttämättömiä ratkaisuja.

Olen aiemmissa päiväkirjahuomioissani arvostellut THL:sta, suomalaista viranomaistoimintaa. Nyt haluan kiittää rohkeasta ja vastuullisesta toiminnasta poikkeuksellisissa oloissa. Edessä on kovat ajat. Me kaikki kannamme yhdessä tätä taakkaa, mutta jonain päivänä taakka kevenee. Pohjalle on ikävä kyllä vielä matkaa, mutta lopulta aurinko nousee ja voimme kömpiä koloistamme ilman pelkoa.




Koronapäiväkirja – sunnuntai 15.3.2020

74. päivä

Tämän kokoluokan globaaleja tapahtumia mahtuu yksi tai kaksi vuosisataan. Elämme siis poikkeuksellisia ja jopa historiallisia aikoja. Riippumatta siitä, kuinka pandemiaa tarkastellaan, tuntuu kuin eläisimme katastrofielokuvan sisällä.

Contagion

Tästäkin suosta selvitään, vaikka ei ihan kuivin jaloin

COVID-19 herättää tietenkin pelkoja, mutta toivottomuuteen ei pidä heittäytyä. Hieman vähemmälle huomiolle uutisoinnissa on jäänyt tieto, että Kiinassa tilanne paranee päivä päivältä, ja pahin siellä on jo takanapäin. Joissain Kiinan provinsseissa ei ole todettu ainuttakaan uutta tartuntatapausta sitten helmikuun 19. päivän. Päivittäin jopa 1500 kiinalaista potilasta paranee koronaviruksen aiheuttamasta taudista. Suurin riski on iäkkäillä ja perussairailla. Nuorilla ja hyväkuntoisilla tauti voi olla lähes oireeton.

COVID-19-viruksesta on jo olemassa yli sata harvinaista mutaatiota. Nämä jakautuvat kahteen ryhmään: L- ja S-alatyyppiin. L-alatyyppi on aggressiivinen ja jopa tappava, mutta S-alatyyppi aiheuttaa yleensä vain lievän, jopa huomaamattoman taudin.

China Dailyn mukaan kiinalaiset tutkijat havaitsivat, että COVID-19 on kehittynyt kahdeksi yleiseksi alatyypiksi. Näiden tutkiminen voi auttaa riskiarvioinneissa ja hoitokeinojen kehittämisessä. Nämä viruksen alatyypit ovat L- ja S-alatyyppi. L-alatyyppi on selvästi aggressiivisempi ja se levisi nopeasti etenkin Wuhanin epidemian kriittisimmässä vaiheessa.

Vähemmän aggressiivinen ja lievempiä oireita aiheuttava COVID-19-viruksen S-alatyyppi on hieman yleistynyt Kiinassa taudin leviämisen seurauksena, mutta L-alatyyppiä sairastaa jopa 70 % tartunnan saaneista.

Tutkijat tunnistivat 149 mutaatiota uuden koronaviruksen 103 sekvensoidussa genomissa. Nämä voitiin edelleen jakaa kahteen päätyyppiin. Asiantuntijoiden oletus on, että mutaatiot ovat tapahtuneet melko hiljattain.

Tutkimus, jonka otsikko on ”SARS-CoV-2:n alkuperä ja jatkuva kehitys”, julkaistiin tiistaina vertaisarvioidussa National Science Review -lehdessä. Tutkimuksen tekivät Pekingin ja Shanghain yliopistojen ja Kiinan tiedeakatemian tutkijat. Tutkijat korostivat, että tutkimus oli varsin pieni.Vielä ei tiedetä, kuinka L-tyypin kannat kehittyivät S-tyypistä ja kuinka nämä mutaatiot vaikuttavat viruksen leviämiseen ja patogeneesiin.

Laumaimmuniteetti Britannian malliin?

Britanniassa on jo harkittu laumasuojan hankkimista altistamalla riittävän suuri osa nuorista ja hyväkuntoisista taudille, jotta taudin leviäminen saarivaltakunnassa estyisi. Teoria on, että vanhukset ja perussairaat eristetään ja taudin annetaan jyllätä nuorten ja terveiden keskuudessa. Kun riittävän suuri osa väestöstä saa immuniteetin koronavirukselle, tauti ei enää leviä ja väestö on turvassa.

Tällainen koko kansakunnan ihmiskoe on herättänyt huolta ja epäilyjä. Monet asiantuntijat ovat varoittaneet, että mitään takeita immuniteetin muodostumisesta ja laumasuojasta ei ole.Ideana ajatus on hyvä; se ehkäisisi todennäköisesti myös saman koronakannan tulevat epidemiat. Vaarana on, että nopeasti mutatoituvaan tautiin ei muodostu immuniteettia ja koe menee reisille, jolloin suuri osa altistuu turhaan koronavirustartunnalle.

‘Our aim is to try and reduce the peak, broaden the peak, not suppress it completely’: Sir Patrick Vallance, chief U.K. scientific adviser”

Ison-Britannian johtava tieteellinen neuvonantaja Patrick Vallance sanoi, että laumaimmuniteetti on vaihtoehto, jota hallitus tutkii pyrkiessään hillitsemään COVID-19-viruksen leviämistä. Tavoitteena olisi antaa immuniteetin kehittyä väestötasolla ihmisille, joilla on pienin riski kuolla koronaviruksen aiheuttamaan sairauteen.

Tavoitteena on siis antaa laumaimmuniteetin kehittyä, jotta riittävän monet ihmiset ovat immuuneja taudille. Näin taudin etenemistä voidaan hidastaa, mikä suojelee sellaisiakin ihmisiä, joilla on suurin riski kuolla koronavirustartunnan aiheuttamaan sairauteen.

Yhdistyneessä kuningaskunnassa ehdotetun idean tarkoituksena on erottaa pienemmän riskin ihmiset korkeamman riskin ryhmästä, johon kuuluvat yli 70-vuotiaat sekä ihmiset, joilla on perussairauksia. Teorian mukaan pienen riskin ryhmässä 60 % sairastuminen kehittää laumaimmuniteetin, joka suojaa kaikkia. Etuna tällaisesta on, että se ehkäisisi saman viruskannan tulevia epidemioita ja säästäisi valtavasti julkisen talouden resursseja.

Tuntematon tuntematon ja musta joutsen

Maailmamme muuttuu nopeammin, kuin kertaakaan sotien jälkeen. Vuoden päästä keväällä maailma on varmasti hyvin erilainen kuin tänään. Millaisia tulevat muutokset ovat ja kuinka ne vaikuttavat maailmaan? Sitä ei kukaan voi varmasti tietää. Edessämme on tuntematon tuntematon.

Yhden positiivisen asian olen huomannut: koronavirusepidemia tuo perspektiiviä asioihin ja näyttää siltä, että tyhjänpäiväinen nahistelu triviaaleista asioista on jo vähentynyt. Parhaiten selviämme, jos kaikki puolueet tekevät yhteistyötä koronaviruksen vahinkojen minimoimiseksi.

Kirjoittaessani tätä todettuja koronavirustartuntoja on Suomessa 244. Ulkoministeriö kehottaa välttämään ulkomaanmatkoja. Epidemia näkyy jo arjessa. Ihmiset välttelevät liikkumista kaupungillla. Karanteeneja on asetettu ja monet ihmiset ovat mahdollisuuksien mukaan asettaneet itsensä ja perheensä vapaaehtoiseen karanteeniin.Taksikuskit ja ravintolatyöntekijät kertovat samaa: hiljaista on. Tavastia-klubi laittoi ovet kiinni jo perjantaina koronaviruksen vuoksi.

Viro sulkee rajansa ja estää ulkomaalaisten pääsyn maahan 17. maaliskuuta alkaen. Donald Trumpin koronavirustesti oli negatiivinen, mutta Espanjan pääministeri Pedro Sanchezin vaimon koronavirustesti oli positiivinen. Javier Solana kuoli tautiin.

Ranskan pääministeri Edouard Philippe kertoi lauantaina, että maassa suljetaan kahvilat, ravintolat, elokuvateatterit ja kaupat lauantain ja sunnuntain välisestä yöstä alkaen. Ainoastaan apteekit, bensa-asemat ja ruokakaupat pysyvät auki. Lauantaihin mennessä 4500 ranskalaista oli sairastunut ja 91 kuollut koronavirustartunnan seurauksena. Koronavirus sulkee myös Kanariansaaret.

Itävalta myöntää heti neljän miljardin euron tukipaketin koronavirusepidemian vuoksi talousvaikeuksiin joutuneille yrityksille. Kiinalaisten mukaan koronaviruksella voi olla pitkäaikaisia terveysvaikutuksia. Osa parantuneista kärsii keuhkojen vajaatoiminnasta.

Väkilukuun suhteutettuna koronavirus runtelee Italiaa todella kovalla kädellä. Syynä pidetään viranomaisten hidasta reagointia, tiivistä yhteisöllisyyttä ja maailman toiseksi iäkkäintä väestöä.

Lukuja sunnuntaina 15.3.2020:

Kiinassa tartuntoja 80 995 ja kuolleita 3199

Italiassa tartuntoja 21 157 ja kuolleita 1441

Iranissa tartuntoja 13 938, kuolleita 724

Etelä-Koreassa tartuntoja 8162, kuolleita 75

Espanjassa tartuntoja 7753, kuolleita 291

Saksassa tartuntoja 5426, kuolleita 11

Ranskassa tartuntoja 4499, kuolleita 91

Yhdysvalloissa tartuntoja on nyt 3083, kuolleita 60

Sveitsissä tartuntoja 2217, kuolleita 14

Norjassa tartuntoja 1205, kuolleita 3

Iso Britanniassa tartuntoja 1143, kuolleita 21

Alankomaissa tartuntoja 1135, kuolleita 20

Ruotsissa tartuntoja 1024, kuolleita 2

Koko maailma: tartuntoja 162868, kuolleita 6070

Live-seuranta

”Korona sattui iskemään maailmaan tilanteessa, jossa vanhoja ajattelutapoja oli jo ehditty kyseenalaistaa monelta suunnalta. Ilmastonmuutos, toistuvat pakolaiskriisit, poliittisen järjestelmän heikkeneminen ja kansainvälisen järjestyksen horjuminen ovat kaikki vahvistaneet sellaista ajatusta, että maailmassa on jotain vikaa.” Saska Saarikoski / HS

Tänään Itävalta kielsi yli 5 henkilön kokoontumiset. Italiassa sairastuneiden määrä ylitti 21 000 ja Espanjaan julistettiin poikkeustila.

Kiina osti koko maailmalle arvokasta aikaa

Varmasti ei voida tietää kauanko kiinalaiset pimittivät tietoa uudesta ihmisiin tarttuvasta koronaviruksesta. Todennäköisesti kiinalaiset viranomaiset reagoivat nopeammin ja aktiivisemmin kuin viranomaiset monissa Euroopan maissa ja Yhdysvalloissa.

Kiinassa on valtavasti moitittavaa, mutta kukaan ei voi enää kiistää kiinalaisten tehokkuutta ja edistymistä. Kun Yhdysvallat on Trumpin hallinnon aikana vetäytynyt kuoreensa ja luopunut maailman johtajan asemasta, Kiina kärkkyy tuota asemaa.

Kiina on taloudellisesti, teknologisesti ja sotilaallisesti saavuttanut Yhdysvallat ja menee varmasti pian ohi (jos ei jo ole mennyt). Kiinan etuina on terveempi ja koulutetumpi väestö kuin USA:ssa sekä maailman massiivisin teollisuuspotentiaali. Kiinan vaikutusvalta ja omistukset ovat kasvaneet kaikkialla maailmassa Afrikasta Eurooppaan. Tämä lienee yksi muutos maailman geopoliittisessa tilanteessa epidemian jälkeen.

Kiinan rajut toimet Wuhanin tartuntojen eristämiseksi herättivät länsimaissa hämmennystä, mutta kun nyt katselee Eurooppaa ja maailmaa, kiinalaisten toimet asettuvat kontekstiin. Nyt olisi järkevää ottaa opiksi kiinalaisten ja italialaisten kokemuksista, eikä toistaa Italian virheitä.

Wuhanin asettaminen karanteeniin oli jotain uskomatonta. Kaupunki on samaa kokoluokkaa Lontoon ja New Yorkin kanssa. Kun sairaalapaikat loppuivat, kiinalaiset rakensivat väliaikaisen 1000 potilaan sairaalan kymmenessä päivässä. Ja sitten toisen.

Karanteeni osui kiinalaiseen uuteenvuoteen, jolloin kiinalaiset matkustavat kotiseudulleen ja tapaavat perhettä ja sukulaisia. Kiinalaiset ymmärsivät ja ymmärtävät jotain, mitä länkkärit eivät oikein tajua: velvollisuudet menevät yksilön vapauksien ja oikeuksien edelle. Tämä näkyi Kiinan reaktiossa ja se antoi varmasti aikaa muille maille.

Kiinalaiset ovat käyttäneet aktiivisesti hengityssuojaimia epidemian alusta alkaen. Toisin kuin meille on kerrottu, kiinalaisen tutkimuksen mukaan hengityssuojain suojaa tartunnalta ainakin jonkin verran.

Lääkintähenkilökunta käyttää Kiinassa suojavaatteita, joiden päälle pukemiseen menee tunti. Niiden riisuminen ja desinfioiminen on niin hankalaa, että hoitohenkilökunta käyttää vaippoja. Julkisia tiloja desinfioitiin ja desinfioidaan jatkuvasti. Desinfioivia liinoja on kaikkialla. Lakeja muutettiin Kiinassa tarpeita vastaavaksi epäröimättä.

Kiina osti tehokkailla toimillaan aikaa, jonka me tuhlasimme epäilyyn sen sijaan, että olisimme valmistautuneet ajoissa. Suomalaisten ja monien muiden maiden viranomaisten viesti oli: ei se tänne tule, ja jos tulee, se on hyvin lievä, eikä tartu moneen.

Koskakohan poliitikot alkavat kuunnella asiantuntijoita.WHO ja Euroopan tartuntatautivirasto (ECDC) tuottavat ajantasaista ja arvokasta tietoa, jota Suomen hallituksen ja viranomaisten on käytettävä päätöksiä tehtäessä.

Erilaisia salaliittoteorioita syntyi heti taudin tultua julki

Näistä ehkä eniten huomiota saivat amerikkalaisen senaattorin väite, että koronavirus karkasi kiinalaiselta huippumodernilta biologisen sodankäynnin laitokselta. Toisaalta kiinalaisdiplomaatti väitti, että koronavirus oli amerikkalaisten biologinen hyökkäys Kiinaan.

Tällaisia syytöksiä nousee aina pintaan, kun jotain pelottavaa tapahtuu. Kolmas maininnan arvoinen salaliittoteoria on, että Yhdysvalloissa koronavirukseen viittaavia havaintoja tehtiin jo viime vuonna, mutta tapauksiin liittyvistä keuhkovaurioista syytettiin julkisuudessa sähkötupakkaa. Tämän viimeisen tarinan mukaan Wuhaniin marraskuussa saapui 10 000 ulkomaalaista maailman sotapeleihin osallistuvaa vierasta. Aamerikkalaiset toivat taudin mukanaan.

Niissä jutuissa tuskin on mitään perää. Pandemiaa on osattu odottaa jo pitkään, ja monet tutkijat ovat tienneet, että kysymys ei ole siitä tuleeko pandemia, vaan siitä, koska se tulee. TEDTALKissa puhunut Bill Gates varoitti pandemiasta jo 2015, eikä hän edes ole virologi. Johns Hopkinsin tutkijat ajoivat tietokonesimulaation koronaviruksen aiheuttamasta pandemiasta vain kuukausia ennen Wuhanin ensimmäisiä tartuntoja.

Kiinalaiset toimivat nopeasti ja tehokkaasti jo taudin alkuvaiheessa. Wuhan ja Hubei asetettiin tiukkaan karanteeniin, kun sairastuneita oli virallisten tietojen mukaan vasta joitain satoja. Ensireaktiot maailmalla näin ankariin toimiin olivat epäuskoisia ja hämmentyneitä. Tämä lietsoi uusia salaliittoteorioita taudin todellisesta vakavuudesta.

Kiina lähetti Italiaan yhdeksän lääkäriä ja 30 tonnia lääkintävälineitä.

Mutta onko COVID-19 musta joutsen?

Ei. Asiantuntijat ja esimerkiksi Maailman terveysjärjestö WHO on pelännyt jotain tällaista jo vuosia. Varoitukset ovat kaikuneet kuuroille korville. Valtiot rahoittavat mielummin hyökkäys- kuin immuunipuolustuskykyä.

Vain murto-osalla rahasta, joka käytetään sotilasmenoihin, voitaisiin perustaa monikansalliset lääketieteen asiantuntijoista muodostuvat Medical Corps-joukot, eli nopean toiminnan lääketieteellinen valmiusryhmä, joka pystyisi puuttumaan paikan päällä epidemioihin jo niiden varhaisvaiheessa. Näin ideoi Bill Gates 2015. WHO:lla tai YK:lla ei ole tuollaiseen valmiuksia.

Yhdysvalloissa

Johns Hopkins on perustanut COVID-19 tietokannan ja kehittää järjestelmää, jolla tuhat potilasta voidaan testata koronaviruksen varalta päivässä. Useissa maissa tehdyt tutkimukset osoittavat, että oireettomat tartuttajat levittävät koronavirusta huomaamatta. Tähän mennessä on kiinnitetty huomiota oireita osoittaviin potilaisiin (yskä, kuume, hengitysvaikeudet). Nyt on varmistunut, että myös oireettomat voivat kantaa ja levittää koronavirustartuntaa. Maaliskuun ensimmäisenä päivänä Yhdysvaltojen terveysministeri Alex Azar totesi haastattelussa, että oireettomat eivät levitä tartuntaa.

You really need to just focus on the individuals that are symptomatic,” he said. ”It [the containment strategy] really does depend on symptomatic presentation.”

Yhdysvaltojen tartuntatautien virasto (CDC) ei myöskään pidä oireettomia tartunnan saaneita uhkana.

”Some spread might be possible before people show symptoms; there have been reports of this occurring with this new coronavirus, but this is not thought to be the main way the virus spreads,” according to the website.

Viimeisimpien tutkimusten perusteella yhdysvaltalais-asiantuntijat varoittavat, että oireettomat potilaat levittävät tautia paljon luultua enemmän.




Koronapäiväkirja – lauantai 14.3.2020

73. päivä, Ehkä jokaisen sukupolven on kohdattava vakava maailmanlaajuinen kriisi

”Eittämättä tulee mieleen hallituksen analyysi ennen finanssikriisiä vuonna 2008: se ei koske meitä. Todellisuudessa kriisi koski ja rajusti. Yhteiskunta vajosi sitkeään taantumaan – vuosiksi. Tammikuussa Terveyden ja hyvinvoinnin laitoksen THL:n asiantuntijat kertoivat, että koronan leviäminen Suomeen on epätodennäköistä ja kyseessä ei ole erityisen tarttuva virus. Euroopan tartuntatautiviraston suomalaisasiantuntija Pasi Penttinen sanoi 13.2. Ylellä totuuden: tauti ei pysy Kiinan rajojen sisällä, syntyy etäpesäkkeitä ja maailmanlaajuisen pandemian julistaminen on lähellä.” Timo Paunonen /IS

Katsoin eilen Maailman terveysjärjestön (WHO) tiedotustilaisuuden. Yksinkertaisuudessaan viesti oli seuraava: Älkää olko tyhmiä ja luulko, ettei tämä virus kosketa omaa maatanne! Asiantuntijan mukaan huonoin tapa reagoida on olla reagoimatta. WHO kehotti testaamaan, etsimään tartuntoja ja mahdollisuuksien mukaan sosiaalisesti eristäytymään. Ne eivät ratkaise pandemiaa, mutta ne antavat elintärkeää aikaa hidastamalla epidemian leviämistä ja tasoittamalla sairaaloihin kohdistuvaa painetta.

The main outcome of a teleconference with EU health ministers, the European Centre for Disease Prevention and Control (ECDC) and three Commissioners was that social distancing is the most cost-effective measure at least for now and it’s not clear yet for how long. Sarantis Michalopoulos has more.

Suomen hallitus ja viranomaiset päättivät heti aluksi, että tämä epidemia ei leviä Suomeen. Koulujen ja päiväkotien sulkemisen kanssa viivytellään, vaikka viivyttelyä WHO:n asiantuntijat pitivät kaikkein vaarallisimpana.

Suomen naapurimaissa on aloitettu rajut toimet epidemian leviämisen hillitsemiseksi. Paitsi Venäjällä, mutta onko venäjällä koskaan suhtauduttu kansalaisten terveyteen riittävällä vakavuudella. Venäjän tiedotuslinja on Neuvostoliiton ajoista alkaen aina ollut sama: mitään tiedotettavaa ei ole ja kaikki on harasoo. Suomalaisten viranomaisten linja on ollut tähän asti, että mitään hätää ei ole, vaikka koko maailma on paniikissa. Mahtavaa, että suomalaiset viranomaiset ymmärtävät epidemiaa paremmin kuin italialaiset ja kiinalaiset.

Argh. Tätä on hirveä pukea sanoiksi, mutta tuntuu siltä, että vihervasemmiston napanuora DDR:ään ei katkennut, vaikka DDR haudattiin jo 30 vuotta sitten. Tällä hetkellä Kokoomus on ainoa puolue, jonka jäsenet eivät jatkuvasti päästele suustaan sammakoita, ja jonka linja on pääsääntöisesti koherentti ja puolueohjelman mukainen. Muissa puolueissa on enemmän tosiasioiden tunnustamisen vastaisuutta ja ideologista paloa, kuin järkevää politiikkaa.

Suomen virallisena ohjelmana on hallituksen tiedoksiannon mukaan tuottaa ohjeita ja älylaiteäppi. Jumalauta, oikeasti! Ei tähän nyt mitään äppiä tarvita. Nyt pitää valmistautua siihen, että sairaaloiden resurssit ja kapasiteetti loppuvat luultavasti kesken. On mietittävä mihin sairastuneet sijoitetaan ja kuinka heidän hoitonsa järjestetään 7-14 päivän sisällä.

Suomessa on vain noin 250-500 tehohoitopaikkaa, joista osa on jo käytössä. STM hehkutti, että varautuminen Suomessa on hyvä ja teho-osastopaikat riittävät. Riittävät ehkä jossain fantasiamaailmassa, jossa ihmiset voidaan taikasauvaa heilauttamalla taikoa terveiksi. Realiteetit ovat jotain muuta. Se nähdään jo ympäri maailmaa. Myös Italiassa ja Kiinassa uskottiin resurssien riittävän, kunnes paska kaatui niskaan. On parempi varautua pahimpaan skenaarioon, kuin katua myöhemmin tekemättä jääneitä päätöksiä.

Onko paniikkiin aihetta? Ei tämä maailmanloppu ole, mutta monelle tämä on loppu

Jos 1 % sairastuneista suomalaisista tarvitsee tehohoitopaikan, se tarkoittaa melkein 20 000 potilasta, jotka tarvitsevat intensiivistä hoitoa. Tietenkään ihmiset eivät kaikki sairastu kerralla, mutta jos tehohoitovalmius Suomessa on karkeasti 500 potilaalle, se ei riitä. Ihmiset kuolevat sairaaloiden käytäville kuten Kiinassa ja Italiassa. Onko se sitten kivaa? No ei ole. HUS:n alueella uusia tautitapauksia on todettu elisen jälkeen 48 ja koko maassa vähintään 60.

Viranomaisten pitäisi kuunnella, mitä kokeneemmat asiantuntija kertovat Kiinassa ja Italiassa! Suomi ei ole mikään taudin ulottumattomissa oleva lintukoto.Kuka kantaa vastuun siitä, että toimiin ei ryhdytty riittävän ajoissa, vaikka varoituksia on annettu joka suunnasta monen viikon ajan. Nyt myös Yhdysvallat on julistanut poikkeustilan. Aiemmin Trump esti lennot Yhdysvaltoihin Schengen-vyöhykkeeltä Euroopasta.

Viranomaistyö on Suomessa pelottavan tehotonta. Sen tietävät kaikki Kelan asiakkaat. Koronayhteistyö on suomalaista pokeria, jossa hämäläinen hitaus yhdistyy savolaiseen juonikkuuteen; suottaapi olla tai suattaapi olla olematta, mutta katellaan.

En tiedä mitä sillä uskotaan saavutettavan. Tässä nyt ei voita kukaan. Käteen jää Musta Pekka, toimitaan sitten nopeasti tai hitaasti. Harmillista on se, että ajoissa toimimalla inhimillistä kärsimystä ja väistämättömiä kuolemantapauksia voitaisiin ehkä vähentää. Viranomaisten toimintaa määrittelee myös pohjalainen jäyhyys; minähän teen niin kuin haluan, vaikka taivas putoaisi niskaan.

Aika on se, mitä nyt tarvitaan. Rokotetta ja hoitokeinoja kehitetään kiireellä ympäri maailman, ja vaikka koulujen ja päiväkotien sulkeminen ei estä epidemiaa etenemästä, se antaa hieman elintärkeää aikaa. Fakta on se, että virukset leviävät siellä, missä on paljon ihmisiä samassa tilassa. Tämän tietävät kaikki opettajat ja päiväkotitädit. Miksi THL ei tiedä sitä?

Tauti X

”Tautia tavataan lukuisissa maissa ja sitä on vaikea torjua. Tauti X:n kuolleisuus on kausi-influenssaa suurempi mutta leviää samalla tavalla. Se sekoittaa maailman talousmarkkinat jo ennen kuin se julistetaan pandemiaksi.” – WHO varoitti pandemiasta kaksi vuotta sitten.

””Kysymys ei ollut, että vieläkö tulee joku uusi virusepidemia, vaan että milloin se tulee”, Olli Vapalahti

THL:n johtaja Mika Salminen kertoi, että taudin saanee kolmannes tai hieman useampi suomalainen, mutta valtaosalla tauti jää lieväksi. Entä, jos ei jää lieväksi? THL on tähän asti antanut jatkuvasti väärää tietoa ja pieleen menneitä arvioita.

Jos 35 % sairastuu, se tarkoittaa, että 1 934 591 suomalaista sairastuu. Jos 20 % suomalaisista sairastuu vakavasti, vakavan taudin saa 386 918 suomalaista. Muualta maailmalta tulevien tilastojen mukaan vakavasti sairastuneita on karkeasti viidennes potilaista, joten laskelma ei ole tuulesta temmattu.

Vaikka vakavasti sairastuisi vain prosentti sairastuneista, Suomen pitäisi varautua hoitamaan 19 246 vakavasti sairastunutta tulevien kuukausien aikana. Kertokaa kuinka tämä tilanne ratkaistaan koronaäppillä. Voi vittu oikeasti! Lähiviikkoina tarvitaan sairaalavuoteita, lääkkeitä, lääkäreitä, hoitohenkilökuntaa, suojavarusteita ja helvetisti tuuria. Koronaäppi on naurettavin idea ikinä.

Jokaiselle suomalaiselle postitse lähetettävät ohjeet ovat noin 2 kuukautta ja puoli elämää myöhässä. Useimmat suomalaiset tietävät, mikä korona on, kuinka se tarttuu ja minkälaisia oireita on luvassa. Postitse lähetettävät ohjeet on okei, mutta suurta lisäarvoa niistä ei tämän tilanteen ratkaisemisessa ole. Tarvitaan aikaa ja aikaa voidaan taata vain kovilla rajoituksilla. Meidän täytyy huomioida sairaaloiden valmiudet ja kyvyt sekä hoitohenkilökunnalle lankeava raskas taakka.

Keskittykää jumalauta miettimään miten potilaiden hoito järjestetään tulevina kuukausina. Katsokaa Italiaa ja katsokaa Kiinaa! Tilanne on se, että pahimpaan vaihtoehtoon kannattaa varautua, eikä sinisilmäisesti uskoa, että kyllä se mörkö menee piiloon, jos laitan silmät kiinni ja työnnän pään pensaaseen. Italialainen koronaviruksen saanut Angelo Sidonio toteaa:

Be prepared by absorbing as much information as you can. Learn from us. What’s the real problem here, mortality rate? Nope, it’s the possibility of healthcare collapse due to too many cases at the same time. If you can avoid that, then you’re really fine, because rate of survival of people with no pre-existing conditions who end up in intensive care should be decent. Recovery is slow, though, and that’s why available reception capacity is so vital.”

Suurin ongelma ei ole koronaviruksen aiheuttama kuolleisuus, vaan se, että sairaalat ruuhkautuvat. Tästä syystä on tärkeää rajoittaa kaikkia tilanteita, joissa virus leviää ja sulkea päiväkodit ja koulut, vaikka ne eivät epidemiaa lopeta. Hidastamalla taudin etenemistä voidaan estää sairaaloiden ylikuormittuminen.

Sairastuneita on tiettävästi jo 123 maassa

Tanska ja Puola sulkevat rajansa. Kypros estää maahan pääsyn 15 päivän ajan. Ukraina estää ulkomaalaisten maahantulon kahdeksi viikoksi. Ranskassa todettiin perjantaina 800 uutta tartuntaa. Venezuelassa todettiin aamulla ensimmäiset kaksi koronatapausta; talousvaikeuksien kanssa kamppailevan maan presidentti Nicolas Maduro julisti hätätilan. Kolumbia sulki Venezuelan välisen rajan ja estää ihmisten maahantulon Aasiasta ja Euroopasta. Eurooppa on nytpandemian keskus.

Norjalainen Håkon Hapnes Strand kertoo, että Norjan tilanne (yli 500 tartuntaa / miljoonaa ihmistä kohden) on verrannollinen Pohjois-Italian tilanteeseen ja, kuten hän toteaa, ’”aika paha”. Norja on sulkemassa koulut, päiväkodit ja rajat. Hän kertoo, että Norjan talous on vapaassa pudotuksessa, ja että kansalliskaarti ryhtyy valvomaan rajoja. Seuraavat logaritmiset asteikot osoittavat, että taudin eteneminen noudattaa samaa kaavaa Kiinassa, Italiassa, Saksassa ja Yhdysvalloissa. THL ilmeisesti olettaa, että näin kuitenkaan ole Suomessa.

Aasiassa länsimaalaisia varotaan ja vältellään. Thaimaalainen ministeri kutsui valkoihoisia ”farangeja” likaisiksi. Intia ja Vietnam ovat kiristäneet maahantuloa. Vietnamissa valkoihoisten pääsy ravintoloihin, kauppoihin ja toreille voidaan estää.

GnS Economicsin pääekonomisti Tuomas Malinen sanoi perjantaina, että koronaviruspandemia johtaa Suomessa lamaan ja suurtyöttömyyteen. Muut ekonomistit olivat hieman varovaisempia, mutta myös Euroopan komissio varoittaa, että koronavirus ajaa Euroopan suurella todennäköisyydellä taantumaan.

”Talousvaikutusten arvioidaan olevan nyt jo erittäin kovia. Viimeisimpänä Valmet Automotive ilmoittaa aloittavansa Uudenkaupungin autotehtaalla yt-neuvottelut virustilanteen takia. Tilapäinen sopeutustarve koskee kaikkia työntekijöitä, toimihenkilöitä sekä ylempiä toimihenkilöitä. Irtisanomiset eivät kuulu vaihtoehtoisiin henkilöstövaikutuksiin. Sopeutustarve ei koske Salon akkutehdasta.”

**The European Commission said on Friday (13 March) that the coronavirus COVID-19 will “very likely” push the European economy into recession this year, and warned that the rebound next year will depend on a bold response from member states. EURACTIV’s Jorge Valero has the story.

Edes kuuluisuus ei suojaa koronatartunnalta

Koronavirus ei katso varallisuutta, kuuluisuutta tai yhteiskunnallista merkitystä. Kaikki voivat sairastua. Koronavirus on levinnyt jo 123 maahan. Bill Gates varoitti, että koronavirus aiheuttaa pandemian ja voi tappaa jopa 10 miljoonaa ihmistä. Hän on lahjoittanut 100 miljoonaa dollaria epidemian vastaiseen taisteluun. Eräitä sairastuneita tunnettuja henkilöitä.

  • Daniele Rugani (Juventuksen jalkapalloilija)
  • Tom Hanks ja Rita Wilson (Näyttelijät)
  • Rudy Gobert (NBA-koripalloilija)
  • Donovan Mitchell (NBA-koripalloilija)
  • Mikel Arteta (Arsenalin manageri)
  • Callum Hudson-Odoi (Chelsean pelaaja)
  • Paulo Dybala (Juventuksen pelaaja)
  • Fernando Gaviria (kolubialainen pyöräilijä)
  • Dmitry Strakhov (venäläinen pyöräilijä)
  • Janet Broderick (Matthew Broderickin sisko)
  • Sophie Grégoire Trudeau (Kanadan pääministerin vaimo)
  • Nadine Dorries (Britannian terveysministeri)
  • Irene Montero (Espanjan tasa-arvoministeri)
  • Massoumeh Ebtekar (Iranin varapresidentti)
  • Iraj Harirchi (Iranin apulaisterveysministeri)
  • Peter Dutton (Australian sisäasiainministeri)
  • Fabio Wajngarten (Brasilian presidentin apulainen)

Yhdysvalloissa koronavirus leviää jo nopeammin kuin EU:ssa?

USAssa arvioidaan, että 40-70 % väestöstä saa tartunnan. Kaikkein kesyimmissäkin arvioissa luvut ovat hirvittävät. Yhdysvalloissa on 209 miljoonaa aikuista.

209 miljoonaa (aikuiset) x 0,40 (% sairastuneet) x 0,02 (% kuolleisuus) = 1,672 miljoonaa kuolonuhria. Espanjan tautiin kuoli 675 000 amerikkalaista. Jos WHO:n arviot ovat lähimainkaan totta, Yhdysvalloissa menehtyy pahimmassa skenaariossa 5,8 miljoonaa ihmistä.

Yhdysvaltojen reaktiona on tähän mennessä ollut lähinnä Kiinan ja EU:n syyttäminen epidemiasta, mutta varautiminen tautiin USAssa on heikolla tasolla.

Kun Kiinan Wuhanissa ja Hubeissa tartuntojen määrä oli muutama sata, Kiina aloitti rajut toimenpiteet taudin etenemisen pysättämiseksi. Yhdysvalloissa on yli 1500 varmistettua tautitapausta, jotka jakautuvat tasaisesti koko maahan; vasta nyt hallinto on julistanut poikkeustilan.

Koronaepidemia leviää Yhdysvalloissa jo nopeammin kuin Euroopassa, kertoo Johns Hopkins Coronavirus Data Repositoryn tilastot. Pieni ”Trump tick” logaritmisessa asteikossa tarkoittaa, että Yhdysvalloissa on jo nyt 2 x tai 3 x enemmän tartuntatapauksia, kuin olisi odotettavissa. Ks. kuva.

”Trump Tick might look small, but this is because it, too, is on a log scale. That small tick indicates that we have about 2x or 3x more cases than you’d expect at this stage.”

Pale Blue Dot

Nyt, jos koskaan, ihmisten on ymmärrettävä, että olemme samassa veneessä ja se vene vuotaa. Vain yhteistoiminnalla voimme tehdä maailmasta paremman ja turvallisemman, selvitä ilmastonmuutoksesta, liikakansoituksesta ja pandemioista. Kiinalainen lääkäreistä koostuva asiantuntijaryhmä saapui eileen Italiaan auttamaan koronaepidemian hoidossa. Jos hyvin käy, tämä globaali kriisi muuttaa maailmaa parempaan ja tasa-arvoisempaan suuntaan. Toisinkin voi käydä.

Maailmamme on hauraus kalpea piste tyhjyydessä. Kolme vuosikymmentä sitten Voyager-1 kääntyi kuuden miljardin kilometrin päästä katsomaan vielä maapalloa ja otti tunnetun kuvan: Pale Blue Dot. Maapallomme on tuo yksittäinen vaalea pixeli auringonvalossa. Carl Saganin sanoin:

Katso uudelleen tuota pistettä. Se on tässä. Se on koti. Siinä olemme me. Siellä ovat kaikki joita rakastat, kaikki jotka tunnet, kaikki joista olet koskaan kuullut, jokainen ihminen joka on koskaan ollut olemassa ja elänyt elämäänsä. Kaikki ilomme ja kärsimyksemme, tuhannet itsevarmat uskonnot, ideologiat ja talouden doktriinit, jokainen metsästäjä ja keräilijä, jokainen sankari ja pelkuri, jokainen sivilisaation luoja ja tuhoaja, jokainen kuningas ja maanviljelijä, jokainen rakastunut nuoripari, jokainen äiti ja isä, toiveikas lapsi, keksijä ja tutkimusmatkailija, jokainen moraalinvartija, jokainen korruptoitunut poliitikko, jokainen ”supertähti”, jokainen ”ylivaltias”, jokainen pyhimys ja synnintekijä lajimme historiassa on elänyt siellä – pölyhitusella, joka leijuu auringonsäteen varassa.”

An image from Maxar’s WorldView-3 satellite shows the Behesht-e Masoumeh cemetery in Qom, Iran, on March 1, 2020. The cemetery is preparing for the pandemic by digging two long ”trenches” of graves, each about 100 yards (90 meters) long. (Image credit: Satellite image ©2020 Maxar Technologies)




Koronapäiväkirja – perjantai 13.3.2020

En tiedä, onko tämä aiheellista, mutta jälkikäteen voi olla kiinnostavaa tutustua näihin muistiinpanoihin. Aloitan päiväkirjan kirjoittamisen epidemian 72. päivästä. Ainakin luulen, että tämä on 72. päivä, mutta voin olla väärässä. Nämä ovat lähinnä huomioita, tunnelmia ja muistiinpanoja.

Suomessa tartunnan saaneita oli eilen 109 ja tänään aamulla jo 155. Tauti etenee pelottavan nopeasti ja tartunnan saaneiden määrä liääntyy koko ajan. Miten tämä näkyy arjessa? Suomessa tauti on jonkin päivän Norjaa ja Ruotsia jäljessä, mutta Helsingin Sanomien graafin perusteella Suomessa eteneminen on alkuvaiheessa nopeampaa kuin naapurimaissa.

Kävin aamulla kaupassa. Kaupan hyllyt olivat monien tuotteiden osalta tyhjät. Minut kauppaaan kuljettanut taksikuski kertoi, että hänen tulonsa ovat romahtaneet 80-90 % ensin Bernerin taksiuudistuksen ja nyt koronaepidemian vuoksi, Viimeisin isku taksikuskin mukaan oli Eläkeyhtiö Tapiolan sulkeminen koronatartunnan vuoksi. Hän valitteli, että hänen tulonsa eivät enää riitä ruokaan ja laskuihin, vaikka hän istuu autossa päivittäin jopa 15 tuntia. Asiakkaita ei vain ole.

Äitini on tehnyt vapaaehtoistyötä ja osallistunut diakonityönä ravinnon jakamiseen kirkolla. Hän peruutti koronavirusepidemian vuoksi tulevat työvuorot. Kirkolla mm. aamiaistoiminnasta ja mahdollisesti myös ruokakassien jakamisesta joudutaan luopumaan. Tästä kärsii luonnollisesti kaikkein heikoimmassa asemassa olevat ja huonokuntoisimmat ihmiset. Se on tavattoman surullista.

THL:n professori Mika Salminen arvelee, että jopa 35 % suomalaisista voi saada tartunnan. Helsingin ja Uudenmaan sairaanhoitopiiri tiedotti, että HUSin nuorisopsykiatriassa työssä olevalla sairaanhoitajalla on todettu koronavirustartunta 12.3.2020. Tartunnan vuoksi 33 HUS:n työntekijää on altistunut koronavirukselle ja heidät on asetettu karanteeniin.

Veikkaus on päättänyt sulkea peliautomaatit koronaviruksen vuoksi. Helsingin suomalainen yhteiskoulu kehottaa oppilaita jäämään kotiin maanantaista alkaen. Lukiolaisten opiskelu tapahtuu täysin etäopiskeluna. Aurinkomatkat peruu kaikki matkat huhtikuun puoleen väliin asti. NHL, NBA , Englannin valioliiga ja monet muut urheilusarjat on keskeytetty. Juuri tulleen tiedon mukaan myös jääkiekon SM-liiga päättyy välittömästi.

Ulkoministeriö ilmoittaa nettisivuillaan, että nyt ei ole syytä matkustaa ulkomaille. Koska koronavirus on levinnyt maailmanlaajuiseksi pandemiaksi, koronaviruksen saamisen riski on kohonnut ministeriön mukaan koko maailmassa.


Minusta THL:n tiedottaminen ja asenne tuo mieleen entisen itäblokin maiden vähättelevän tiedotuslinjan. Toiminta on piittaamatonta, halutonta, laiskaa ja flegmaattista. Myös hallitus väistelee todellisen vastuun kantoa.

Talousongelmille ei voi nyt mitään. Koko maailma on taloudellisessa syöksykierteessä. Nyt tärkein asia on turvata kansalaisten terveys poikkeustilalaeilla. Toivon, että EU pystyy järkeistämään toimintaa unionin alueella.

Myös Espanjan pääministeri julisti poikkeustilan. Kaikkien rajojen rajatarkastukset ja yli 100 hengen yleisötapahtumien kielto astuivat voimaan.

Tallink lopetti risteilylippujen myynnin Tukholman ja Tallinnan välillä. Viking Line aloittaa yt-neuvottelut matkustajakadon vuoksi. Bussikuskit aloittavat koronan vuoksi työtaistelun Helsingin seudulla. Tampere-talo Oy aloittaa yt-neuvottelut koronan vuoksi.

Viroon julistettiin hätätila. Viro on myös päättänyt sulkea kaikki koulut maanantaista alkaen. Tšekki päätti sulkea rajat täysin. Belgia aloittaa kriisitoimet. Ranskan presidentti Emmanuel Macron ilmoitti eilen torstaina ankarista toimista koronan taltuttamiseksi: näihin kuului mm. koulujen ja päiväkotien sulkeminen.

Brasilian presidentin (Jair Bolsonaron) koronavirustesti antoi positiivisen tuloksen. Miten lienee Donald Trumpin tilanne; hän tapasi  ja kätteli muutama päivä sitten Brasilian presidentin seurueen, jossa oli yksi taudinkantaja (viestintäpäällikkö Fabio Wajngarten). Romanian pääministeri on mahdollisesti saanut tartunnan.

Suomen aikaan perjantain vastaisena yönä uutisoitiin, että Kanadan pääministeri Justin Trudeaun vaimo Sophie Gregoire Trudeau on saanut koronavirustartunnan.

Olen hieman hämmentynyt. Viranomaiset ovat usein toistaneet, että hengityssuojista ei ole mitään hyötyä, mutta kiinalainen tukimus väittää toista. Miksi?

The researchers also found that none of those passengers in the two buses who wore face masks were infected.” Coronavirus can travel twice as far as official ‘safe distance’, study says (9 Mar 2020, scmp.com)

Cina Morning Post kertoo, että virus kulkee ilmassa kaksi kertaa pidemmälle, kuin virallisissa ohjeissa kerrotaan. Suomalaisissa ohjeissa kehotetaan pitämään metrin väli muihin ihmisiin. Monet maat suosittelevat 1-2 metrin turvaväliä.

Kiinalaisen tutkimuksen mukaan tartunnansaaneet voivat tartuttaa ihmisiä 4-5 viiden metrin säteellä. Kiinalaistutkijat kehottavat käyttämään hengityssuojaimia, koska virus selviää pisaratartuntana jopa 30 minuuttia.

Lisäksi kiinalaistutkijat korostavat, että pinnoille pisaroina päässyt virus voi pysyä tartuttavana useita päiviä. 37 asteisessa ympäristössä virus selviää 2-3 päivää. Hunanin provinssissa toimivat tutkijat perustavat näkemyksensä tartunta-aaltoon, joka tapahtui 22. tammikuuta bussissa. Infektiota kantanut matkustaja A nousi täyteen buukatun linja auton toiseksi viimeiselle istuinriville.

Linja-autossa sairastuneet kiinalaistutkijoiden mukaan

Laskennallinen kuolleisuusaste on 3,7 %. WHO arveli, että koronavirus tappaa 3,4 % sairastuneista. Erot maiden välillä ovat huomattavia: Kiinassa sairastuneista on kuollut 3,9 %, Italiassa 6,7 %, Norjassa 0,11 % ja Saksassa 0,19 %

Tartunnat 13.3.2020




Likaista biologiaa & muutama vesiperä

Biologia on likaista. Paperilla matematiikka on puhdasta ja kaunista, mutta jos ihmisen aineenvaihdunnan toiminta määritellään termodynamiikan ensimmäisellä pääsäännöllä muuttujista piittaamatta, johtopäätökset ovat väistämättä harhaanjohtavia. Likaista biologiaa & muutama vesiperä tutustuu painonhallintaan ja terveyteen vaikuttaviin tekijöihin hieman toisesta vinkkelistä.

Olen aiemmissa kirjoituksissani arvioinut, että LCHF-ruokavaliota noudattavia ja suosittelevia lääkäreitä on muutamista kymmenistä satoihin. Olin väärässä. Pelkästään Kanadassa on lähes 4000 naistentautien lääkäriä, jotka suosittelevat potilailleen LCHF-ruokavaliota osana hoitosuosituksia.

Gary Taubesin mukaan koko maailmassa voi olla jo yli 10 000 lääkäriä, jotka toimivat institutionalisoituja lääketieteen dogmeja vastaan suosittelemalla LCHF-ruokavaliota osana lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoitosuunnitelmaa.

Andreas Eenfeldtin Diet Doctor on maailman johtava lääketieteen ammattilaisten ylläpitämä ketogeeniseen ruokavalioon keskittynyt riippumaton verkkosivusto. Monet pidempään ketoilleet tunnistavat Diet Doctorin suunnannäyttäjien joukosta useita henkilöitä. Tämä henkilögalleria esimerkkinä siitä, että maailmalla yhä useammat lääketieteen ammattilaiset ja ravintoterapeutit luottavat tieteeseen ja tutkimukseen enemmän kuin pölyttyneisiin dogmeihin.

Diet Doctor Team

Tieteellinen tieto ei perustu muuttumattomiin dogmeihin

Koska tieteellinen metodologia on itseään korjaava järjestelmä, oletus on, että paremmin ilmiöitä kuvaava havaintojen ja evidenssin tukema malli korvaa huonommin ilmiöitä selittävän mallin. Perinteinen diet-heart hypoteesi on aikansa elänyt. Se on aika kuopata. Myös kaloriteoria kaipaa kipeästi päivittämistä.

Conclusions: Available evidence from randomized controlled trials shows that replacement of saturated fat in the diet with linoleic acid effectively lowers serum cholesterol but does not support the hypothesis that this translates to a lower risk of death from coronary heart disease or all causes. Findings from the Minnesota Coronary Experiment add to growing evidence that incomplete publication has contributed to overestimation of the benefits of replacing saturated fat with vegetable oils rich in linoleic acid.”

Uudet utkimukset eivät tue Ancel Keysin vuosikymmeniä vanhaa hypoteesiä, jonka mukaan tyydyttyneet rasvat ja kolesteroli aiheuttavat ateroskleroosia ja lisäävät kuolleisuutta.

On totta, että tyydyttyneet rasvat lisäävät ja monityydyttämättömät rasvat vähentävät lipoproteiinien määrää veressä. Tutkimusten mukaan kuolleisuus lisääntyy enemmän matalilla kolesterolitasoilla.

Robert Atkins

Palataan historiassa hieman taaksepäin. Robert Atkins ei ollut ensimmäinen ketoilija. Aihetta on käsitelty länsimaisessa lääketietellisessä kirjallisuudessa jo 1700-luvulta lähtien. Paaston ja hiilihydraattien rajoittamisen hyödyt on tunnettu Kiinassa pari vuosituhatta.

Robert Atkins (1930-2003) oli yhdysvaltalainen lääketieteen tohtori, fysiologi ja sydänlääkäri. Perinteisiä ruokavaliosuosituksia noudattanut Atkins kärsi ylipainosta ja masennuksesta. Hän aloitti 33-vuotiaana Alfred W. Penningtonin kehittämän ruokavalion noudattamisen rajoittamalla sokerin ja tärkkelyksen saantia. Vain kuudessa viikossa hänen painonsa putosi 12 kg.

Laihtumisen rohkaisemana hän ryhtyi hoitamaan ylipainoisia potilaitaan samanlaisella ruokavaliolla. Myös potilaiden paino laski ja terveys koheni. Vuonna 1972 Robert Atkins julkaisi maineikkaan laihdutusoppaan: Dr. Atkins’ Diet Revolution: The High Calorie Way to Stay Thin Forever. Vuonna 1992 hän julkaisi toisen kirjansa: Dr. Atkins’ New Diet Revolution, joka toimi lähtölaukauksena vuosituhannen vaihteen jälkeiselle vähähiilihydraattiselle buumille.

On selvää, etteivät terveysviranomaiset ja terveysjärjestöt katsoneet hyvällä Atkinsin oppeja. Hiilihydraattien rajoittamista vastustavat muistavat aina mainita, että Atkins kuoli 125 kiloisena läskinä sydänkohtaukseen, ja että hänellä oli pitkä historia sydänkohtauksia. Tällä urbaanilla legendalla halutaan alleviivata ketogeenisen Atkinsin ruokavalion oletettuja sydänriskejä. tarina on myytti.

Robert Atkins kaatui ja loukkasi päänsä. Sairaalassa hänet punnittiin. Robert Atkins painoi sairaalaan tullessaan 88,5 kiloa. Atkins vaipui sairaalassa koomaan ja sai nesteytystä yhdeksän päivää kestäneen kooman ajan. Sairaalassa Atkinsin paino nousi noin 28 kiloa. Hän siis painoi kuollessaan enemmän kuin sairaalaan saapuessaan. Robert Atkins sairasti kardiomyopatiaa (sydännlihaksen sairaus), jonka todennäköisin aiheuttaja oli infektio. Robert Atkins kuoli kaatumisen aiheuttamaan aivovammaan. Tämä on virallinen lääketieteellinen totuus.

Tutkimusten mukaan Atkinsin dieetti on turvallinen ja tehokas

Vuoden 2000 jälkeen tehdyt tutkimukset ovat osoittaneet, että Atkinsin dieetti on tehokas ruokavalio painonpudotuksessa ja hyödyllinen sydänterveyden riskitekijöiden kannalta. Tutkimukset eivät ole kuitenkaan vakuuttaneet läheskään kaikkia.

Kun sata lääkäriä julkaisi taannoin ketogeenisen ruokavalion terveyshyötyjä painottavan julkilausuman Huffington Postissa, vain muutama viikko myöhemmin ketogeeninen ruokavalio ja Atkinsin dieetti teilattiin mediassa täysin. Kamppailu on ankaraa. Paradigmat kaatuvat väistämättä, mutta väärien tietojen kumoaminen on hidasta.

Miksi ihminen lihoo?

Nykyihminen kehittyi noin 200 000 vuotta sitten. Ravitsemussuositukset otettiin käyttöön Yhdysvalloissa vuonna 1977. Ihmiskunta selvisi ja kehittyi 200 000 vuotta ilman virallisia ohjeita. Kuinka se on mahdollista? Miksi ihminen lihoo, vaikka meillä on vimpan päälle ohjeet oikein syömiseen?

Ihminen kehittyi sekasyöjäksi,koska se oli ainoa tapa selvitä. Ravinto kerättiin luonnosta silloin kun jotain ravintoa oli kerättävissä. Eläimiä saalistettiin ravinnoksi aina kuin se oli mahdollista tai tarpeen. Talvisin saaliseläimet olivat käytännössä varhaisten ihmisten ainoa ravinnonlähde. Tähän kehityshistoriaan nojaa paleodieetin perusta. Ruokaa syötiin silloin, kun sitä oli. Ylimääräisen energian elimistö varastoi rasvasoluihin.

Ihminen lihoo siksi, että evoluutio on mahdollistanut energian varastoimisen rasvasoluihin pahan päivän varalle. Ihminen selviää erinomaisesti ilman ravintoa pitkiäkin aikoja. Miten ihminen lihoo, on kokonaan toinen kysymys, joka liittyy energiansaannin ja kulutuksen tasapainoon sekä noin kymmeneen muuhun muuttujaan.

Luontokappaleet joko varastoivat energiaa tai vaihtolämpöisinä säästävät energian kulutuksessa. Varastoiminen tarkoittaa rasvan keräämistä, koska ravinnon saanti ei aina ollut itsestään selvää.

Lähes kaikki eläimet varastoivat energiaa rasvasoluihin. Lihominen on siis luonnollinen tapa varautua siihen, että ravintoa ei olekaan saatavilla. Rasvasoluihin varastoituu myös rasvaliukoisia vitamiineja.

Kun ihminen ei saa energiaa ravinnosta, elimistössä aktivoituu aineenvaihduntaprosessi, joka purkaa rasvasoluihin varastoituneita triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi verenkiertoon. Vapaiden rasvahappojen karboksyyliryhmät hapetetaan solujen beetaoksidaatiossa asetyylikoentsyymi-A:ksi, jota mitokondriot voivat sitruunahappokierrossa hapettaa energiaksi. Osa asetyylikoentsyymi-A:sta voidaan edelleen muuttaa solujen energiaksi kelpaaviksi ketoaineiksi. Maksa muuttaa ketogeneesissä vapaita rasvahappoja ketoaineiksi, kuten betahydroksibutyraatiksi.

Vapaita aminohappoja, sitruunahappokierron välituotteita, ketoaineita, vettä ja glyserolia voidaan muuttaa glukoosiksi glukoneogeneesissä. Veren punasolut tarvitsevat välttämättä glukoosia, jonka keho osaa itse valmistaa. Aiempien oletusten mukaan aivojen solut eivät ole riippuvaisia glukoosin saannista.

Evoluutio on varmistanut näin sen, että me emme kuole nälkään, jos emme saa heti ruokaa. Terve ihminen voi paastota pelkällä vedellä jopa 30 vuorokautta ja pysyä terveenä ja toimintakykyisenä.

Maailman pisimpään paastosi skotlantilainen Angus Barbieri, joka paastosi veden ja vitamiinipillereiden avulla kokonaista 382 vuorokautta. Paaston aikana hänen painonsa putosi 125 kiloa. Tapaus on hyvin dokumentoitu ja mainitaan mm. Guinnesin ennätysten kirjassa.

Angus Barbieri
Lähde: Wikipedia

Lämpöopin ensimmäinen pääsääntö

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Ongelma on se, että monimutkaiset asiat halutaan yksinkertaistaa. Lihomisen selittäminen energian säilymisellä tarkoittaa sitä, että viivat vedetään suoriksi ja kaikki häiritsevät taustavaikuttajat pyyhitään yhtälöstä.

Tutkiva journalismi on lähestulkoon haudattu. Uutiset julkaistaan sen tarkemmin asioihin paneutumaatta. Monet journalistit käytännössä vain kääntävät uutistoimistojen uutisia ymmärtämättä uutisen aiheesta juuri mitään. Se on valitettavaa, mutta totta.

Kalorioppi toimii periaatteessa hyvin paperilla. Ikävä tieteellinen fakta on, että rumat tosiasiat pilaavat kauniit teoriat. Biologia on likaista. En tarkoita saastaista, vaan tarkoitan, että kaikkien yhtälöön vaikuttavien tekijöiden laskeminen ja mallintaminen jokaiseen ihmiseen päteväksi universaaliksi lainalaisuudeksi on mahdotonta.

Biologia on likaista, koska aineenvaihdunnasta ei voi vetää universaaleja lakeja. Se sisältää liikaa rumia tosiasioita, jotka pilaavat kauniin teorian.

Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biokemiallinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan mekanismeja.

Kalorioppi

Kalori on vanha energian mittayksikkö. Se tarkoittaa lämpömäärää, joka kasvattaa yhden 14,5 asteisen vesigramman lämpötilaa assteella normaalipaineessa. Ravinnosta puhuttaessa pitäisi puhua kilokaloreista.

Tohtorit Newburg ja Johnston esittivät vuonna 1930 hypoteesin, jonka mukaan lihavuus johtuu kalorein mitattuna liian rusaasta ravinnosta, eikä aineenvaihdunnan häiriöstä. Tutkimusaineisto oli niukka, mutta kaloriteoria otettiin vastaan kumoamattomana tieteellisenä faktana.

Montignacin kritiikki kaloriteoriaa vastaan

Ranskalaisen Michel Montignacin periaate on seuraava: ”Lihominen ei johdu liiasta syömisestä vaan huonosta syömisestä.”

Montignacin mukaan kalorien vähentämiseen perustuva laihdutusteoria on 20. vuosisadan suurin ”tieteellinen ankka”. ”Se on ansa, huiputus, hölmö ja vaarallinen olettamus, jolla ei ole mitään tieteellistä perustaa. Ja kuitenkin se on ohjannut ravitsemuskäyttäymistämme yli puolen vuosisadan ajan.”

Montignac selvittää painon kertymisen logiikan seuraavasti: Olettakaamme, että yksilön päivittäinen tarve on 2500 kcal ja hänen saamansa kalorimäärä on pitkän ajan vastannut tätä tarvetta. Mikäli päivittäinen kaloriannos putoaa äkkiä 2000 kcal:iin, seurauksena on todellakin vastaavan vararasvamäärän käyttö ja toteamme painon pudonneen.

Jos päivittäinen kalorimäärä sen sijaan vakiintuu 2000:ksi aiemman 2500:n sijasta, elimistön eloonjäämisvaisto mukauttaa energiatarpeen nopeasti uudelle tasolle. Koska ihmiselle annetaan vain 2000 kcal, hän kuluttaa vain 2000 kcal. Painonmenetys keskeytyy nopeasti. Mutta elimistö ei jää tähän. Itsesäilytysvaisto houkuttelee sen entistä suurempaan varovaisuuteen. Ja tämä varovaisuus johtaa uusien varastojen muodostamiseen. Mikäpä siinä, jos sille annetaan vain 2000 kcal, se vähentää energiantarvettaan entisestään ja kuluttaa esimerkiksi vain 1700 kcal ja tallettaa ylimääräiset 300 kcal vararasvoiksi.

Montignacin mukaan vararasvojen muodostuminen tai muodostumatta jääminen on suoraan riippuvainen insuliinin erityksestä. Insuliinin eritys käynnistyy aina silloin kun veren sokeripitoisuus on nousemassa liian korkeaksi. Sen tehtävänä on auttaa veren glukoosin imeytymistä elimistön kudoksiin. Tarjolla oleva glukoosi käytetään joko tyydyttämään kehon välitöntä energiantarvetta tai, mikäli sitä esiintyy runsaasti, vararasvojen muodostamiseen. (1)
Ajatus, että jokaisen ihmisen biokemiallinen kone noudattaa täsmälleen samalla tavalla termodynamiikan ensimmäistä pääsääntöä, on yhtä hölmö, kuin väite, että kaikkien autojen bensiininkulutus on täsmälleen sama.

Termodynamiikan ensimmäinen pääsääntö:

  • Energiaa ei voida hävittää, se vain muuttaa muotoaan.
  • Termodynaamiseen systeemiin voidaan tuoda energiaa kahdessa eri muodossa työnä W ja lämpönä Q.
  • Tuotu energia muuttuu systeemin sisäenergiaksi U.
  • Sisäenergian muutos on siis systeemiin tuodun energian määrä:

ΔU=Q+W

  • Sisäenergian muutos ilmenee muutoksena systeemin lämpötilassa, paineessa, tilavuudessa tai olomuodossa.
  • Systeemistä voi myös lähteä energiaa. Tällöin systeemi, joko luovuttaa lämpömäärän -Q tai tekee ympäristölle työn -W. Huomaa miinus merkki energian lähtiessä systeemistä.

Syötyjen ja kulutettujen kaloreiden laskeminen on käytännössä mahdotonta. Erilaiset laskurit ja laskentakaavat helpottavat seurantaa, mutta nekin antavat epätäsmällisiä osatotuuksia.

Tietenkin ihminen laihtuu, jos syödyn energian määrä on vähäisempi kuin kulutetun energian määrä, mutta jos aineenvaihdunta toimii normaalisti, se purkaa energianpuutteessa mm. lihasten proteiineja polttoaineeksi. Äärimmäisellä rasvoja rajoittavalla ruokavaliolla ihminen voi ”syödä” omat lihaksensa. (1)

Kaikki laihduttajat tietävät, että laihduttaminen on vaikeampaa kuin lihominen. Meidät on ehdollistettu syömään 4-6 kertaa päivässä (mukaanlukien välipalat), että verensokerimme pysyy tasaisena.

Koska ravintomme koostuu pääasiassa sokereista, verensokerin ja insuliinipitoisuuden vaihtelut aiheuttavat energiapiikkejä ja energiatason nopeita laskuja. Tämä pitää meidät nälkäisinä ympäri vuorokauden. Jatkuvaa nälkää kompensoidaan välipalapatukoilla, pullakahveilla, välipaloilla, snackseillä, virvoitusjuomilla jne.

Tämä aiheuttaa toisaalta kokonaisenergian huomaamattoman kasvun, mutta tärkeämpää on se, kuinka ruoka vaikuttaa verensokeriin ja insuliiniin.

Miksi insuliini on tärkeää?

Kuvaparissa tyypin 1 diabetesta sairastava potilas ennen ja jälkeen insuliinihoidon. Kun haima lopettaa insuliinintuotannon, aineenvaihdunta ei voi käyttää syötyä ravintoa polttoaineena, joten se turvaa välttämättömien elintoimintojen jatkuvuuden purkamalla lihaksiin, maksaan ja rasvakudokseen varastoitua energiaa solujen polttoaineeksi.

Ennen insuliinilääkitystä tyypin 1 diabeetikot nääntyivät nälkään riippumatta siitä, kuinka paljon he söivät.

Haiman beetasolut erittävät vereen insuliinia kahdella mekanismilla.

  1. Ensinnäkin syöminen signaloi aivoille, että elimistö saa ravintoa. Tällöin hypotalamus signaloi haimalle, että ruokaa olisi pian tulossa, joten eritäpä sitä insuliinia vereen.Syöminen vaikuttaa insuliinin eritykseen makuaisti-hypotalamas-haima reitillä. Hypotalamuksen säätelemään insuliinin eritykseen vaikuttaa ainakin makuaisti. (1, 2).
  2. Veren glukoosipitoisuuden kasvu vaikuttaa haiman insuliinin eritykseen suoraan. Haiman Langerhansin saarekkeiden beetasolut aistivat verensokerin muutoksia ja pystyvät autonomisesti säätelemään verensokeria.Verensokerin noustessa haiman beetasolut erittävät vereen insuliinia, joka siivoaa glukoosin (ja muut ravinteet) verestä soluihin. Verensokerin laskiessa haiman alfasolut erittävät vereen glukagonia, joka aktivoi lihaksiin ja maksaan varastoitujen glykogeenien purkamisen glukoosimolekyyleiksi.

Insuliinin merkitystä painonhallinnalle ja terveydelle ei voi vähätellä.

  1. Insuliini on elintärkeä hormoni, jota ilman me kuolisimme.
  2. Insuliini vaikuttaa glukoosin ja muiden ravintoaineiden soluunottoon, glykolyysiin, glykogeenien synteesiin, proteiinien synteesiin sekä elektroninsiirtoketjun toimintaan.
  3. Insuliini estää glukoosia tuottavan glukoneogeneesin käynnistymisen, maksan ja lihasten sokerivarastoja purkavan glykogenolyysin, rasvahappoja purkavan lipolyysin, proteolyysin ja ketogeneesin.

Insuliinin toiminta

Insuliini on energia-aineenvaihdunnan tarvitsema elintärkeä hormoni. Se toimii kuin liikennevalvoja, joka ohjaa solujen energia-aineenvaihduntaa ja energian varastointia.

Solujen energiakylläisyyden perusteella solujen insuliinireseptoreihin kiinnittyneet insuliinimolekyylit päästävät ravintoaineita soluihin, jotka tarvitsevat energiaa ja/tai soluihin, joissa on tilaa varastoida energiaa.

Soluun kiinnittynyt insuliinimolekyyli näyttää glukoosi- ja rasvamolekyyleille vihreää valoa; tänne mahtuu.

Insuliini on porttivahti, joka avaa solut vain yhteen suuntaan: sisälle. Glukagoni insuliinin vastavaikuttajana puolestaan toimii solusta ulos periaatteella ja purkaa mm. glykogeeneihin varastoituneita sokereita verenkiertoon.

Veressä on aina insuliinia, mutta, kun insuliinipitoisuus laskee riittävästi, haima erittää glukagonia,joka purkaa energiavarastoja. Kun maksan ja lihasten sokerivarastot on kulutettu, verenkiertoon erittyy lipolyyttisiä hormoneja (adrenaliini, noradrenaliini, kortikotropiini ja glukagoni), jotka käynnistävät rasvasolujen purkamisen. Insuliini estää rasvasolujen purkamista, eli lipolyysiä. Jos verensokeri on jatkuvasti korkea ja veressä on paljon insuliinia, rasvasolujen purkaminen energiakäyttöön estyy.

Insuliiniresistenssi ja hyperinsulinemia

Jos haiman kyky tuottaa insuliinia loppuu, kuten tyypin 1 diabeteksessa tapahtuu, ravintoaineet eivät pääse verestä soluihin. Insuliinin puutteessa energian tuotanto loppuu ja ihminen nääntyy nälkään, vaikka söisi koko ajan. Tyypin 2 diabeteksessa haima tuottaa alkuun jopa normaalia enemmän insuliinia, mutta solujen insuliiniherkkyyden heikentyminen johtaa siihen, että veressä on liikaa insuliinia (hyperinsulinemia).

Insuliiniresistenssi ja hyperinsulinemia assosioituvat kaikkiin yleisimpiin kroonisiin sairauksiin. Tätä ei vielä tiedetty viime vuosisadan puolivälissä, mutta tieto lisääntyy ja se korjaa vanhoja käsityksiä.

Useimpien sairauksien taustalla on aineenvaihdunnan toimintahäiriö ja tämän aiheuttamat komplikaatiot. Lihavuus on lähes aina oire siitä, että aineenvaihdunnan toiminta on häiriintynyt. Nykyisin on tapana syyllistää ja leimata lihavia, mutta se on väärin. Lihavuus on oire, ei syy.

Hyperinsulinemiaan assosioituvat mm. Alzheimerin ja Parkinsonin taudit, tyypin 2 diabetes, alkoholista riippumaton rasvamaksa, haavainen paksusuolentulehdus, krooninen inflammaatio, lihavuus, ateroskleroosi, kardiomyopatia, sydänhalvaukset ja verenpaine. Edelliset kuvankaappaukset Catherine Kroftsin videolta.

Insuliini rakentaa lihas- ja rasvakudosta

Insuliini vaikuttaa myös anabolisiin aineenvaihduntatapahtumiin, kuten energian varastoimiseen lihasten ja maksan glykogeeneihin ja rasvasoluihin sekä esimerkiksi lihaskudosta rakentavaan proteiinisynteesiin. Tämä on äärimmäisen tärkeää.

Kun verenkierrossa on liikaa energiaravinteita (glukoosia ja rasvaa), ravintoaineet ohjataan ensin soluihin, jotka tarvitsevat energiaa. Ylimääräinen glukoosi varastoidaan ensimmäiseksi maksan ja lihasten sokerivarastoihin (glykogeenit), johon mahtuu keskimäärin 250-500 grammaa sokeria ihmisen lihaskunnosta riippuen.

Glukoosi, joka ei mahdu glykogeeneihin, varastoidaan rasvasoluihin. Myös ylimääräinen rasva ohjataan rasvasoluihin. Insuliinilla on keskeinen rooli energiaravinteiden ohjaamisessa soluihin. Solut käyttävät energian lähteenä joko rasvaa tai glukoosia. Solu ei voi samanaikaisesti sekä polttaa, että varastoida energiaa. Niin ei vain tapahdu. Tämä on periaatteessa perinteisen kaloriopin mukainen mekanismi.

Kiinnostavaksi tilanne muuttuu, kun likainen biologia kumoaa perinteisen mallin. Jos ja kun veressä on liikaa sokeria (hyperglykemia) ja insuliinia (hyperinsulinemia), sokeri voidaan varastoida vain rasvasoluihin, jossa glukoosi muutetaan lipogeneesissä triglyserideiksi. Jatkuvasti koholla oleva insuliini johtaa solujen insuliiniresistenssiin, minkä seurauksena insuliinin kyky siivota verestä ravintoaineet soluihin heikkenee. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, joten insuliini ohjaa yhä enemmän ravintoa verenkierrosta rasvasoluihin samalla, kun insuliiniresistenttien lihassolujen energiansaanti vähenee. Tämän seurauksena ihminen alkaa lihoa.

Insuliiniresistentti varastoi enemmän energiaa rasvasoluihn

Mitä tämä käytännössä tarkoittaa? Se tarkoittaa sitä, että samasta syödystä energiamäärästä insuliini varastoi suhteessa suuremman osan rasvakudokseen, koska ravintoa energiaksi polttavien lihassolujen kyky vastaanottaa energiaa on heikentynyt. Insuliiniresistentin ihmisen lihominen voi alkaa, vaikka kilokalorimääräisesti energiansaanti pysyisi aiemmalla tasolla. Insuliiniresistenssi vaikuttaa lihomiseen satunnaista ylensyöntiä enemmän.

Veressä on aina hieman insuliinia. Proteiinit ja rasvat lisäävät insuliinin eritystä, koska energia-aineenvaihdunta loppuu ja ihminen nääntyy nälkään, jos insuliinia ei ole saatavilla. Glukoosi kohottaa insuliinitasoja tuplasti enemmän kuin proteiini ja moninkertaisesti enemmän kuin rasva. Liikaa hiilihydraatteja sisältävä ravinto pitää verensokerin liian korkealla, jolloin insuliinin eritys lisääntyy ja vähitellen jatkuvasti koholla olevat verensokeri ja insuliini alkavat vaikuttaa negatiivisesti aineenvaihdunnan toimintaan. Tämä ennakoi insuliiniresistenssia, joka on useimpien kardiometabolisten sairauksien tärkein aiheuttaja.

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biologinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan jänniä mekanismeja.

Se, että eräät konservatiiviset ja institutionalisoituneet tieteestä piittaamattomat ravitsemusneuvojat väittävät, ettei hormoneilla, kuten insuliinilla ole suurtakaan merkitystä painon kannalta, on raivostuttavaa paskapuhetta.

Yksinkertaisesti: keho ei voi varastoida sokereita tai läskiä ilman insuliinin välittävää vaikutusta.

Etanolin aineenvaihdunta

Entä, jos laitamme energian tilalle alkoholin? Termodynamiikan ensimmäisen pääsäännön mukaan juodun alkoholin pitäisi poistua kehosta, koska muuten ylimääräinen alkohli varastoituisi elimistöön alkoholina tai läskinä.

Aineenvaihdunta polttaa juotua alkoholia muiksi aineiksi. Myös ravinnon sisältämä energia muuttuu aineenvaihdunnassa. Ravinto ei ole pelkkää energiaa.

Lämpöoppi toimii, mutta siinä on huomioitava myös yhtälöön vaikuttavat lukemattomat muuttujat, koska muuten siihen ei voi luottaa.
Etanoli on luonnosta ja alkoholijuomista löytyvä alkoholi, joka metaboloituu monimutkaisella katabolisella aineenvaihduntareitillä. Useat entsyymit osallistuvat etanolin prosessointiin ensin asetaldehydiksi ja edelleen etikkahapoksi ja asetyylikoentsyymi-A:ksi.

Kun asetyylikoentsyymi-A on muodostunut, siitä tulee sitruunahappokierron substraatti, joka hapetetaan solujen mitokondrioissa energiaksi. Sitruunahappokierron jäännöstuotteina on vettä ja hiilidioksidia.

Entsyymien esiintymisessä ja saatavuudessa olevien erojen vuoksi eri ikäiset ihmiset käsittelevät etanolia eri aineenvaihduntareiteillä. Maksa on tärkein etanolin aineenvaihduntaan osallistuva elin, koska maksassa esiintyy korkeina pitoisuuksina etanolin aineenvaihdunnan tarvitsemia entsyymeitä.

Ruoansulatusjärjestelmä tuottaa noin 3 g etanolia päivässä fermentoimalla ravintoa. Etanolin katabolinen hajoaminen on välttämätöntä paitsi ihmisten, myös kaikkien tunnettujen organismien, elämälle.

Eräät etanolin aineenvaihduntaan liittyvien entsyymien aminohapposekvenssit eivät ole muuttuneet 3,5 miljardiin vuoteen. Kaikki organismit tuottavat alkoholia pieninä määrinä useilla aineenvaihduntareiteillä.

Etanolia syntyy pääasiassa rasvahappojen synteesin, glyserolipidimetabolian, ja sappihapon biosynteesireittien kautta. Jos keholla ei olisi mekanismia alkoholien katabolisoimiseksi, alkoholit kumuloituisivat elimistöön ja muuttuisivat myrkyllisiksi.

Ehkä tämän vuoksi evoluutio on kehittänyt keinon katabolisoida etanolia myös sulfotransferaasin avulla. Sulfotransferaasit sulfonoivat serebrosideja sulfatideiksi. Serebrosidit ovat sfingolipideihin kuuluvia glykolipidejä, jotka vaikuttavat mm. hermokudoksessa.

Serebrosidien rakenne koostuu sfingosiinistä, rasvahappo-osasta ja glukoosista tai galaktoosista. Galaktooseja sisältäviä serebrosideja esiintyy erityisesti myeliinistä. No niin. Pitikö se viina vetää tähänkin juttuun? Ohessa etanolin aineenvaihduntareitti

Kuvankaappaus: Wikipedia

Kuinka etanolin aineenvaihdunta liittyy termodynamiikan ensimmäiseen pääsääntöön?Aineenvaihdunta muuttaa etanolin energiaksi, mutta ei varastoi etanolia soluihin alkoholina. Itse asiassa aineenvaihdunta ei edes osaa muuttaa etanolia läskiksi.

Lihottaako alkoholi ja miten se lihottaa?

Alkoholi sisältää noin 7 kcal/g energiaa. Puhtaassa etanolissa on enemmän energiaa kuin sokerissa ja melkein saman verran kuin rasvassa.

Alkoholi voi vaikuttaa lihomiseen ja rasvoittaa maksaa, mutta ei sen vuoksi, että laskennallisesti etanolissa on paljon energiaa. Lihomiseen ja maksan rasvoittumiseen vaikuttavat ne muuttujat, jotka sotkevat puhtaan termodynamiikan ensimmäisen pääsäännön kauniin yhtälön likaisella biologialla.

Mitä alkoholille tapahtuu? Kun ihminen juo alkoholia, maksa paiskii ylitöitä. Entsyymi nimeltä Alkoholidehydrogenaasi (ADH) hapettaa alkoholin asetaldehydiksi. Alkoholia palaa noin 0,1 g/painokilo/h, eli 70-kiloinen henkilö polttaa 7 grammaa alkoholia tunnissa.

Aldehydidehydrogenaasi metaboloi asetaldehydistä edelleen asetaattia. Asyyli-CoA syntaasi (ACSS2) ja asetyyli-CoA syntaasi (ACSS1) syntetisoivat asetaatista asetyylikoentsyymi-A:ta. Kun asetyylikoentsyymi-A on muodostunut, se siirtyy mitokondrioiden sitruunahappokiertoon, jossa siitä hapetetaan energiaa ja jäännöstuotteena on vettä ja hiilidioksidia. Kaikki energiaa tuottavat ravinteet muuttuvat aineenvaihdunnassa asetyylikoentsyymi-A:ksi, joka poltetaan vedeksi ja hiilidioksidiksi.

Alkoholin sisältämät sokerit lihottavat, alkoholi hidastaa rasvan palamista ja kasvattaa ruokahalua. Jos alkoholin yhteydessä syö energiatiheää ruokaa, alkoholi lisää ravinnon sisältämän rasvan ja hiilihydraattien varastoimista mm. maksaan. Puhdas alkoholi ei muutu elimistössä läskiksi. Se on sitä likaista biologiaa, joka ei sovi yhteen termodynamiikan ensimmäisen pääsäännön kanssa. Eräs alkoliin liittyvä kiinnostava huomio on se, että alkoholi itse asiassa parantaa solujen insuliinisensitiivisyyttä.

Runsaan alkoholin nauttimisen seurauksena veren alkoholipitoisuus pysyy korkeana kunnes maksa on prosessoinut kaiken alkoholin asetaldehydiksi, astetaatiksi ja asetyylikoentsyymi-A:ksi, joka hapetetaan sitruunahappokierrossa energiaksi. Jo tämä itsessään todistaa, että keho ei osaa muuttaa alkoholia läskiksi. Elimistö metabolisoi alkoholin ennen muita ravinteita. Jos ihminen syö, kun veressä on alkoholia, syöty ravinto muutetaan energiaksi tai varastoidaan vasta alkoholin palamisen jälkeen. Tämä voi lihottaa.

Aineenvaihdunta on siitä merkillinen biokemiallinen järjestelmä, että rasvat eivät aina varastoidu läskinä, mutta hiilihydraatit joudutaan joskus muuttamaan läskiksi.

Energiaravinteet: rasvat, hiilihydraatit ja proteiinit seuraavat kukin omia kemiallisia aineenvaihduntareittejään. Niillä on elimistössä muitakin tehtäviä kuin energian tuottaminen.

Alkoholiesimerkin takoituksena oli havainnollistaa, että aineenvaihdunnan kannalta tapahtumat eivät ole yksinkertaisesti sisään-ulos-tapahtumia, vaan paljon paljon monimutkaisempia reaktioketjuja, joihin vaikuttavat mm. geenit, sukupuoli, ikä ja hormonit.

Me tiesimme tämän aina, mutta emme ymmärtäneet. Alkoholin aiheuttama humalatila jatkuu, kunnes maksa on polttanut kaiken alkoholin verestä. Alkoholin sisältämä energia (kalorit) palaa, mutta ei varastoidu.

Lihava ihminen – Homo Corpulentus

Lihomiseen vaikuttaa ravinnon sisältämän energian lisäksi mm. ympäristö, geenit, hormonit, sukupuoli,ikä, suolistoflooran koostumus, stressi, unen määrä ja laatu, sekä ruumiinrakenne, eli kehon rasva- ja lihaskudoksen suhde. Näillä kaikilla on huomattava merkitys siihen, kuinka elimistö käyttää ravinnosta saatuja kaloreita, ja kuinka ihminen lihoo. Lihomiseen vaikuttavia tekijöitä kutsutaan obesogeneettiseksi potentiaaliksi.

Yleisesti ottaen aineenvaihdunta varastoi energiaa silloin kun energiansaanti ylittää kulutuksen. Tämä on selvää, mutta tutkimuksista tiedetään, että samaa ruokaa saman verran syövien ihmisten aineenvaihdunnan tapa käsitellä ravinnosta saatua energiaa poikkeaa toisistaan.

Tämä on osoitettu mm. identtisillä kaksosilla, jotka ovat syöneet laskennallisesti saman verran energiaa, mutta toinen on pysynyt hoikkana ja toinen lihonut. Kuinka se on mahdollista? Identtisillä kaksosilla on havaittu suoliston mikrobiomin vaikutus energia-aineenvaihduntaan. Lajistoltaan runsaampi mikrobiomi on yhteydessä tehokkaamaan aineenvaihduntaan ja energian kulutukseen, kun lajistoltaan köyhempi mikrobiomi assosioituu lihomiseen.

Ravinnolla on lihomisen kannalta merkittävä rooli, mutta jopa 70 % kehonpainoon vaikuttavista muuttujista johtuu geneettisistä tekijöistä, kertoi Professori Alfredo Martinez (Center of Nutrition Research at the University of Navarra, Pamplona, Espanja) Nature Reviews Disease Primers-lehdelle.

Melanokortiini 4 reseptori -geenimuutos näyttää liittyvän lihavilla ihmisillä selvästi ahmimishäiriöön. Sveitsiläistutkijat totesivat, että kaikki tätä geenimuutosta kantavat erittäin lihavat potilaat kärsivät ahmimishäiriöstä. Melanokortiini 4 reseptorin geenimuutosta on kahden tuoreen tutkimuksen mukaan runsaalla viidellä prosentilla lihavista ihmisistä. Geenimuunnos vaikuttaa ruokahalun sääntelyyn aivojen hypotalamuksessa.”Duodecim

Lihomisalttiuteen vaikuttavia geenimuutoksia on löydetty 118. Yksittäinen muutos ei kasvata lihomisen riskiä merkittävästi, mutta ihmisillä, joilla on useita lihomisalttiuteen vaikuttavia geenimuutoksia, on vahva taipumus lihomiseen kaloreista ja liikunnan määrästä riippumatta. Esimerkiksi ankyrin-B geenin muutokset lisäävät glukoosin kulkua rasvasoluihin.

Myös äidin paino vaikuttaa raskauden ja imetyksen aikana lapsen kehitykseen. Professori Martinezin mukaan raskaudenaikainen lihominen ensimmäisten 20 raskausviikon aikana lisää syntyvän lapsen ylipainoisuuden riskiä. Ilmiö palautuu sikiöaikaiseen aineenvaihduntaan, joka vaikuttaa pysyvästi lapsen geeneihin.

Toisaalta äidin imetyksen aikainen ravinto voi aiheuttaa vastaavanlaisia epigeneettisiä muutoksia lapsen insuliininsäätelyä ohjaavissa geeneissä ja altistaa lapsen myöhemmin elämässä insuliiniherkkyyden alenemiselle ja insuliiniresistenssille, kertoo professori Mark H. Vickers (Liggins Institute at the University of Auckland, New Zealand) Frontiers in Endocinology-lehdessä.

Kolesteroli

Yritän kirjoittaa kolesterolista oman tutkielman, koska aihe on äärimmäisen laaja ja monimutkainen.

Ei ole olemassa hyvää tai pahaa kolesterolia. On vain kolesterolia. Jos kolesterolimolekyyliä muutetaan yhdelläkin atomilla puoleen tai toiseen, se ei enää ole kolesterolia.

LDL, HDL ja kylomikronit (yms.) ovat rasvaa, kolesterolia ja vitamiineja kuljettavia lipoproteiineja. Sellaisina ne ovat aivan välttämättömiä rasva-aineenvaihdunnan normaalille toiminnalle. Se, että lipoproteiineja kutsutaan kolesteroliksi on hyvin harhaanjohtavaa.

Kolesterolisynteesi tuottaa kolesterolia, joka on mm. steroidihormonien, kuten estrogeenin, testosteronin ja D-vitamiinin synteesin välttämätön lähtöaine. Ruoansulatusnesteet tarvitsevat kolesterolia, aivot tarvitsevat kolesterolia, hermoratoja suojaavissa myeliinikalvoissa on kolesterolia ja solut tarvitsevat kolesterolia solukalvoihin. Joka päivä uusiutuu noin 200 grammaa soluja, joiden solukalvojen yksi rakennusaine on kolesteroli. Ihmisen kolesterolista 25 % on aivoissa, ja ravinto ei lisää kokonaiskolesterolia juuri lainkaan. Elimistö tuottaa sen verran kolesterolia kuin se tarvitsee.

Esimerkiksi suomalaisen väitöstutkimuksen mukaan naisten kuolleisuus lähtee kasvuun, jos kokonaiskolesteroli laskee neljään tai sen alle. Mutta tutustutaan kolesteroliin toisessa artikkelissa.

Inspiraation ja tiedon lähteitä

Gary Taubes

Robert Lustig

Paul Mason

Catherine Crofts

Nina Teicholz

Andreas Eenfeldt

Jason Fung

Georgia Erde

Benjamin Bikaman

Stephen Phinney

Darius Mozaffarian
Tim Noakes

David Unwin

Jeffry Gerber

Ted Naiman

Ivor Cummins

Dave Feldman




Taivaan ilossa tavataan?

Taivaan ilossa tavataan, vai tavataanko? Minut on kutsuttu rakkauden juhliin, mutta koska Herra on ollut koko ajan hyvin hiljaa, ajattelin jättää nämä bileet väliin. Haitanneeko tuo, jos jätän osallistumatta tähän maailmanloppuun? Minulla on tärkeämpääkin tekemistä, kuin kuolla koronaan.

Kunpa Jeesus pian tulisi ja loppuisi tämän maailman kärsimys

Tällaisia COVID-19-epidemian herättämiä toiveita olen viimeaikoina lukenut suomalaisilla ja ulkomaisilla keskustelupalstoilla. Monet rakkaudesta ja armosta saarnaavat haaveilevat Jeesuksen toisesta tulemisesta, armollisesta maailmanlopusta ja synnit puhtaaksi polttavasta tulesta.

Minä sanon teille rakkauden apostoleille ja tuomiopäivän trumpetisteille, että vaikka pasuunat ja vasket soisivat kuinka kauniisti, ei meillä ole mikään kiire tuonpuoleiseen. Kyllä täällä on vielä niin paljon tehtävää, nähtävää ja opittavaa, että en kiireiltäni ehdi seuraavaan ylöstempaisuun.

Älkää huolestuko. Te pääsette sinne Taivaan iloon, kun maltatte vain mielenne. Kaikki kuolevat ennemmin tai myöhemmin. Kaikkien ei kuitenkaan tarvitse kuolla yhdessä rykäyksessä, vai tarvitseeko? Onko Jumalalla johonkin kiire? Koitetaan nyt vain jotenkin selvitä tästä pandemiasta.

Tuomiopäivän trumpetistit ja viimeisten päivien vihaiset pasunistit voivat Taivaan ilossa pohtia elämän ja kuoleman kysymyksiä stressaamatta maahanmuutosta, seksuaalisisten vähemmistöjen sänkyleikeistä tai muistakaan Iisebelin hirvityksistä.

Aika ei ole ongelma Paratiisissa. Taivaan riemussa on kokonainen ikuisuus aikaa miettiä, miksi rajallinen elämä on niin vaikeaa ja miksi iankaikkinen elämä on paljon helpompaa.

Kun te rakkauden apostolit viimeisenä päivänä saavutte kultaisten porttien kautta taivaan riemuun ja Paratiisin poikkipolulla avaatte hihitellen raskaan vaskisen kaivonkannen, joka johtaa syvyyteen ja pimeyteen, tuohon rikinkatkuiseen sielujen viemäriin, jossa me uskottomat hereetikot ja armosta piittaamattomat paskiaiset palamme kirkkaalla ja kivuliaalla liekillä aina ja iankaikkisesti syntejämme katuen, matojen vetistämin silmin armosta unelmoiden; kun te katsotte meitä ja näette, kuinka mädäntyvä iho riippuu riekaleina yllämme niin kuin revitty vaate ja sieraimissamme kiemurtelee myrkkykäärmeitä. Silloin te tiedätte, että Jumala on armo, oikeus ja rakkaus.

Minulle on ihan okei,jos te rallattelette kuorossa ylistystä Herralle ikuisuuden Tralalaa-mikä-mikä-maassa. Ei se minua haittaa. Minä haluan jättää sen reissun kuitenkin väliin.

Mutta onko Taivaan ilon ja Isän hylkääminen oikeudenmukainen peruste grillata miua ja muita ateisteja iankaikkisesti erilaisissa tulisissa järvissä ja padoissa samalla kun hampaitani revitään hitaasti irti, raajojani sahataan tylsillä sahoilla, läskistäni tehdään saippuaa ja ihoani leikellään saksilla? Tietenkin se on oikeudenmukaista, vaikka minusta se on hieman ylimitoitettua.

Tapasin taannoin Helvetin esikartanossa viisaan eksistentialistin, joka odotti tuomiota ateismista. Hän ihmetteli syvästi abrahamilaista tulkintaa armosta ja oikeudenmukaisuudesta. Työssään ja elämässään hän oli kokenut merkittävää uskonnollista härintää. Ikuisuutta oli kaupattu hänelle lupauksilla kauneudesta ja lihaksikkaasta kuumppanista paratiisissa. No minunkin mielestäni oli hieman hassua, että hän ei tarttunut syöttiin, vaan valitsi myrkkykäärmeet sieraimiinsa. No sellaistahan tämä elämä on.

Mutta mikä kiire sillä maailmanlopulla on, jos kaikki jumalattomat ja syntiset kuitenkin palavat iankaikkisesti. Ei mitään kiirettä. Päivä tänne, vuosi tuonne ja yksi elämä on vain kärpäsen kusema ikuisuudessa. Koitetaan kestää se.

Uskossaan vahvoja ja vanhurskaita COVID-19 ei tietenkään pelota niin kuin ateisteja, koska korona on Jumalan rangaistus homoille ja syntisille, mutta aivan erityisesti homoille.

Toistan: COVID-19 on Jumalan rangaistus, koska maailmassa on liikaa homoja ja vihervasemmistolaisia puunhalaajia, sossutätejä, feministejä ja ateisteja.

Jumala ei tykkää kommareista ja vihreistä tai kikattelevien tyttöjen hallituksista. Kaikki sen tietää! Ja Jumala vihaa myös Euroopan unionia ja katolista kirkkoa. COVID-19 on rangaistus Gayroopalle. Sen tietää Putinkin.

Pelastus on yhtä lähellä kuin lähin kirkko

Nyt kyllä viimeistään kannattaa pakkautua suurin joukoin kirkkoihin, temppeleihin ja moskeijoihin rukoilemaan pelastusta. Se voi olla ainoa toivomme. Ehtoollinen on taivaallinen idea. Muistakaa kosketella toisianne ja syökää pappien kädestä.

Tavataan sitten taivaan ilossa, jossa ei maalliset murheet paljon paina. Luojan kiitos, hopeavesi tappaa homovirukset ja pelastaa, jos ei muita, niin ainakin käärmeöljyjen kauppiaat ja evankelistat!

Israelilainen rabbi Meir Mazuz on julistanut koronaviruksen Jumalan rangaistukseksi homokulkueista. Heikompia on aina helppo vainota ja syyllistää. Kuvittelin, että juutalaiset rabbit osaisivat olla osoittelematta syyttävällä sormella vähemmistöjä. Ehkä eräät eivät enää muista.

Pahinta on se, että typerät massat seuraavat evankelistoja, rabbeja ja imaameja vaikka tuleen. Nyt odotetaan vain, että Päivin ja Lauran hengenheimolaiset alkavat lietsoa suomalaisia fanaatikkoja Jumalan homovastaiseen vihaan.

Järki käteen! Virukset eivät ole Jumalan rangaistus ja COVID-19 ei ole maailmanloppu. Suomessa patavanhoillisia herännäisiä on vain kourallinen, mutta viha leviää nopeammin kuin yksikään virus. Vihan lietsojia löytyy jokaisen kriisin yhteydessä, oli kriisin syy sitten tulehtunut hammas tai kikattelevien tyttöjen hallitus. Aina joku vihaa ja heittää bensaa vihan liekkeihin.

COVID-19 ei ole vitsi tai maailmanloppu

Epidemia on paholainen. Me emme voi antaa paholaisen piiloutua”, Xi Jinping, 28.1. Kiinan valtiollisen median mukaan

Yhdysvaltojen hallinnossa varautuminen pandemiaan on pelottavan heikolla tasolla. Trumpin hallinto lopetti vuonna 2018 asiantuntijoista koostuvan epidemioihin varautuvan erikoisryhmän rahoituksen. Tartuntatautiviraston (CDC) rahoitusta leikattiin seuraavana vuonna 80%.

Trump itse on kutsunut koronavirusepidemiaa demokraattien juoneksi ja viruksesta kertovia uutisia valeuutisiksi, joiden tarkoituksena on horjuttaa hänen valta-asemaansa. Päävastuu COVID-19-epidemiasta on Yhdysvalloissa siirretty tiedevastaiselle kristitylle, Mike Pencelle. Kädet ristiin. Nyt on hyvä aika rukoilla.

Eräät Trumpin lähipiiriin kuuluvat evankelistat julistavat blogeissaan ja vlogeissaan, että COVID-19 on Jumalan rangaistus aborteista ja homoseksistä. Joidenkin evankelistojen mukaan epidemia alkoi Kiinasta, koska Jumala vihaa kiinalaisia kommunisteja. Näiden evankelistojen mukaan amerikkalaisilla ei ole hätää, sillä Jumala suojelee kristittyjä amerikkalaisia.

Yhdysvalloissa kriisi voi kuitenkin kärjistyä vaarallisesti. Väestö on jakautunut hyvin rikkaisiin, hyvin toimentuleviin ja äärimmäisen köyhiin. Etniset ristiriidat, yhteiskunnan jakaantuminen, rikollisuus ja väkivalta ovat monin verroin suurempia ongelmia Yhdysvalloissa kuin Euroopassa.

Amerikkalainen lääketieteellinen osaaminen kuuluu maailman parhaimpiin, mutta se tarjoaa palveluita vain niille, joilla on riittävän kattava vakuutus tai rahaa. Kymmenillä miljoonilla amerikkalaisilla ei ole varaa edes edullisimpiin terveydenhoitopalveluihin tai välttämättömimpiin lääkkeisiin.

Washingtonin osavaltiossa koronavirustartuntojen määrä kaksinkertaistuu kuuden päivän välein. Tällä tahdilla sairastuneiden ja sairauteen kuolevien määrä kuusitoistakertaistuu seuraavan kuukauden sisällä. Kahdessa kuukaudessa potilaiden ja kuolleiden määrä 64-kertaistuu ja kolmessa kuukaudessa tuhatkertaistuu. Nämä ovat pelottavia lukuja.

Taannoin Kiinasta palannut amerikkalaismies tunsi olonsa flunssaiseksi, joten hän hakeutui sairaalaan Miamissa koronavirustestiä varten. Kaksi viikkoa myöhemmin vakuutusyhtiö muisti miestä 3270 dollarin laskulla. Kuinka moni köyhä amerikkalainen uskaltaa edes hakeutua testeihin?

Vuosittain sadat tuhannet amerikkalaista ajautuvat henkilökohtaiseen konkurssiin sairastumisen ja kalliiden terveydenhoitomenojen seurauksena.

”A new study from academic researchers found that 66.5 percent of all bankruptcies were tied to medical issues —either because of high costs for care or time out of work. An estimated 530,000 families turn to bankruptcy each year because of medical issues and bills, the research found.”

Erään tilastollisen analyysin mukaan COVID-19 voi tappaa Yhdysvalloissa jopa 2,5 miljoonaa ihmistä tulevien viikkojen ja kuukausien aikana. University College Londonin professori Mark Handley varoitti, että Italian tilanne toistuu muissakin maissa, mutta 9-14 päivän viiveellä.

”By March 1, 2020, between 1,043 and 9,484 people in the U.S. may have already been infected by the COVID-19 coronavirus, far more than the number that had been publicly reported, according to a new Cedars-Sinai study.”

21. helmikuuta Italiassa oli 3 varmistettua koronavirustapausta. Nyt sairastuneita on jo yli 10 000. Italiassa tauti tappaa päivittäin jo 100-200 henkilöä. Koko maa on asetettu karanteeniin. Tämän hirvittävän tragedian kaikkia taloudellisia ja inhimillisiä kärsimyksiä on mahdotonta arvioida.

Italian talous on horjunut jo vuosia. Entä, jos COVID-19 taittaa kamelin niskan, ja Italian talous romahtaa? Romahduksen seurannaisvaikutukset aiheuttaisivat taloudellisen tsunamin Euroopassa. Dominoefekti kaataisi monta korttitaloa.

Koronavirus on levinnyt lähes koko maailmaan.

Suomessa varautuminen on virallisten tietojen mukaan hyvällä tasolla, mutta edes johtavat lääkärit eivät oikein usko näihin väitteisiin. Edessä on pelottavan suurella todennäköisyydellä verta, hikeä, tuskaa ja vielä enemmän tuskaa. Jokainen meistä voi menettää jotain. Siihen kannattaa varautua.

EU varautuu pahimpaan ja on syytäkin


“I just talked to Giuseppe Conte [Italian prime minister] about the extraordinary situation Italy is facing & prepare the videoconference with European Council members this afternoon. Our duty is to strengthen an European Union coordinated approach. We are with all those affected by COVID-19″ . Charles Michel, President – European Council, 10 March 2020

70. päivä

Britannian terveysministeri Nadine Dorries ilmoitti sairastuneensa. Aiemmin muun muassa Ranskan kulttuuriministeri Franck Riester ja Italian demokraattipuolueen pääsihteeri Nicola Zingaretti ovat vahvistaneet saaneensa tartunnan.

Tauti on levinnyt myös Turkkiin. Tilanne on uhkaava. 3,6 miljoonan syyrialaisen pakolaisen ja horjuvan talouden vuoksi Turkin valmiudet sairastuneiden hoitoon ja koronavirusepidemian leviämisen taltuttamiseen ovat vähintäänkin puutteelliset.

Jos/ja kun koronavirus leviää pakolaisleireille, edessä on sodasta kärsineiden ja kotinsa menettäneille pakolaisille maanpäällinen helvetti. Ja me luulimme että pakolaisleirit ovat jo nyt helvetillisiä. Kuka heitä pystyy auttamaan? Luultavasti ei kukaan. Jos saisin toivoa, että jotain hyvää seuraisi tästä epidemiasta, niin toivon, että epidemia päättäisi Syyrian sisällissodan.

Italia

Väestöön suhteutettuna COVID-19-epidemia on pahimmillaan Italiassa. Päivittäin yli 100 sairastunutta menehtyy ja 1000 ihmistä sairastuu. Saksan tämänhetkinen tilanne muistuttaa tilannetta, joka Italiassa oli kaksi viikkoa sitten.

Epidemia on pakottanut Italian turvautumaan erittäin ankariin rajoituksiin. Mitään tällaista ei ole koettu rauhan aikana Euroopassa. Valitettavasti vain ankarat rajoitukset voivat estää taudin leviämisen ja pelastaa ihmishenkiä.

Lombardian tilanne on kaikkein kurjin. Lombardia on yksi Euroopan rikkaimpia alueita, joten raha ei takaa turvallisuutta. Osa sairaaloista toimii kaksinkertaisella teholla normaaliin nähden. Sairaalapaikoista, lääkäreistä ja hoitohenkilökunnasta on huutava pula.

Ihmisten taloudellisen hädän vuoksi asuntovelkojen lyhennyksiin ja verojen maksuun suunnitellaan lykkäyksiä. Se vaarantaa valtiontalouden ja johtaa todennäköisesti alijäämäisen budjetin kompensoimiseen uudella velalla.

Italia on EU:n neljänneksi suurin talous ja sen velkaantuminen on jo nyt yli 130 % suhteessa bruttokansantuotteeseen. Italian ajautuminen maksukyvyttömäksi samaan tapaan kuin Kreikka 2008,.. No en halua edes ajatella, mitä siitä seuraisi.

EU reagoi tähän kriisiin mielestäni hyvin

EU vapauttaa heti 7,5 miljardia hätärahoitusta koronaviruksen aiheuttamien talousiskujen korjaamiseen. EU-maat yhdistävät voimansa koronaviruksen torjumiseksi.

Komissio kokoaa virologeista ja muista asiantuntijoista ryhmän, joka laatii strategian viruksen leviämisen estämiseksi.

Tutkimukseen ja rokotteen kehittämiseen ohjataan 140 miljoonaa euroa. Komissio myös inventoi olemassaolevat resurssit lääke- ja hoitotarvikkeista EU:n laajuisesti, jotta tiedetään mitä on saatavilla ja mitä tarvitaan.

Euroopan unionin talous turvataan keinolla millä hyvänsä. Komission puheenjohtaja Ursula von der Leyden lupasi, että jäsenmaat saavat tukea taloudellisesti epidemian heikentämiä yrityksiä. Kasvu- ja vakaussopimuksen annetaan joustaa.

Erityisen tärkeää on, että komissio perustaa Korona-sijoitusrahaston, johon kootaan 25 miljardia euroa. Rahastosta voidaan ohjata apua terveydenhuoltoalalle, pienille ja keskisuurille yrityksille ja työmarkkinoille.

”Puhelinkokousta johtanut Eurooppa-neuvoston puheenjohtaja Charles Michel sanoi kokouksen jälkeen, että kaikkein tärkeintä on rajata virus ja huolehtia ihmisten terveydestä.

Viime viikon perjantaina terveysministerien ylimääräisessä kokouksessa kävi ilmi, että useampi jäsenmaa ei ole varautunut pandemian kaltaisen taudin torjuntaan eikä hoitoon. Myös Suomen valmiuksia on epäilty.

Lääkkeitä ja sairaalatarvikkeita kuten kasvosuojia ja respiraattoreita pyritään hankkimaan komission johdolla yhteishankintoina. Yhtälailla jäsenmaat pyrkivät nyt kohti yhtenäisiä ohjeita viruksen taltuttamiseksi.”

EU:lla on nyt mahdollisuus todistaa epäilijöille, että yhteistoiminta tekee meistä vahvempia. Toivon todella näin.

Ja tsemppiä kaikille. Pysykää terveinä, ottakaa iisisti ja pitäkää läheisistä huolta. On mahdollista, että Suomi ja suuri osa maailmaa menee tulevien viikkojen aikana kiinni.

COVID-19 tulee vaikuttamaan kaikkien meidän elämään tavalla tai toisella vaikka emme sairastuisikaan…

COVID-19 on äärimmäisen vakava uhka koko maailmalle ja todennäköisesti sen seuraukset muuttavat maailmaa ja vaikuttavat elämäämme vielä vuosien päästä.

”The mortality rate of this virus is 41 in 4,000 cases, or about 1%. Doesn’t sound like a lot, right?

By way of comparison, the mortality rate of influenza A is 0.1%, hepatitis A is 0.3%, anthrax is 0.6%, smallpox is 3.0%, and Lassa fever is 1.1%.

So we’re talking about a virus with comparable mortality to smallpox and Lassa fever, that’s easily transmitted (it has an R0 of somewhere between 1.4 and 2.5, meaning each infected person can be expected to transmit it to 2–4 others). By way of comparison, the R0 of influenza is 1.4 to 1.6, and Ebola is 1.5 to 2.0. It’s as lethal as smallpox and spreads as fast as or faster than Ebola.”

Tämä oli tämmöinen näkökulma. Pyydän anteeksi sarkasmiani, mutta toivon todella, että uskonnolliset ääriajatukset eivät ohjaa tämän pandemian selvittämistä.




Makeuttajat: sukraloosi ja aspartaami

Sukraloosin ja hiilihydraattien yhdistäminen voi heikentää insuliiniherkkyyttä ja altistaa aineenvaihdunnan häiriöille, kuten lihomiselle ja insuliiniresistenssille.

Ei ole helppoa, jos makeanhimo yllättää. Lisätyn sokerin riskit tunnetaan vanhastaan hyvin. Medical News Today uutisoi Yalen yliopiston tutkimuksesta, jonka mukaan sukraloosin (keinotekoinen makeutusaine) syöminen yhdessä hiilihydraattien kanssa muuttaa ihmisen makean aistimusta ja heikentää solujen insuliiniherkkyyttä. Tämä voi kasvattaa insuliiniresistenssin ja siihen assosioituvien sairauksien riskiä.

Onko sukraloosilla tai aspartaamilla makeutettu Cokis, burgeri ja ranskalaiset pikatie diabetekseen?

Makuaisti ja makean maistaminen kiihdyttävät insuliinin eritystä. Insuliini ohjaa energia-aineenvaihduntaa. Solujen insuliiniherkkyyden häiriöt voivat aiheuttaa insuliiniresistenssia.

Yalen yliopiston tutkijat tekivät yllättävän havainnon

Cell Metabolism julkaisi Yalen yliopiston tutkijoiden tutkimuspaperin, jonka tulokset viittaavat siihen, että keinotekoisten makeutusaineiden syöminen samaan aikaan hiilihydraattien kanssa heikentää terveiden aikuisten insuliiniherkkyyttä.



Sukraloosi ja hiilihydraatit: huono yhdistelmä?

Pienimuotoiseen tutkimukseen rekrytoitiin 45 tervettä 20-45 vuotiasta aikuista, jotka eivät normaalisti käyttäneet keinotekoisia makeutusaineita.

Tutkimukseen osallistuneilta ei edellytetty erityisiä ruokavalion muutoksia. Heille tarjottiin tutkimuksen yhteydessä seitsemän hedelmänmakuista virvoitusjuomaa. Osa juomista oli makeutettu sokerilla ja osa sukraloosilla, eli keinotekoisella makeutusaineella.

Sukraloosi

Sukraloosi on 600-650 kertaa tavallista sokeria makeampi keinotekoinen makeutusaine. Sukraloosia käytetään runsaasti elintarvikkeissa, kuten juomissa ja leivonnaisissa, sillä sen maku muistuttaa tavallista sokeria.

Sukraloosin etuna aspartaamiin verrattuna on hyvä lämpökestävyys ja säilyvyys. Sukraloosi valmistetaan sakkaroosia klooraamalla, jolloin sakkaroosin kolme hydroksyyliryhmää korvataan klooriatomeilla.

Sukraloosi keksittiin vuonna 1976 uuden hyönteismyrkyn kehittämisen yhteydessä Tate & Lyle Corporationin ja Queen Elizabeth College University of Londonin yhteistyönä. Tämä tapahtui sattumalta, kun kiinalainen opiskelija ymmärsi ohjeet väärin ja testaamisen (test) sijaan maistoi kemikaalia (taste).

Sukraloosia on tutkittu useilla eläin- ja ihmiskokeilla. Ihmiskokeissa havaittiin, että 11–27 % sukraloosista imeytyy, mutta 70–80 % poistuu kuitenkin muuttumattomana virtsaan. Noin 5 % sukraloosista hajoaa elimistössä kahdeksi monosakkaridiksi.

Ihmiskokeissa sukraloosilla ei havaittu kielteisiä terveysvaikutuksia, ja muun muassa Euroopan komission tieteellinen komitea on katsonut aineen turvalliseksi. Eräissä eläinkokeissa erittäin suurten annosten (2000 mg/kg) havaittiin aiheuttavan DNA-vaurioita hiirissä. Vielä suurempien annosten (3000 mg/kg) on havaittu kutistavan rottien kateenkorvaa. Sukraloosin on myös havaittu joissakin tapauksissa laukaisevan migreeniä.

Tutkimus

Osa koehenkilöistä sai sukraloosilla makeutettua juomaa, johon oli lisätty maltodekstriiniä (hiilihydraatti). Tähän turvauduttiin, koska näin oli helppo säädellä juoman kaloripitoisuutta tekemättä juomasta yhtään makeampaa. Koe kesti kaksi viikkoa.

Tutkittaville tehtiin erilaisia mittauksia, kuten MRI (aivojen magneettikuvaus) ennen koetta, kokeen aikana ja kokeen jälkeen.

Mittausten avulla tutkijat pystyivät arvioimaan erilaisten makuärsykkeiden aiheuttamat muutokset aivojen toiminnassa. Tutkittavien aivojen vastetta makeaan, happamaan ja suolaiseen, ja makuaistin sekä insuliiniherkkyyden tapahtumia seurattiin.

Analysoidessaan tutkimuksessa koottua aineistoa tutkijat löysivät kerätystä datasta yllättäviä poikkeamia. Havainnot koskivat sukraloosia ja maltodekstriiniä saanutta kontrolliryhmää. Tässä ryhmässä havaittiin aivojen muuttuneita vasteita makeaan, insuliiniherkkyyden heikentymistä ja muutoksia glukoosin metaboliassa.

Havaintojen paikkansapitävyyden varmistamiseksi tutkijat jatkoivat koetta siten, että uudelle ryhmälle annettiin joko sukraloosilla tai maltodekstriinillä makeutettuja juomia seitsemän päivän ajan. Näin varmistettiin, että sukraloosi tai maltodekstriini ei yksin selittänyt kokeessa havaittuja muutoksia.

Mitä tapahtui?

Miksi sukraloosi-hiilihydraatti-yhdistelmä muutti kokeeseen osallistuneiden makeuden aistimista ja insuliiniherkkyyttä? Tähän ei osata varmasti vielä vastata, mutta tutkijoilla on joitain ideoita syystä.

Vaikutus johtui mahdollisesti siitä, että ravinnon sisältämä energia tulkittiin väärin, jolloin aivojen saama kemiallinen viesti saadun energian määrästä oli virheellinen. Solut ovat herkkiä sukraloosille ja maltodekstriinille. Makuaisti tulkitsee makean ravinnoksi, joka sisältää energiaa. Aivoille välittyy sukraloosin ja maltodekstriinin yhteisvaikutuksesta kemiallinen signaali, että elimistö on saanut energiaa.

Maltodekstriini sisältää energiaa, mutta sukraloosi ei. Näiden yhteisvaikutuksen elimistö tulkitsee siten, että käytettävissä olisi todelliseen energianmäärään nähden kaksinkertainen määrä energiaa. Ajan mittaan keho oppii, että näin ei ole, ja metabolinen vaste makeaan muuttuu.

Aiemmat havainnot

Tutkimuksessa viitataan myös aikaisemmin jyrsijöillä tehtyihin tutkimuksiin, jotka antoivat samankaltaisia tuloksia. Näissä kokeissa rotille syötettiin makeuttamatonta jogurttia tai keinotekoisilla makeutusaineilla makeutettua jogurttia. Tulokset olivat verrannollisia Yalen yliopiston tutkimuksen tulosten kanssa.

Aikaisemmat tutkimukset rotilla osoittivat, että muutokset makean aistimisessa ohjaavat aineenvaihduntaa virheelliseen suuntaan, mikä voi altistaa aineenvaihduntahäiriöille ja lihomiselle.

Keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmä tulkitaan elimistössä virheellisesti suuremmaksi energiakuormaksi kuin se on.

Tutkimuksen tulosten perusteella dieetti-Colan juominen satunnaisesti on ihan okei, mutta runsaasti hiilihydraatteja sisältävän ruoan, kuten ranskalaisten perunoiden kanssa on parempi valita normaali Cola tai jokin muu juoma, kuten vesi.

Makeutusaineilla makeutetut virvokkeet ja runsashiilihydraattiset ruoat eivät tutkimusten perusteella sovi yhteen. Tutkijat suunnittelevat tutkimukselle jatkoa, jossa selvitetään, onko muiden keinotekoisten makeutusaineiden ja hiilihydraattien yhdistelmillä vastaavia insuliinisensitiivisyyttä heikentäviä vaikutuksia. Tarkoituksena on lisäksi tehdä vertaileva tutkimus stevian ja hiilihydraattien yhteisvaikutuksesta.


Onko aspartaamilla sivuvaikutuksia?

Aspartaami on sukraloosin ohella tunnetuin keinotekoinen ja vähäkalorinen makeutusaine. Aspartaami on eräs suosituimmista sokerin korvikkeista vähäkalorisissa ruoissa ja juomissa, sekä monissa lääkkeissä.

Yhdysvalloissa aspartaamia myydään tuotenimillä Nutrasweet ja Equal. Laajasta käytöstä ja suosiosta huolimatta aspartaami herättää yhä ristiriitoja ja kiistoja mm. terveysvaikutuksista. Useissa tutkimuksissa väitetään, että makeutusaineella on haitallisia sivuvaikutuksia.

Onko aspartaami turvallista?

Yhdysvalloissa FDA (Food and Drug Administration) hyväksyi aspartaamin elintarvikekäyttöön vuonna 1981. Aspartaamin käyttö elintarvikkeissa on hyväksytty EU:ssa, Kanadassa ja monissa muissa valtioissa. Seuraavat kansainväliset järjestöt hyväksyvät aspartaamin elintarvikekäytön:

  • World Health Organization
  • United Nations Food and Agriculture Organization
  • American Heart Association
  • American Dietetic Association

Vuonna 2013 Euroopan ruokaturvallisuudesta vastaava virasto (EFSA) analysoi satoja aspartaamia käsitteleviä tutkimuksia.

Analyysin perusteella EFSA arvioi, että aspartaamin käyttö ravinnossa on turvallista. EFSA asetti päivittäisen saannin ylärajaksi suosituksen 40 milligrammaa / painokilo.

EFSAn turvallisena saantina pidetty määrä on 10 mg vähemmän kuin FDA:n turvallisena pitämä määrä. Tällä ei sinänsä ole merkitystä, koska ylärajat ovat molemmissa tapauksissa normaalin käytön kannalta hyvin korkealla. Esimerkiksi normaali virvoitusjuoma sisältää noin 190 mg aspartaamia. Päivittäisen ylärajan saavuttamiseksi pitäisi juoda 19-20 aspartaamilla makeutettua virvoitusjuomaa.

Aspartaamin vaikutus painoon

Aspartaamissa on energiaa 4 kcal grammassa samoin kuin sokerissa, mutta aspartaami on 200 kertaa makeampaa kuin sokeri. 1:200 osa aspartaamia ajaa saman asian kuin gramma sokeria. Vähäkalorisilla makeutusaineilla makeutettuja elintarvikkeita suositaan lähinnä painonhallinnan vuoksi.

Tutkimuskatsaus viimeisimmistä tutkimuksista (2017 review) ei löytänyt todisteita siitä, että vähäkaloriset makeutusaineet, kuten aspartaami, sukraloosi ja steviosidi auttaisivat painon hallinnassa.

Eräät katsauksen tutkimuksista seurasivat tutkittavien elämäntapoja useiden vuosien ajan. Keinotekoisten makeutusaineiden säännöllinen käyttö assosioitui tutkimuksissa ylipainoon, lihavuuteen ja suurempaan vyötärönympärykseen.

Huolestuttavinta makeutusaineiden säännöllisessä saannissa on se, että vuoden 2017 tutkimuskatsaus havaitsi yhteyden säännöllisen makeutusaineiden saannin, sydäntautien, diabeteksen ja halvausten välillä.

Aspartaamin aikutukset ruokahaluun

Havaintojen perusteella keinotekoiset makeutusaineet lisäävät ruokahalua. Lisääntyneen ruokahalun arvellaan selittävän sitä, että kalorittomat ja vähäkaloriset makeutusaineet ovat yhteydessä lihomiseen.

Vuonna 2013 Trends in Endocrinology and Metabolism julkaisi tutkimuskatsauksen (2013 review), joka viittaa useisiin eläimillä tehtyihin tutkimuksiin. Säännöllinen kalorittomien tai vähän kaloreita sisältävän makeutusaineen saanti lisäsi näiden tutkimusraporttien mukaan eläinten ruokahalua ja painoa.

Katsauksessa arvellaan, että keinotekoiset makeutusaineet häiritsevät kehon ja aivojen välistä normaalia viestintää, jonka pitäisi kertoa aivoille, kun elimistö on saanut riittävästi runsasenergistä ravintoa. Elimistö viestii nälästä greliinin, ja kylläisyydestä leptiinin välityksellä. Näiden hormonien toiminnan sekoittaminen johtaa helposti lihomiseen.

Makean aistiminen signaloi suolistolle, että suolistoon on tulossa ravintoa. Keho odottaa saavansa energiaa ja valmistautuu siihen. Makuaisti tunnistaa myös makeutusaineiden makeuden, jolloin elimistö valmistautuu vastaanottamaan runsaasti ihania ja ravitsevia sokereita. Niitä ei kuitenkaan ole luvassa, sillä makeutusaineet eivät sisällä energiaa.

Hypoteesin mukaan säännöllinen keinotekoisten makeutusaineiden syöminen sekoittaa kehon nälästä ja kylläisyydestä kertovaa viestintää. Kun elimistö tottuu tähän, se ei enää reagoi oikeasti korkeakalorisiin ruokiin oikealla tavalla. Tämä voi vaikuttaa kylläisyyshormoni (leptiinin) toimintaan vaikuttamalla esimerkiksi leptiiniresistenssin kehittymiseen, jolloin ihminen ei koe tulevansa kylläiseksi, vaikka söisi riittävästi.

Vaikutukset aineenvaihduntaan

Sama prosessi, joka häiritsee elimistön energiatilasta kertovaa hormonaalista viestintää, voi lisätä insuliiniresistenssin ja tyypin 2 diabeteksen riskiä.

Keho oppii vähitellen, että makea ei tarkoita energiansaantia. Jos ihminen sitten syö sokeripitoista ravintoa, suolisto ja aineenvaihdunta ei reagoi enää sokeriin toivotulla tavalla.

Vuoden 2016 tutkimuskatsauksessa havaittiin, että keinotekoiset makeutusaineet ovat myrkkyä suoliston mikrobiomille. Keinotekoiset makeutusaineet järkyttävät suolistoflooran tasapainoa ja vähentävät mikrobiomin monimuotoisuutta.

Suolistoflooran lajikirjon heikkeneminen on myös yhteydessä lihomiseen. Esimerkiksi identtisillä kaksosilla, jotka syövät lähes identtisesti, toinen voi olla lihava ja toinen hoikka. Tämä selittyy suoliston mikrobiomin hyvinvoinnilla. Terve ja lajistoltaan runsaampi mikrobiomi vaikuttaa immuunijärjestelmän ohella myös aineenvaihduntaa tehostavasti. Mikrobilajistoltaan köyhempi suolistofloora assosioituu lihomiseen.

Eläinkokeissa on osoitettu, että tällaiset energia-aineenvaihdunnan häiriöt voivat johtaa glukoosi-intoleranssiin, joka on tyypin 2 diabeteksen riskitekijä.Vuodesta 2016 tehdyssä tutkimuksessa tutkittiin tiettyjen sokereiden ja makeutusaineiden vaikutuksia ihmisten sokerin sietokykyyn.

Lihavilla havaittiin yhteys aspartaamin saannin ja glukoosi-intoleranssin välillä. Mikään testatuista sokereista ja makeutusaineista ei kuitenkaan vaikuttanut kielteisesti normaalipainoisen ihmisen terveyteen.

Tutkimusten perusteella voidaan todeta, että säännöllinen aspartaamin saanti voi kasvattaa glukoosi-intoleranssin riskiä etenkin lihavilla.


Liittyykö aspartaamiin muita riskejä?

Viimeisten vuosikymmenten aikana aspartaamin on väitetty aiheuttavan ainakin:

  • Päänsärkyä
  • Huimausta
  • Kohtauksia
  • Masennusta
  • ADHD:ta
  • Alzheimerin tautia
  • Multippeliskleroosia (MS)
  • Syöpää
  • Lupusta
  • synnynnäisiä epämuodostumia

Ttutkimusaineistoa tai todisteita aspartaamin yhteydestä ylläoleviin sairauksiin ei ole olemassa. Nuo ovat enemmänkin urbaaneja legendoja.

Minä sairastan multippeliskleroosia, mutta en ole syönyt tai juonut juuri lainkaan aspartaamilla makeutettuja ruokia tai juomia. En usko aspartaamin aiheuttavan MS-tautia.Päänsärkyä paitsi aspartaamin yhteys ylläoleviin sairauksiin tuntuu epäuskottavalta.

Yhteenveto

Aspartaamin ympärillä kiehuu jatkuvasti, vaikka tutkimukset eivät anna aihetta ylettömälle paniikille.

Tuoreimpin tutkimusten mukaan aspartaamin pitkäaikainen säännöllinen käyttö voi aiheuttaa lihomista. On vain hyvin hataraa näyttöä siitä, että aspartaamista olisi haittaa terveille ja normaalipainoisille. Ylipainoisten ja lihavien kohdalla aspartaamin korrelaatio metaboliseen oireyhtymään ja tyypin 2 diabetekseen on osoitettu.




Ketogeeninen ruokavalio ja terveys

Korkea verenpaine on huonojen ravitsemustottumusten jälkeen toiseksi yleisin sairastumisen riskiä lisäävä tekijä, kertoo David J. Unwin (lue tutkimus tästä). Unwin on vuoden 2012 jälkeen hoitanut lihavia, korkeaa verenpainetta ja aikuistyypin diabetesta sairastavia potilaita ketogeenisellä ruokavaliolla. Tulokset ovat olleet hyviä.  Ketogeeninen ruokavalio ja terveys on laaja katsaus ketoilun positiivisiin terveysvaikutuksiin.

Kymmenet lääkärit ympäri maailman suosittelevat ketogeenistä ruokavaliota laihduttamiseen ja kardiometabolisten sairauksien hoitoon.

Uuden ravitsemusmallin omaksumisen vaikeus on siinä, että kasvavasta tutkimusnäytöstä ja parantuneista potilaista huolimatta ketogeeninen ruokavalio ei sovi nykyisiin ravitsemusmalleihin. Se haastaa vuosikymmeniä vallalla olleet ravitsemusopit ja lääketieteen paradigmat.

Ketogeeninen ruokavalio olettaa, että tyydyttyneisiin rasvoihin perustuva energiansaanti laihduttaa ja pitää kehon terveenä. Se sotii kaikkea oppimaamme vastaan.

Tieteen itseään korjaava periaate sopii huonosti ravitsemustieteen institutionalisoituihin dogmeihin. Jos tutkimukset antavat tuloksia, jotka eivät tue vallalla olevia käsityksiä, vanhoja oppeja pitää korjata vastaamaan uusia havaintoja.

Onko ketoilu vaarallista, koska siinä syödään paljon rasvaa?

Oppi rasvojen terveyshaitoista on rakennettu tieteellisesti hataralle perustalle. Rasvojen yhteys sydän- ja verisuonitauteihin on tieteellisesti kyseenalaistettu, mutta tämän paradigman asema ravitsemustieteessä on horjumaton.

Laajan kohorttitutkimusten meta-analyysin mukaan tyydyttyneet rasvat eivät lisää sydän- ja verisuonitautien riskiä.

” This current meta-analysis of cohort studies suggested that total fat, SFA, MUFA, and PUFA intake were not associated with the risk of cardiovascular disease. However, we found that higher TFA intake is associated with greater risk of CVDs in a dose-response fashion. Furthermore, the subgroup analysis found a cardio-protective effect of PUFA in studies followed up for more than 10 years.” Lue meta-analyysi tästä!

Olen laihtunut ketogeenisellä ruokavaliolla kolmessa kuukaudessa 9-10 kiloa. Ruokavalioni perusravinne on rasva, jota syön valtavasti virallisiin saantisuosituksiin nähden.  Verensokerini on hyvä 4,5-5,5. Verenpaineet ovat keskimäärin 135/85/80 -tasolla, mutta vaihteluväli on +/-10 suuntaansa.

Laihtuminen on ollut käsittämättömän helppoa, ja oloni on säilynyt koko ajan energisenä. Tältä osin uskallan suositella ruokavaliota muillekin. Tässä esiin tulevat lääketieteelliset havainnot ja väitteet perustuvat useisiin lähteisiin, joihin viittaan tekstissä ja tekstin jälkeen.

Kardiometabolinen syndrooma (CMS)

Kardiometaboliseen syndroomaan (CMS) sisältyy joukko aineenvaihduntaan, verenkiertoon ja munuaisiin assosioituvia häiriöitä. Yhteisiä nimittäjiä kardiometabolisille sairauksille ovat viskeraalinen rasva, keskivartalolihavuus ja insuliiniresistenssi.

Keskivartalolihavuuteen liittyy usein insuliinin heikompi vaikutus ääreiskudoksissa ja/tai seerumin korkea insuliinipitoisuus.

CMS:n oireisiin kuuluvat mm. korkea verenpaine, poikkeavuudet verenpaineen ja sykkeen vuorokausivaihtelussa, diabetekseen viittaavat rasva- ja sokeriaineenvaihdunnan muutokset, aikuistyypin diabetes, alkoholista riippumaton rasvamaksa, lisääntynyt verenhyytymistaipumus, kihti sekä sydän- ja verenkiertoelinten lisääntynyt tulehdusriski.

Epidemiologisissa tutkimuksissa on havaittu, että kardiometabolinen oireyhtymä kasvattaa sepelvaltimotauti-, aivohalvaus-, sydän- ja verisuonitautikuolleisuus- ja kokonaiskuolleisuus-riskejä.

Rohkeimpien lääkäreiden ja ketogeenisen ruokavalion puolestapuhujien, kuten Joseph R. Kraftin ja Ted Naimanin mukaan useimmat sydän- ja verisuonitaudit assosioituvat diagnosoituun tai diagnosoimattomaan diabetekseen. Tämä näkemys sopii hyvin havaintoon, että diabeetikoiden sydän- ja verisuonitautikuolleisuus on hyvin korkea.

Diabeteksen laboratoriodiagnoosin kehitykseen 1970-luvulla osallistuneen tri Joseph R. Kraftin mukaan hyperinsulinemia liittyy vahvasti verenpainetaudin, lihavuuden, ateroskleroosin, neurodegeneratiivisten sairauksien (Parkinsonin tauti, Alzheimerin tauti), eräiden syöpien ja verisuonitautien kehittymiseen.

Kardiometabolinen oireyhtymä ja kardiometaboliset sairaudet yleistyvät vauhdilla. Kraft varoitti diabetesepidemiasta ja hyperinsulinemiaan assosioituvista sairauksista jo 1970-luvulla.

Yhteinen nimittäjä kardiometabolisille sairauksille on samanaikainen insuliiniresistenssin aiheuttama hyperinsulinemia. Paikallinen insuliiniresistenssi ei yksistään yleensä aiheuta sairauksia, sillä aineenvaihdunta turvautuu siihen joskus tarkoituksella. Insuliiniresistenssi ja korkeat insuliinitasot yhdessä ovat vakava uhka terveydelle.

Lihavien prosentuaalinen osuus väestöstä Euroopassa

Synkkiä lukuja

Monet sairastuvat, vaikka he liikkuvat ja noudattavat yleisiä ravitsemussuosituksia. Länsimaissa on maailman paras sairaanhoitojärjestelmä, mutta samanaikaisesti todella sairas väestö.

Ylipainoisten ja lihavien määrä on Maailman terveysjärjestön (WHO) mukaan kolminkertaistunut vuoden 1975 jälkeen.

Kiinassa lihavia on 5-6 prosenttia väestöstä, mutta suurissa kiinalaiskaupungeissa, joissa syödään eniten pikaruokaa, lihavien osuus on lyhyessä ajassa kasvanut yli 20 prosenttiin; ylipainoisten ja lihavien kiinalaisten määrä on vain 10 viime vuoden aikana kolminkertaistunut. Keskivartalolihavien kiinalaisten määrä on samana aikana lisääntynyt 50 prosenttia.

Amerikkalaisista 35,4 prosenttia on lihavia, 61,5 % vyötärölihavia. Noin 100 miljoonaa amerikkalaista sairastaa tyypin 2 diabetesta tai esidiabetesta. Euroopan unionin alueella 30-70 % ihmisistä on jo ylipainoisia ja 10-30 % lihavia. EU:ssa lähes 30 miljoonaa ihmistä sairastaa diabetesta. Koko Euroopan (56 valtiota) alueella diabetesta sairastaa noin 60 miljoonaa ihmistä.

Diabetes

Aikuistyypin diabetesta sairastavien määrä on kasvanut noin 108 miljoonasta (1980) 422 miljoonaan (2014). Prosentuaalisesti maailman väestössä diabeteksen esiintyvyys on kasvanut 4,3 prosentista 8,8 prosenttiin neljässä vuosikymmenessä. Kasvun uskotaan jatkuvan. Nykyisen trendin perusteella vuonna 2045 joka kymmenes maailman ihminen sairastaa diabetesta.

Diabetesta sairastavien lisäksi jopa 352 miljoonan ihmisen glukoosin sieto on heikentynyt ja he sairastavat esidiabetesta. Mikä tällaisen selittää ja pitääkö tästä huolestua?

Minun mielestäni pitää huolestua. Diabetes yleistyy nopeimmin pieni- ja keskituloisten parissa, mutta se yleistyy myös muissa sosioekonomisissa väestöryhmissä. Diabetes on tärkein sokeutta, munuaisvaurioita, sydänkohtauksia ja alaraajojen amputaatioita aiheuttava sairaus.

Vuonna 2016 1,6 miljoonaa ihmistä menehtyi diabeteksen seurauksena ja näiden lisäksi 2,2 miljoonaa kuolemantapausta assosioitui vahvasti korkeaan verensokeriin (WHO).

IDF:n tilastojen mukaan diabetes ja siihen liittyvät komplikaatiot tappavat vuosittain noin 4 miljoonaa ihmistä. Tilastollisesti yksi ihminen kuolee diabeteksen seurauksena seitsemän sekunnin välein. Inhimillisen kärsimyksen lisäksi tyypin 2 diabetes tulee yhteiskunnille mahdottoman kalliiksi.

”The figures given in the IDF Atlas fit well with the estimates of an international consortium reporting worldwide trends in diabetes since 1980 based on a pooled analysis of 751 population-based studies with 4·4 million participants. According to this group global age-standardised diabetes prevalence increased from 4.3% (95% CI 2.4-7.0) in 1980 to 9.0% (7.2-11.1) in 2014 in men, and from 5.0% (2.9-7.9) to 7.9% (6.4-9.7) in women.”

Syitä diabetesepidemialle voidaan etsiä esimerkiksi vähentyneestä arkiliikunnasta, väestön lisääntymisestä ja ihmisten odotettavissa olevan elinajan kasvusta. Nämä eivät kuitenkaan selitä nykyistä diabetesepidemiaa riittävän hyvin, sillä miljoonat raskasta fyysistä työtä tekevät ja ravintosuosituksia noudattavat lihovat ja sairastuvat diabetekseen.

Eräs tärkeimmistä diabeteksen kasvua selittävistä tekijöistä on keskivartalolihavuuden nopea lisääntyminen lähes kaikissa sosioekonomisissa ryhmissä ympäri maailman.

Mistä tiedän, onko minulla diabetes?

Terveellä ihmisellä paaston jälkeinen plasman sokeri on 6 mmol/l tai vähemmän. Kahden tunnin sokerirasituksessa terveen ihmisen verensokeri pysyy alle 7,8 mmol/l.

Kun paastoverinäytteestä mitataan sokeria 6,1–6,9 mmol/l, kyseessä on kohonnut paastoplasman sokeri eli heikentynyt paastosokeri (IFG, impaired fasting glucose).

Heikentynyt sokerinsieto (IGT, impaired glucose tolerance) todetaan, kun verensokeripitoisuus on 7,8–11 mmol/l sokerirasituskokeessa 2 tunnin kohdalla tai 2 tuntia aterian jälkeen.

Tutkimuksessa ketogeeninen ruokavalio oli perinteistä vähärasvaista diabetesruokavaliota parempi:

”Individuals with type 2 diabetes improved their glycemic control and lost more weight after being randomized to a very low-carbohydrate ketogenic diet and lifestyle online program rather than a conventional, low-fat diabetes diet online program. Thus, the online delivery of these very low-carbohydrate ketogenic diet and lifestyle recommendations may allow them to have a wider reach in the successful self-management of type 2 diabetes.”

Hyvä uutinen on se, että tyypin 2 diabetes ei ole krooninen sairaus. Se on voitettavissa! Tyypin 2 diabetes voidaan hoitaa esimerkiksi vähäkalorisella tai ketogeenisellä ruokavaliolla. Näistä jälkimmäinen on tutkimusten perusteella parempi.

”A literature search was performed, and a total of 99 original articles containing information pertaining to diabetes reversal or remission were included. Results: Evidence exists that T2D reversal is achievable using bariatric surgery, low-calorie diets (LCD), or carbohydrate restriction (LC).” Lue tästä!

Lihavien määrän kasvu eri väestöissä

Pitääkö klassinen ruokapyramidi kaataa?

Perinteiset lautasmallit ja ravintopyramidit eivät selvästikään suojele meitä lihomiselta ja sairastumiselta. Sairaudet yleistyvät, vaikka ihmiset noudattavat suosituksia, liikkuvat ja lääketiede kehittyy. Missä vika?

Eräs perinteisen ravintopyramidin kaatajista on professori Tim Noakes, joka on elämänsä aikana juossut kymmeniä maratoneja ja ultramaratoneja. Noakes kirjoitti uransa alussa vähärasvaiseen ja runsaasti hiilihydraatteja sisältävään ruokavalioon kannustavia kirjoja.

Noakes käänsi oman ravitsemuksensa ylösalaisin sairastuttuaan aikuistyypin diabetekseen. Hän sairastui, vaikka vältteli rasvoja, liikkui hyvin aktiivisesti ja söi virallisten suositusten mukaisesti. Vallalla olevan mallin mukaan maailman ”timnoakesien” ei pitäisi lihoa tai sairastua aikuistyypin diabetekseen, mutta monet maailman ”timnoakesit” sairastuvat.

Tohtori David Unwin kertoo, että vuonna 1986 hänen vastaanotollaan kävi 57 aikuistyypin diabetesta sairastavaa. Tauti oli tuohon aikaan vielä melko harvinainen ja siihen sairastuivat lähinnä iäkkäät ihmiset. Vuonna 2012 samalla vastaanotolla tyypin 2 diabeetikkoja oli jo 472.


Insuliini on anabolinen hormoni

Verenpainetauti, lihavuus, dyslipidemia ja glukoosi-intoleranssi assosioituvat hyperinsulinemiaan. Oirekirjo tunnetaan metabolisena oireyhtymänä. Hyperinsulinemia vaikuttaa verenpaineeseen lisäämällä munuaisten natriumretentiota (natriumin säilytystä).

Insuliini on aminohapoista muodostuva hormoni. Hormonit ovat elimistön valmistamia endogeenisiä viestinvälittäjämolekyylejä, jotka kulkevat erittymispaikasta kohdesoluihin pääosin verenkierron välityksellä. Hormoni voi vaikuttaa pieninäkin määrinä soluun, jossa on hormonille spesifisiä reseptoreja.

Eri puolilla elimistöä sijaitsevat umpirauhaset erittävät hormoneja aivolisäkkeen ja hypotalamuksen säätelemänä. Insuliinin eritystä ohjaa veren sokeripitoisuus. Glukoosi aiheuttaa piikin insuliinin erityksessä. Proteiinit ja rasvat vaikuttavat insuliinin eritykseen paljon sokereita maltillisemmin.


Mitä hormonit ovat?

Hormonit, jotka voivat olla joko vesiliukoisia (katekoliamiinit, glukagoni ja insuliini) tai rasvaliukoisia (D-vitamiini, steroidit ja kilpirauhashormonit) säätelevät lähes kaikkia elimistön aineenvaihduntaprosesseja. Ne ovat aminohappo-, rasvahappo-, proteiini- ja peptidihormoneja tai steroideja.

Aminohappoyhdisteistä muodostuneet hormonit muodostuvat tyrosiinista ja tryptofaanista. näihin hormoneihin kuuluvat kilpirauhasen erittämät kilpirauhashormonit ja lisämunuaisytimen erittämät katekoliamiinit.

Solukalvojen fosfolipidi arakidonihappo toimii rasvahappoyhdisteisten hormonien lähtöaineena. Tällaisia ovat mm. eikosanoidit (esimerkiksi postglandiinit, tromoksiaanit ja leukotrieenit).

Proteiini- ja peptidihormonit ovat muodostuneet muutamista tai jopa sadoista aminohapoista. Tällaisia ovat esimerkiksi vasopressiini ja tyreoliberiini.

Proteiinihormoneja ovat mm. insuliini ja kasvuhormoni. Proteiinihormoneja, joihin on liittyneenä hiilihydraattiryhmä, kutsutaan glykoproteiineiksi. Glykoproteiineja ovat esimerkiksi follikkelia stimuloiva hormoni ja luteinisoiva hormoni. Steroidihormonien lähtöaineena toimii kolesteroli.

Insuliini ja insuliiniresistenssi

Terve aineenvaihdunta reagoi ruokailun kohottamaan verensokeriin erittämällä insuliinia haiman Langerhansin saarekkeiden β-soluista. Insuliinimolekyylit kulkeutuvat verenkierron mukana soluihin ja kiinnittyvät kudosten insuliiniherkkien solujen insuliinireseptoreihin.

Insuliinireseptoriin kiinnittynyt insuliinimolekyyli ”kutsuu” solukalvon läpäisevän kanavan, jota pitkin glukoosimolekyyli pääsee sujahtamaan solun sytoplasmaan.

Insuliini vaikuttaa insuliiniherkkiin kudoksiin, kuten lihas- ja rasvasoluihin sekä maksan soluihin. Sillä on merkittävä tehtävä kehon energiataloudessa ja erityisesti sokeriaineenvaihdunnassa, koska insuliini lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa. Insuliiniresistenssi vaikuttaa ensimmäiseksi lihassoluihin, joten rasvasolujen energian varastoiminen lisääntyy.

Normaalisti insuliinin eritys vähenee verensokerin laskiessa. Terveillä verensokeri pysyy noin 5 mmol /l (90 mg /dl) -tuntumassa. Esidiabeteksessa sokeritasot kohoavat lähelle 7 mmol /l -tasoa. Diabetekseen sairastuneilla yön yli paaston jälkeen mitattu verensokeri on toistuvasti 7,0 mmol/l tai sitä korkeampi. Normaalin verensokerin yläraja on 6,0 mmol/l.

Insuliini on kehon energiatalouden kapellimestari. Se ohjaa ravinteiden käyttöä energian tuotantoon tai varastoimiseen solujen kylläisyysasteen mukaisesti.

Insuliinipitoisuuden laskiessa glukagoni purkaa insuliinin rakentamia energiavarastoja maksan ja lihasten glykogeeneistä. Näiden hormonien pitoisuus veressä vaihtelee jatkuvasti. Välillä glukoosia puretaan glukagonin aktivoimana glykogeeneistä ja välillä glykogeeni- ja rasvavarastoja kootaan insuliinin avulla.

Insuliiniresistentillä henkilöllä insuliini ei laske verensokeria halutulla tavalla. Rasva- ja lihassolut, tarvitsevat insuliinia glukoosin sisäänottoon. Kun nämä solut eivät reagoi insuliiniin, verensokeri nousee.

Pitkään jatkuvalla korkealla verensokerilla on monia haitallisia terveysvaikutuksia: se mm. heikentää verisuonia.  Aterioiden välillä insuliinitasot laskevat. Insuliinin laskun vaikutuksesta haiman alfasolut erittävät vereen glukagonia. Tämä insuliinin vastavaikuttaja aktivoi sokerivarastojen purkamisen maksasta vereen ja lihaksista lihasten omaan käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.

Rasvasolujen insuliiniresistenssissä verenkierrossa olevien lipidien imeytyminen heikkenee ja varastoituneiden triglyseridien hydrolyysi kiihtyy. Tämä lisää vapaiden rasvahappojen määrää veriplasmassa ja voi edelleen pahentaa insuliiniresistenssiä.

Hyperinsulinemia


Lisääntynyt viskeraalinen rasva erittää tulehdusta aiheuttavia sytokiinejä vereen, ja nämä vaikuttavat insuliinireseptorien toimintaa heikentävästi.

Hyperinsulinemia

Insuliiniresistenssi voi johtaa hyperinsulinemiaan, eli tilaan, jossa veressä on aivan liikaa insuliinia. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, minkä vuoksi veren glukoosia varastoidaan rasvasoluihin.

Insuliiniresistenssin vaikutuksesta lihasten toiminta heikkenee, sillä lihassolujen glukoosinsaanti vähenee. Samalla insuliinin vaikutuksesta rasvakudoksen rakentaminen tehostuu ja ihminen lihoo.

Koska insuliini on ensisijainen hormonaalinen signaali energian varastoimiselle insuliiniherkkiin rasvasoluihin, se stimuloi uuden rasvakudoksen muodostumista ja kiihdyttää painonnousua.

Insuliiniresistenssi lisää haiman beetasolujen insuliinin tuotantoa. Tämä nostaa veren insuliinitasoja (hyperinsulinemia) korkean verensokerin kompensoimiseksi.

Kompensoidun insuliiniresistenssivaiheen aikana insuliinitasot kasvavat, mutta verenkierron lisääntynyt insuliini ei kuitenkaan laske verensokeria.

Jos lisääntynyttä verensokeria kompensoiva insuliinieritys epäonnistuu laskemaan verensokeria, paastoglukoosi ja aterianjälkeinen glukoosi näkyvät mittauksissa kohonneina glukoosipitoisuuksina. Normaali glukoosipitoisuus pysyy aina 5 mml/l tuntumassa. Esidiabeteksessa verensokeritasot ovat 6,0-6,9 mml/l ja diabeteksessa yli 7 mml/l. Heikentynyt insuliinisensitiivisyys eli insuliiniresistenssi vaikuttaa näin tyypin 2 diabeteksen kehittymiseen.

Insuliiniherkät rasvasolut maksassa ja haimassa säilyttävät insuliinisensitiivisyyden lihassoluja pidempään. Tämän vuoksi insuliini kompensoi kohonnutta verensokeria ohjaamalla glukoosia rasvasoluihin, jossa glukoosi de novo lipogeneesissä muutetaan triglyserideiksi.

Tämä lisää myös maksan ja haiman rasvoittumista. Maksan rasvoittuminen lisää alkoholista riippumattoman rasvamaksan riskiä, mutta sitä suurempi ongelma insuliiniresistenssin ja aikuistyypin diabeteksen kannalta on haiman rasvoittuminen, sillä se heikentää entisestään insuliinintuotantoa, kunnes lopulta beetasolujen toiminta lakkaa kokonaan.

Insuliiniresistenssi assosioituu vahvasti ihmisiin, joilla on runsaasti viskeraalista keskivartaloläskiä, verenpainetauti, hyperglykemia, dyslipidemia, kohonneet triglyseriditasot, kohonnut hyvin pienten matalan tiheyden lipoproteiinien (sdLDL) tasot ja pienentyneet HDL-tasot.

Viskeraalinen keskivartalorasva assosioituu tutkimusten perusteella vahvasti insuliiniresistenssiin kahdella tavalla:

Ensinnäkin toisin kuin ihonalainen rasvakudos, viskeraalinen rasva tuottaa tulehduksellisia sytokiinejä, kuten tuumorinekroositekijä-alfa (TNF-a), interleukiini-1 ja interleukiini-6. Monissa kokeissa on osoitettu, että nämä proinflammatoriset, eli tulehdusta edistävät sytokiinit, hajottavat insuliinia tai estävät insuliinin normaalia toimintaa. Suuri osa tulehduksellisten sytokiinien tuotannosta on keskittynyt IKK-beeta / NF-kappa-B-reitille, proteiiniverkolle, joka tehostaa insuliiniresistenssiä vaikuttamalla tulehduksellisten markkerien ja välittäjien transkriptioon.

Toisaalta viskeraalinen rasva vaikuttaa myös rasvan kerääntymiseen maksaan, mikä aiheuttaa alkoholista riippumattoman rasvamaksan kehittymistä (NAFLD). Tämän seurauksena verenkiertoon vapautuu liikaa vapaita rasvahappoja lisääntyneen lipolyysin seurauksena. Edelleen NAFLD:n seurauksena maksan glykogenolyysi (glykogeenien pilkkominen glukoosiksi) ja maksan glukoosin tuotanto kiihtyvät, mikä pahentaa perifeeristä insuliiniresistenssiä ja kasvattaa tyypin 2 diabeteksen riskiä.

Insuliiniresistenssiin liittyy usein myös hyperkoaguloituva tila (heikentynyt fibrinolyysi) ja lisääntyneet tulehdukselliset sytokiinitasot.

Molekyylitasolla

Molekyylitasolla solu havaitsee insuliinin insuliinireseptoreiden välityksellä signaalin kulkiessa signalointikaskadin läpi. Tämä tunnetaan nimellä PI3K / Akt / mTOR signalointireitti.

Tuoreet tutkimukset viittaavat siihen, että tämä signalointireitti voi toimia fysiologisista olosuhteista riippuvaisena kaksisuuntaisena eli bistabiilina kytkimenä tietyntyyppisille soluille, jossa insuliinivaste voi olla kynnysilmiö.

Tämän signalointireitin herkkyys insuliinille voi heikentyä monien tekijöiden, kuten vapaiden rasvahappojen aiheuttaman insuliiniresistenssin seurauksena. Laajemmasta näkökulmasta herkkyyden virittäminen (tai herkkyyden vähentäminen) on organismin normaali tapa sopeutua muuttuvan ympäristön tai aineenvaihdunnan olosuhteisiin. Eli insuliiniresistenssi voi joissain tilanteissa olla elimistön kannalta toivottava tila.

Esimerkiksi raskaus muuttaa odottavan äidin aineenvaihduntaa. Odottavan äidin elimistön on vähennettävä lihaksiensa insuliiniherkkyyttä varatakseen enemmän glukoosia aivan erityisesti sikiön aivojen kehitykselle. Tämä voidaan saavuttaa siirtämällä insuliinin vastekynnystä, eli herkkyyttä erittämällä vereen istukan kasvutekijää, joka estää insuliinireseptorisubstraatin (IRS) ja PI3K:n vuorovaikutusta. Tämä on ns. säädettävän kynnyshypoteesin ydin.

Insuliiniresistenssi superoksidaasidismutaasi

Insuliiniresistenssi voi olla lisääntyneen ravinnonsaannin aiheuttama solutason reaktio. Ylimääräinen energiansaanti vaikuttaa solujen mitokondrioissa superoksidaasidismutaasin toimintaan.

Superoksidisdaasimutaasi on yksi tärkeimmistä antioksidanteista. Tällaisesta molekyylitason vaikutuksesta on viitteitä erilaisissa insuliiniresistenssistä tehdyissä havainnoissa. Kokeissa on havaittu myös, että insuliiniresistenssi voidaan kääntää nopeasti altistamalla solut esimerkiksi elektronin kuljetusketjun estäjille tai mitokondrioiden superoksididismutaasia jäljitteleville aineille.

Superoksidaasidismutaasi

Insuliiniresistenssi on yhteydessä verenpaineeseen. Nakamura tutkijakollegoineen. osoitti insuliiniresistenteillä jyrsijöillä ja ihmisillä, että vaikka insuliinin stimuloiva vaikutus adiposyyttien glukoosin imeytymisen insuliinireseptorisubstraatin 1 (IRS1) välityksellä heikentyi voimakkaasti, IRS2 välittämä vaikutus suolan imeytymiseen munuaisten proksimaaliseen tubulukseen, säilyi.

Kompensoiva hyperinsulinemia yksilöillä, joilla on insuliiniresistenssi, voi lisätä natriumin kerääntymistä proksimaaliseen tubulukseen, mikä johtaa natriumin ylikuormitukseen ja verenpaineen kohoamiseen.

Superoksidaasidismutaasi (SOD3) on useimmissa kudoksissa esiintyvä antioksidanttientsyymi, joka muuttaa haitallista superoksidia vähemmän haitalliseksi vetyperoksidiksi. Sekin on reaktiivinen happiyhdiste, mutta se toimii myös solujen viestinnässä viestinvälitysmolekyylinä. SOD3 saattaa siis osallistua solujen viestintään.

FM, PhD Lilja Laatikainen selvitti väitöstutkimuksessaan, kuinka solunulkoinen superoksididismutaasi-entsyymi suojaa kudoksia tulehdusreaktion aiheuttamilta vaurioilta. Tutkimus osoitti, että kudokseen virusvektorin avulla siirretty SOD3 estää tulehdussolujen, erityisesti makrofagien, kulkeutumisen vaurioituneeseen kohtaan.

Mekanismi on Laatikaisen tutkimuksen perusteella tulehdussolujen tarvitsemien tarttumismolekyylien ja tulehdusta edistävien sytokiinien tuoton vähentäminen estämällä keskeisen NF-kappa-B-molekyylin toimintaa. Tämän lisäksi SOD3 voimisti viestien välitystä Erk- ja Akt-signalointireiteillä, jotka edistävät solujen eloonjääntiä stressitilanteissa, ja vastaavasti vähensi solukuolemaan johtavien tekijöiden ilmentymistä, vähensi kudosvaurion laajuutta ja nopeutti kudoksen paranemista.

Insuliiniresistenssi tai heikentynyt insuliiniherkkyys on olennainen piirre aineenvaihdunnan oireyhtymässä, johon assosioituvat liikalihavuus, heikentynyt glukoosin sieto, dyslipidemia ja verenpaine. Dyslipidemialla tarkoitetaan rasva-aineenvaihdunnan häiriötä, jossa jokin veren rasva-arvoista (LDL, HDL, triglyseridit) ei vastaa suosituksia. Dyslipidemiasta puhutaan, jos seerumin LDL on yli 3 mmol litrassa, triglyseridipitoisuus yli 2 mmol/l tai HDL-pitoisuus alle 1mmol/l.

Insuliinin toiminta

Heikentynyt insuliiniherkkyys johtaa kompensoivaan hyperinsulinemiaan normaalin verensokerin ylläpitämiseksi. Insuliiniresistenssi voi olla toissijainen vaste insuliinireseptorin (IR) ja telakointiproteiinien, kuten insuliinireseptorisubstraattien (IRS) vaimennussäätelyä tai inaktivaatiota ohjaavalle signaloinnille.

Insuliinilla on tärkeä tehtävä verensokerin säätelyssä, sillä se stimuloi glukoosin kuljetusta rasvasolujen ja luurankolihasten kudosten läpi insuliinireseptorisubstraattien aktivaation jälkeen.

Insuliini stimuloi glukoosin kuljettajien (GLUT) siirtämistä solunsisäisistä kalvo-osastoista plasmakalvoon lisäämällä sokerin imeytymistä. Rasva- ja luurankolihaskudoksissa vaikuttaa useita glukoosin kuljetusmolekyylejä, mutta havaintojen perusteella GLUT4 on glukoosin solukalvojen läpi kuljettamisen kannalta tärkein kuljetusmolekyyli.

Insuliini sitoutuu ja aktivoi insuliinireseptori-tyrosiinikinaasia (IR), mikä johtaa IRS1:n, IRS2:n, IRS3:n ja IRS4:n fosforylaatioon. Sitoutumalla signalointipartnereiden, kuten fosfoinositidi-3-kinaasin (PI3K) kanssa insuliini aktivoi Akt/proteiinikinaasi B- ja proteiinikinaasi C-ζ -kaskadit, joilla on tärkeä tehtävä insuliinin toiminnassa.

IRS-alatyypit jakautuvat kudosspesifisesti, ja niillä on selkeät signalointikanavat. IRS1 välittää insuliinin vaikutusta glukoosin imeytymiseen rasvasoluissa ja luurankolihaksissa. IRS2 toimii ensisijaisesti välittäen insuliinin vaikutusta munuaistiehyihin.

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssin ja verenpaineen välinen yhteys on joko kahden itsenäisen prosessin yhteys, joka ei ole ainakaan suoraan yhteydessä verenpaineeseen, tai syy-seuraussuhde, jossa insuliiniresistenssi aiheuttaa kohonneen verenpaineen.

Jos insuliiniresistenssi ei aiheuta kohonnutta verenpainetta, insuliiniresistenssi ja kohonnut verenpaine voivat olla saman soluhäiriön toisiinsa liittymättömiä seurauksia. Eli kyse voi olla solunsisäisen vapaan kalsiumin määrän lisääntymisestä, mikä johtaa verisuonten supistumiseen ja insuliinin heikentyneeseen toimintaan.

Insuliiniresistenssi on toisaalta myös moniin verenpaineen kohoamista aiheuttaviin aineenvaihdunnan poikkeamiin assosioituva molekyylimarkkeri.

Toinen vaihtoehto on, että hyperinsulinemia vaikuttaa verenpainetaudin syntyyn, lisäämällä natriumin imeytymistä munuaisiin, aktivoimalla sympaattista hermostoa ja muuttamalla verisuonten resistenssiä.

Kudoksen heikentynyt insuliiniherkkyys on yhteinen nimittäjä useille sairauksille, kuten metabolinen oireyhtymä, keskivartalolihavuus, hyperglykemia, dyslipidemia, hypertensio ja insuliiniresistenssi. Vaikka insuliiniresistenssin osuutta hyperglykemian ja dyslipidemian osalta on tutkittu, insuliiniresistenssin merkityksestä verenpainetaudin patogeneesissä tiedetään vähemmän kuin insuliiniresistenssin merkityksestä metabolisen oireyhtymän ja tyypin 2 diabeteksen sekä lihavuuden synnyssä.

Miten Suomessa?

Diabetesliiton mukaan Suomessa vajaat puoli miljoonaa ihmistä sairastaa aikuistyypin diabetesta. Arviolta 100 000 sairastaa diabetesta tietämättään. Joka vuosi yli 20 000 suomalaista sairastuu tyypin 2 diabetekseen.

Diabetes on suurin yksittäinen valtimotautien, aivoverenkiertohäiriöiden ja alaraaja-amputaatioiden syy. Se lisää myös munuais- ja silmäsairauksia. Suomessa diabeteksen hoitokustannuksiin kuluu ihan helvetisti rahaa. Diabeteksen hoitoon käytetään 15 % terveydenhuollon menoista.

FinTerveys 2017 -tutkimuksen mukaan yli 30-vuotiaista miehistä 72 % ja naisista 63 % oli vähintään ylipainoisia. Miehistä 26 % ja naisista 28 % oli lihavia. Melkein puolet suomalaisista on vyötärölihavia.

Jo noin puoli miljoonaa ihmistä käyttää verenpainelääkkeitä. Tuhansilla verenpaineet ovat jatkuvasti riskirajoilla.  

Ketogeeninen ruokavalio toimii painonhallinnassa, pitää verensokerin tasaisena ympäri vuorokauden ja laskee tutkitusti verenpainetta. Voisiko ketogeeninen ruokavalio auttaa verenpaineen, painon ja huonojen lipidiprofiilien kanssa kamppailevia myös Suomessa?

Miksi ketoilu laskee verenpainetta?

David J. Unwin kertoo hiljattain tehdystä pilottitutkimuksesta, jossa tutkijat havaitsivat, että hyvin vähän hiilihydraatteja sisältävään ruokavalioon assosioitui merkittäviä verenpaineen, painon ja lipidiprofiilien paranemista, minkä vuoksi potilaiden lääkitystä voitiin tutkimuksen aikana vähentää.

Kysymys on: Voidaanko samanlaisia positiivisia terveyshyötyjä saada laajemmassa tutkimuksessa? Unwin tutkijaryhmineen rekrytoi perusterveydenhuollon seurantatutkimukseen 154 potilasta, jotka sairastivat aikuistyypin diabetesta, tai joilla sokerin sietokyky oli merkittävästi heikentynyt.

Vähähiilihydraattisen ruokavalion vaikutuksia sydämen ja verisuonitautien riskitekijöihin tutkittiin keskimäärin kaksi vuotta. Seurattujen potilaiden verenpaine laski merkittävästi LCHF-ruokavaliolla:

* Systolinen verenpaine laski keskimäärin 10,9 mmHg
*Diastolinen verenpaine laski keskimääräinen 6,3 mmHg
*Tutkimukseen osallistuneiden potilaiden paino laski keskimäärin 9,5 kg    *lipidiprofiilit paranivat selvästi

Tutkimuksen aikana potilaiden verenpainelääkitystä vähennettiin 20 prosentilla.  Kansallinen terveydenhuollon huippuosaamisinstituutti (National Institute for Health and Care Excellence – NICE) määrittelee kohonneen verenpaineen riskirajaksi 140/90 mmHg ja sitä korkeammat tulokset. Kotioloissa mitatut päivittäiset verenpaineen keskiarvot, jotka ovat vähintään135/85 mmHg ovat korkean verenpaineen riskirajoilla. Ymmärtääkseni näitä arvoja noudatetaan myös suomalaisessa terveydenhuollossa.

Hiljattain julkaistun tutkimuksen (lue tästä) mukaan huonojen ravitsemustottumusten jälkeen korkea verenpaine on globaalisti merkittävin sairastumisen riskitekijä.

Isossa-Britanniassa korkea verenpaine on tupakoinnin ja huonojen ravitsemustottumusten jälkeen kolmanneksi merkittävin sairastumiselle altistava riskitekijä.

Usein korkean verenpaineen syy voi johtua esimerkiksi ylipainosta, tupakoinnista, runsaasta suolan käytöstä tai perinnöllisistä tekijöistä, mutta toisinaan kohonneelle verenpaineelle ei löydetä mitään suoraa kausaalista syytä. Tällöin puhutaan essentiaalisesta hypertensiosta. Se on viisaalta kuulostava diagnoosi, joka kertoo, että syytä kohonneelle verenpaineelle ei tiedetä.

Tutkijat laativat vuonna 2013 ohjeita vähähiilihydraattisen ruokavalion (vähemmän kuin 130 g hiilihydraattia / päivä) hoitosuosituksia tyypin 2 diabeteksen. 19 potilaan pilottitutkimuksen potilaat sairastivat aikuistyypin diabetesta tai heidän sokerinsietokykynsä (IGT) oli merkittävästi heikentynyt. Kahdeksan kuukauden tutkimuksen hämmästyttävimmät seuraukset olivat potilaiden verenpaineen merkittävä parantuminen.  è systolinen 148 ± 17–133 ± 15 mmHg, p <0,005 è diastolinen 91 ± 8–83 ± 11 mmHg, p <0,05).  Koehenkilöiden verenpaineet laskivat huolimatta verenpainelääkkeiden käytön lopettamisesta.

Hypoteesi vuoden 2013 pilottitutkimuksen tuloksille oli, että vähähiilihydraattiset ruokavaliot voivat toimia diabeteksen ja painonhallinnan hoidossa perinteisiä hoitomuotoja paremmin. Aluksi hypoteesi herätti lääketieteellisessä yhteisössä runsaasti kritiikkiä ja epäilyjä, mutta sittemmin ketogeeninen ruokavalio on laajemmin hyväksytty osaksi aikuistyypin diabeteksen hoitoa. (Lue tästä ja tästä).

Hiilihydraattien vähentämisen vaikutukset insuliinin aktiivisuuteen ja metabolisen oireyhtymän oireiden hoitoon osoitettiin jo vuonna 2005 (lue tutkimus). Lisätyn sokerin lisäksi kaikkien ravinnon glukoosilähteiden, kuten leivän, perunan, viljan ja riisin rajoittaminen vähentää insuliinin eritystä ja parantaa insuliiniherkkyyttä.

Metabolinen oireyhtymä, korkea verenpaine DB2, keskivartalolihavuus, dyslipidemia ja alkoholista riippumaton rasvamaksa (NAFLD) ovat vain jäävuoren huippu. Kaikki nämä sairaudet palautuvat pinnan alla vaanivaan insuliiniresistenssiin.

Vuonna 2013 valmistunut vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion ja vähärasvaisen ruokavalion pitkäaikaisia vaikutuksia selvittänyt satunnaistettujen kontrolloitujen tutkimusten (> 12 kuukauden kesto) meta-analyysi, osoitti vähän hiilihydraatteja sisältävällä ruokavaliolla selvää laskua diastolisessa verenpaineessa, mutta ei systolisessa verenpaineessa.

Samana vuonna valmistunut toinen satunnaistettu kontrolloitu tutkimus havaitsi, että sekä systolinen että diastolinen verenpaine laskivat kuuden viikon kuluttua.

Tyypin 2 diabetesta sairastavilla hyperinsulinemia lisää munuaisten natriumin pidättämistä. Samaa ei tapahdu terveillä verrokeilla. Vuonna 2017 satunnaistettujen vertailututkimusten systemaattinen katsaus ja meta-analyysi osoitti, että pienemmän glykeemisen kuorman ruokavalio laskee merkittävästi verenpainetta. (Lue tästä)

Huolimatta ketogeenisen ruokavalion hyötyjen laajemmasta hyväksynnästä, vähähiilihydraattisen ruokavalion pitkäaikaisvaikutukset herättävät yhä kysymyksiä.

Iso-Britannian diabetesyhdistyksen marraskuussa 2018 antaman lausunnon mukaan: vaikka vähän hiilihydraatteja sisältävän ruokavalion ”lyhytaikaiset” hyödyt diabetesta sairastavan painonhallintaan, parantunut glykeeminen kontrolli ja pienentynyt sydän- ja verisuonitautien riski on osoitettu, ketogeenisen ruokavalion pitkäaikaisvaikutuksista tarvitaan lisää tutkimuksia.

Tutkimus ja menetelmät

Tutkimuksessa analysoitiin retrospektiivisesti yleislääkäreiden tutkimusta varten keräämiä kliinisiä tietoja 9700 potilaasta Pohjois-Englannista.  Lääkärit ja sairaanhoitajat tarjosivat tyypin 2 diabetesta tai heikentynyttä glukoositoleranssia (IGT) sairastaville potilaille vaihtoehtoisena hoitomuotona vähän hiilihydraatteja sisältävää ruokavaliota.

Tutkimuksesta poissuljettiin: raskaana olevat, syömishäiriöiset, alipainoiset, tyypin 1 diabetesta sairastavat ja alle 18-vuotiaat. Tietoja kerättiin maliskuusta 2013 marraskuuhun 2018.

Ruokavalio-kokeeseen osallistuneille annettiin kirjalliset ohjeet ja lisätukea potilaan valinnasta ja kliinisestä tarpeesta riippuen.  Kokeeseen valikoitui monenkirjava joukko eri ikäisiä ja erilaisissa elämäntilanteissa eläviä ihmisiä.  Lääkärin ja sairaanhoitajan tapaamisten lisäksi kokeeseen osallistuville tarjottiin säännöllisiä 90 minuutin ”ryhmäistuntoja” lähes kuukausittain.

Ryhmäistuntoihin osallistui myös perheenjäseniä. Kohorttiin valikoitui 154 osallistujaa: 90 miestä ja 64 naista. Kunkin potilaan paino, verenpaine ja verenkuva tutkittiin ennen tutkimuksen alkua. 89 oli tyypin 2 diabetes. Kokeeseen osallistuvien ikähajonta oli 40-89 ja ryhmän keski-ikä 63 vuotta tutkimuksen alkaessa. Useimmat seurantaan osallistuvista olivat ylipainoisia (keskimääräinen painoindeksi 34).

Alkutiedot Lähtötason mittauksiin sisältyivät seuraavat: Paino, verenpaine, kokonaiskolesteroli, HDL-kolesteroli, paaston triglyseriditasot ja verenpainetaudit. Kaikki mittaukset kerättiin käyttämällä Yhdistyneen kuningaskunnan kansallisen terveyspalvelun standardilaitteita ja laboratorioanalyysejä.

Tutkittavia ohjeistettiin vähentämään merkittävästi ruokavalion sisältämiä piilosokereita ja tärkkelyspitoisia elintarvikkeita, kuten perunoita, leipää ja riisiä. Ohjeistuksessa käytettiin apuna tutkimusta varten kehitettyä sokeriekvivalenttijärjestelmää, joka edustaa erilaisten elintarvikkeiden glykeemistä kuormaa.

Esimerkiksi pieni viipale leipää aiheuttaa vastaavan verensokerin nousun kuin kolme teelusikallista sokeria, ja 150 g keitettyä riisiä nostaa verensokeria saman verran kuin kymmenen teelusikallista sokeria.  Sokeriekvivalenttijärjestelmän avulla potilaat ymmärsivät, että esimerkiksi maissihiutaleista, paahtoleivästä ja mehusta muodostuva aamiainen on käytännössä sokeria.

Tulokset

Kahden vuoden tutkimuksen aikana tutkittavien potilaiden verenpaine, paino ja lipidiprofiilit paranivat selvästi ketogeenisellä ruokavaliolla.

Tutkimus osoitti, että hiilihydraattien rajoittaminen on turvallinen ja tehokas tapa hoitaa tyypin 2 diabeteksen oireita.


Yhteenveto

Ketogeenisen ruokavalion vaaroja liioitellaan. Todennäköisesti näin tehdään, koska keto-dieetti ei mahdu perinteisiin oppeihin hyvästä ja terveellisestä ruokavaliosta.

Tutkimuksia ketogeenisen ruokavalion terveyshyödyistä julkaistaan kiihtyvään tahtiin ja yhä useammat lääketieteen ammattilaiset ovat ottaneet ketogeenisen ruokavalion osaksi lihavuutta, verenpainetautia, metabolista oireyhtymää, tyypin 2 diabetesta jne. sairastavien potilaiden hoitosuunnitelmaa.

Ketogeeninen ruokavalio pitää verensokerin ja veren insuliinipitoisuuden tasaisena. Korkea verensokeri ja korkea insuliini assosioituvat  kardiometabolisiin ja kroonisiin sairauksiin, kuten tyypin 2 diabetekseen. Ketogeeninen ruokavalio on paras tapa hoitaa insuliiniresistenssiä, joka on monien sairauksien perussyy. Ruokavalio hillitsee oksidatiivista stressiä ja inflammaatiota, jotka assosioituvat lukemattomiin kroonisiin sairauksiin.

Kansainvälisesti yhä suurempi joukko lääketieteen ammattilaisia ja ketogeeniseen ruokavalioon syvällisesti perehtyneitä ravintoterapeutteja, insinöörejä ja nörttejä luennoi ja kirjoittaa ketogeenisen ruokavalion hyödyistä.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6695889/

https://en.wikipedia.org/wiki/Insulin_resistance

https://www.sciencedirect.com/science/article/pii/S0085253815301745

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6359196/

https://lipidworld.biomedcentral.com/articles/10.1186/s12944-019-1035-2

https://www.ncbi.nlm.nih.gov/pubmed/28193599

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664869/

 




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Onnellista alkanutta vuotta kaikille vielä kerran ja viivästyneesti! Oma vointini on jo ihan kakskyt-kakskyt. Ehkä edessämme on paras vuosikymmen ikinä tai sitten kiinalainen korona pelaa meidät pandemiaan. Maailmanlopun kelloa on jälleen siirretty eteenpäin. Enää on vain 100 sekuntia keskiyöhön. Jatkan yksinäistä sokereiden vastaista ketoiluhömppää artikkelissa: Sokerina pohjalla: Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Mutkaton 6:1-ketoiluni on tuottanut toivottuja tuloksia ja voin hieman paukutella henkseleitäni. Viiden viikon aikana painoni putosi tuskattomasti 5-6 kiloa. Seitsemännellä viikolla paino käväisi ujonoloisesti 85 kilossa, mutta otin sitten menetettyjä kiloja varovasti takaisin erilaisten tekosyiden varjolla. Se onnistui helposti hampurilaisilla ja oluella.

Vointini on pysynyt energisenä, eikä nälkä ole juuri vaivannut. Sehän se ongelma lienee; uskon nälän parantavaan voimaan. Syön ehkä vieläkin liikaa, vaikka luulen, että tehostuneen rasva-aineenvaihdunnan ohella myös päivittäinen kokonaisenergian saantini on ketoillen laskenut.

Oli painon putoamisen syy mikä tahansa, ketogeeninen ruokavalio toimii omalla kohdallani mainiosti. Jännää on, että en kaipaa perunoita, pastaa, leipää ja sokereita enää lainkaan. Ajatus esimerkiksi karkkien tai vaalean leivän syönnistä tuntuu melkeinpä vastenmieliseltä. Tai tuntui, kun kirjoitin nuo sanat. Tänään ahmin karkkia koko alkaneen vuoden edestä. Hyi minua!


Sokerina pohjalla:

Kuinka sokerin terveysriskeistä vaiettiin 50 vuotta?

Anahad O’Connor kirjoitti 12.9.2016 New York Times -lehdessä sokeriteollisuuden toteuttamasta suuresta vedätyksestä 1960-luvulla. En tiedä saiko tämä uutinen ansaitsemaansa näkyvyyttä suomalaisissa uutismedioissa, joten uutisoidaan tämä viiveellä Ruokasodassa.

Sokeriteollisuuden rahoittama härski pseudotutkimus on vaikuttanut ravintotieteisiin ja ravintosuosituksiin jo 50 vuotta ja vaikuttaa yhä. Se on vakava aihe, vaikkakaan ei yllättävä, eikä ehkä uutinenkaan.

Kaikkien aikojen huijaustilastoissa sokeriteollisuuden huijaus yltää neljännelle sijalle. Edelle menee kuuhuijaus, tai se kun amerikkalaiset päättivät lavastaa kuukäynnin, mutta se tuli niin kalliiksi, että he kuvasivat kuuhuijauksen kuussa ja huijasivat vain lavastuksen. Se oli yllättävän ovelaa.

Ei oikeasti! Se on hölmö juttu, mutta kuulostaa hauskalta. Sokeriteollisuuden vedätys jää vain hieman jälkeen öljyteollisuuden huijauksesta ja tupakkateollisuuden katalista toimista. Ne ovat vahvasti todennettuja faktuaalisia tapahtumasarjoja.

Tämän kupletin viheliäinen juoni on se, että sokeriteollisuus maksoi löytyneiden dokumenttien valossa kolmelle Harvardin tutkijalle tutkimuksesta, joissa valkopestiin sokerin ja sydäntautien välinen yhteys. Tämän ei pitäisi yllättää, sillä myös sokereiden ja syöpien yhteydestä haluttiin vaieta. Sen tarinan voit lukea tästä.

Samassa tutkimuksessa epäily sydän- ja verisuonitautien ravitsemuksellisesta syystä vieritettiin tyydyttyneille (koville) eläinrasvoille. Ensimmäiset amerikkalaiset ravitsemussuositukset laadittiin sokeriteollisuudessa kannuksensa ansainneen tohtori Hegstedin suosituksesta rasvavastaisiksi ja sokereita suosiviksi jo 1970-luvulla.

Nämä yhdysvaltalaiset ravitsemussuositukset levisivät ympäri maailman ja lopulta myös Suomeen. Mikä vaikutus huijauksella on ollut lihavuus- ja diabetesepidemioihin? Suoraa kausaalisuhdetta tuskin voidaan osoittaa, mutta korrelaatio on selvä: rasvan rajoittamisen ja sokereiden suosimisen seurauksena aikuistyypin diabetes ja lihavuus kääntyivät selvään kasvuun.

”Se, että sokerin terveyshaittoja vähäteltiin ja rasvojen haittoja liioiteltiin vuosikymmeniä, on suurella todennäköisyydellä vaikuttanut nykyisiin lihavuus- ja diabetesepidemioihin, kertoo Sanjay Basu Stanfordin yliopistosta. Lihavuus ja diabetes yleistyivät vähärasvaisten ja rasvattomien tuotteiden kulutuksen seurauksena.”


Tutkijat salapoliiseina

Tämä tieteellinen huijaus paljastui Kalifornian yliopiston tutkijan esiin kaivamista sokeriteollisuuden dokumenteista. Löydöstä on raportoinut mm. arvostettu lääketieteellinen julkaisu JAMA.

Keskustelu sokerin mahdollista terveyshaitoista vaiennettiin vuosikymmeniksi, kertoo eräs JAMAn julkaiseman raportin tekijöistä, professori Stanton Glantz (Kalifornian yliopisto).

Löydetyt dokumentit todistavat, että Sugar Research Foundation -niminen sokeriteollisuuden järjestö (nykyään Sugar Association), maksoi kolmelle Harvardin tutkijalle nykyrahassa 49 000 dollaria vastaavan summan sokeria, rasvoja ja sydäntauteja käsittelevän tutkimuksen julkaisemisesta 1967.

Sokeriteollisuuden rahoittama tutkimus ohjattiin sokereita suosivaksi

Sugar Research Foundation määritteli tutkijoille ennalta valitun sokerin terveysriskejä vähättelevän tutkimusmateriaalin. Sen lisäksi sokeriteollisuuden johtajat tarkistivat tutkimuksen ennen sen julkaisemista. Sokereiden terveysriskejä vähättelevä ja eläinrasvojen haittoja korostava artikkeli julkaistiin arvovaltaisessa lääketieteellisessä julkaisussa (New England Journal of Medicine).

Sokeriteollisuuden suuresta huijauksesta on vierähtänyt vuosikymmeniä, mutta sama meno jatkuu yhä. Ruokateollisuus rahoittaa ja ohjaa ravitsemusta käsitteleviä tutkimuksia.

2015 New York Times kertoi, että Coca-Cola Company on rahoittanut miljoonilla dollareilla tutkijoita ja tutkimuksia, joissa pyritään kumoamaan sokeria sisältävien juomien ja lihavuuden välinen yhteys. 2016 kesäkuussa AP (Associated Press) kertoi, että makeisvalmistajat rahoittavat tutkimuksia, joiden mukaan makeisia syövät lapset ovat terveempiä ja laihempia kuin lapset, jotka eivät syö makeisia. Tällaisen ei pitäisi hämmästyttää enää tässä totuudenjälkeisessä maailmassa, mutta on se aika härskiä ja järkyttävää toimintaa. Teollisuuden ahneus on ainoa asia, johon enää voi uskoa.

Huijaukseen osallistuneet Harvardin tutkijat ja sokeriteollisuuden johtajat ovat jo kuolleet. Eräs sokeriteollisuudelta rahaa saanut tutkija oli tohtori Mark Hegsted, joka myöhemmin nousi Yhdysvaltojen maatalousministeriön ravitsemusasioiden johtajaksi ja oli laatimassa ensimmäisiä ravitsemussuosituksia 1977. Toinen sokeriteollisuudelta rahaa saanut tutkija oli tohtori Fredrick J. Stare, Harvardin yliopiston ravitsemustieteellisen tiedekunnan johtaja.

Mitäpä sokeri vastasi?

Sugar Association vastasi JAMA:n julkaisemaan raporttiin toteamalla, että vuoden 1967 raportti julkaistiin aikana, jolloin lääketieteellisissä lehdissä ei edellytetty tutkimusten rahoittajien paljastamista. New England Journal of Medicine aloitti tieteellisten raporttien rahoittajien ilmoittamisen vasta vuonna 1984.

Sugar Association myönsi, että avoimuus ja läpinäkyvyys tutkimustoiminnan rahoittajien osalta olisi ollut aiheellista, mutta puolusti julkaistun tutkimuksen tärkeää ja informatiivista roolia tieteellisessä keskustelussa. Sokeriteollisuus painotti vastauksessaan, että vuosikymmenten tutkimukset eivät ole osoittaneet merkittävää korrelaatiota sokerin ja sydäntautien väliltä, toisin kuin American Heart Association ja World Health Organization uskovat.

Tausta

Sota tyydyttyneiden rasvojen ja sokerin terveyshaitoista on jatkunut vuosikymmeniä. Rasvasodan käynnisti Ancel Keysin myöhemmin kyseenalaistetut tutkimukset kovien rasvojen yhteydestä valtimonkovettumatautiin eli ateroskleroosiin. John Yudkin varoitteli sokereiden terveyshaitoista jo 1970-luvulla, mutta hänet leimattiin naurettavaksi pelleksi.

Keskustelu sokereiden ja tyydyttyneiden rasvojen haitoista jatkuu edelleen yhtä aiheellisena kuin 1970-luvulla. Vuosikymmenien ajan ravitsemussuosituksissa on kehotettu välttämään rasvaa ja erityisesti kovia rasvoja. 1970-luvulla alkanut vähärasvaisuutta suosiva buumi johti siihen, että rasvoja korvattiin elintarvikkeissa lisätyillä sokereilla. Monien tutkijoiden ja maallikoiden, kuten allekirjoittaneen, mielestä tämä on tärkein syy aikuistyypin diabeteksen ja ylipainon räjähdysmäiseen kasvuun.

Huijaus toimi – yllättääkö se?

Sokeriteollisuuden kannalta suunnitelma toimi erinomaisesti: huomio sokereiden mahdollisista terveyshaitoista unohdettiin käytännössä kokonaan. Arvostetussa julkaisussa raportoitu tutkimusraportti sai merkittävän näkyvyyden tieteellisessä yhteisössä.

Tohtori Hegsted käytti tutkimusraporttia vakuuttaakseen terveysviranomaiset tyydyttyneiden rasvojen haitoista sydän- ja verisuoniterveydelle. Sokereiden haitoista ei juuri puhuttu muuten kuin tyhjinä kaloreina, jotka saattavat pahimmillaan vahingoittaa hampaita.

Hegstedin raportti toimii yhä yleisimpien ravitsemussuositusten perustana, vaikka Amerikan sydänliitto (AHA) ja Maailman terveysjärjestö (WHO) ovat osoittaneet myös lisätyn sokerin kasvattavan sydän- ja verisuonitautien riskiä. Hölmöksi leimattu Yudkin oli siis oikeassa jo 1970-luvulla.

New Yorkin yliopiston ravitsemuksen, ruokatutkimuksen ja kansanterveyden professori Marion Nestle kirjoitti JAMA:n julkaiseman tutkimusraportin liitteessä, että löydetyt asiakirjat todistavat vakuuttavasti sokeriteollisuuden pyrkimyksestä valkopestä sokereiden rooli sydän- ja verisuonitautien riskitekijänä.

Tohtori Walter Willett, Harvardin TH Chanin kansanterveydenlaitoksen ravitsemusosaston puheenjohtaja, totesi, että akateemiset eturistiriitasäädökset ovat muuttuneet merkittävästi 1960-luvulta lähtien. Hänen mukaansa löydetyt dokumentit ovat tärkeä osoitus siitä, miksi tieteellistä tutkimusta tulisi tukea julkisella rahoituksella sen sijaan, että rahoitus on teollisuuden varassa.

Tohtori Willett lisäsi, että tutkijoilla oli vain rajoitetusti tietoa sokereiden ja rasvojen suhteellisten riskien arvioimiseksi. Tuoreet tutkimukset ovat osoittaneet, että puhdistetut hiilihydraatit ja erityisesti sokeroidut juomat ovat mm. sydän- ja verisuonitautien, lihavuuden ja aikuistyypin diabeteksen riskitekijöitä, mutta myös ravinnosta saatujen rasvojen laatu vaikuttaa sydän- ja verisuonitautien riskiin.

JAMA perusti artikkelinsa tuhansiin sivuihin kirjeenvaihtoa ja muita asiakirjoja, jotka tutkijatohtori Christin E. Kearns löysin Harvardin ja Illinoisin yliopistojen kirjastojen arkistoista. Löydettyjen asiakirjojen mukaan sokeriteollisuuden ylin johtaja John Hickson keskusteli vuonna 1964 muiden sokeriteollisuuden johtajien kanssa suunnitelmasta, jossa yleiseen mielipiteeseen vaikutettaisiin tutkimuksella, tiedotuksella ja lainsäädännöllisin keinoin. Samoja menetelmiä on onnistuneesti soveltanut tupakka- ja öljyteollisuus.

Imperiumin vastaisku

Tutkimukset olivat jo 60-luvulla havainneet merkittävän korrelaation runsaasti sokeria sisältävän ravinnon ja sydänsairauksien väliltä. Samaan aikaan muut tutkijat, kuten Ancel Keys, tutkivat oletusta, jonka mukaan sydänsairauksien riskiä kasvatti ensisijaisesti tyydyttyneet rasvat ja ravinnon sisältämä kolesteroli.

Hicksonin mukaan sokeriteollisuutta huolestuttaviin tutkimuksiin oli vastattava sokeriteollisuuden omalla tutkimuksella, joka kumoaa sokeriin liitetyt negatiiviset terveysväittämät.  Vuonna 1965 Hickson pyysi Harvardin tutkijoita kirjoittamaan raportin, joka kumoaa sokerin terveyshaittoja käsittelevät tutkimukset. Tutkijoille maksettiin 6500 dollaria, joka nykyrahassa vastaa 49 000 dollaria. Hickson valitsi tutkijoille lähdeaineiston ja teki selväksi, että tutkimuksen tulosten pitää suosia sokeria.

Kirjeenvaihdon perusteella Harvardissa työskennellyt tohtori Hegsted vastasi sokeriteollisuuden johtajille: ”Ymmärrämme ongelman ja teemme parhaamme sen korjaamiseksi”. Tutkijat esittelivät tutkimusluonnoksen Hicksonille, joka kertoi olevansa siihen erittäin tyytyväinen. Harvardin tutkijat sivuuttivat tutkimuksessa sokerin terveyshaittoihin viittaavat tiedot ja painottivat tyydyttyneiden rasvojen ja valtimonkovettumataudin välistä yhteyttä.

Tutkimuksen julkaisemisen jälkeen keskustelu sokerin ja sydäntautien välillä vaiettiin kuoliaaksi. Samalla monet terveysviranomaiset hyväksyivät ”terveelliset” vähärasvaisuutta korostavat ruokavaliot.

Nonni. Tämä nyt on tätä. Jos se ei ole totta, niin ainakin se on hyvä tarina!

https://www.nytimes.com/2016/09/13/well/eat/how-the-sugar-industry-shifted-blame-to-fat.html

https://academic.oup.com/ajcn/advance-article/doi/10.1093/ajcn/nqz276/5680464?guestAccessKey=e676e010-0638-423b-a731-6c760b460bd4

https://www.stmichaelshospital.com/media/detail.php?source=hospital_news/2019/1230

https://jamanetwork.com/journals/jamainternalmedicine/article-abstract/2548255