Likaista biologiaa & muutama vesiperä

Biologia on likaista. Paperilla matematiikka on puhdasta ja kaunista, mutta jos ihmisen aineenvaihdunnan toiminta määritellään termodynamiikan ensimmäisellä pääsäännöllä muuttujista piittaamatta, johtopäätökset ovat väistämättä harhaanjohtavia. Likaista biologiaa & muutama vesiperä tutustuu painonhallintaan ja terveyteen vaikuttaviin tekijöihin hieman toisesta vinkkelistä.

Olen aiemmissa kirjoituksissani arvioinut, että LCHF-ruokavaliota noudattavia ja suosittelevia lääkäreitä on muutamista kymmenistä satoihin. Olin väärässä. Pelkästään Kanadassa on lähes 4000 naistentautien lääkäriä, jotka suosittelevat potilailleen LCHF-ruokavaliota osana hoitosuosituksia.

Gary Taubesin mukaan koko maailmassa voi olla jo yli 10 000 lääkäriä, jotka toimivat institutionalisoituja lääketieteen dogmeja vastaan suosittelemalla LCHF-ruokavaliota osana lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoitosuunnitelmaa.

Andreas Eenfeldtin Diet Doctor on maailman johtava lääketieteen ammattilaisten ylläpitämä ketogeeniseen ruokavalioon keskittynyt riippumaton verkkosivusto. Monet pidempään ketoilleet tunnistavat Diet Doctorin suunnannäyttäjien joukosta useita henkilöitä. Tämä henkilögalleria esimerkkinä siitä, että maailmalla yhä useammat lääketieteen ammattilaiset ja ravintoterapeutit luottavat tieteeseen ja tutkimukseen enemmän kuin pölyttyneisiin dogmeihin.

Diet Doctor Team

Tieteellinen tieto ei perustu muuttumattomiin dogmeihin

Koska tieteellinen metodologia on itseään korjaava järjestelmä, oletus on, että paremmin ilmiöitä kuvaava havaintojen ja evidenssin tukema malli korvaa huonommin ilmiöitä selittävän mallin. Perinteinen diet-heart hypoteesi on aikansa elänyt. Se on aika kuopata. Myös kaloriteoria kaipaa kipeästi päivittämistä.

Conclusions: Available evidence from randomized controlled trials shows that replacement of saturated fat in the diet with linoleic acid effectively lowers serum cholesterol but does not support the hypothesis that this translates to a lower risk of death from coronary heart disease or all causes. Findings from the Minnesota Coronary Experiment add to growing evidence that incomplete publication has contributed to overestimation of the benefits of replacing saturated fat with vegetable oils rich in linoleic acid.”

Uudet utkimukset eivät tue Ancel Keysin vuosikymmeniä vanhaa hypoteesiä, jonka mukaan tyydyttyneet rasvat ja kolesteroli aiheuttavat ateroskleroosia ja lisäävät kuolleisuutta.

On totta, että tyydyttyneet rasvat lisäävät ja monityydyttämättömät rasvat vähentävät lipoproteiinien määrää veressä. Tutkimusten mukaan kuolleisuus lisääntyy matalilla kolesterolitasoilla.

Robert Atkins

Palataan historiassa hieman taaksepäin. Robert Atkins ei ollut ensimmäinen ketoilija. Aihetta on käsitelty länsimaisessa lääketietellisessä kirjallisuudessa jo 1700-luvulta lähtien. Paaston ja hiilihydraattien rajoittamisen hyödyt on tunnettu Kiinassa pari vuosituhatta.

Robert Atkins (1930-2003) oli yhdysvaltalainen lääketieteen tohtori, fysiologi ja sydänlääkäri. Perinteisiä ruokavaliosuosituksia noudattanut Atkins kärsi ylipainosta ja masennuksesta. Hän aloitti 33-vuotiaana Alfred W. Penningtonin kehittämän ruokavalion noudattamisen rajoittamalla sokerin ja tärkkelyksen saantia. Vain kuudessa viikossa hänen painonsa putosi 12 kg.

Laihtumisen rohkaisemana hän ryhtyi hoitamaan ylipainoisia potilaitaan samanlaisella ruokavaliolla. Myös potilaiden paino laski ja terveys koheni. Vuonna 1972 Robert Atkins julkaisi maineikkaan laihdutusoppaan: Dr. Atkins’ Diet Revolution: The High Calorie Way to Stay Thin Forever. Vuonna 1992 hän julkaisi toisen kirjansa: Dr. Atkins’ New Diet Revolution, joka toimi lähtölaukauksena vuosituhannen vaihteen jälkeiselle vähähiilihydraattiselle buumille.

On selvää, etteivät terveysviranomaiset ja terveysjärjestöt katsoneet hyvällä Atkinsin oppeja. Hiilihydraattien rajoittamista vastustavat muistavat aina mainita, että Atkins kuoli 125 kiloisena läskinä sydänkohtaukseen, ja että hänellä oli pitkä historia sydänkohtauksia. Tällä urbaanilla legendalla halutaan alleviivata ketogeenisen Atkinsin ruokavalion oletettuja sydänriskejä. tarina on myytti.

Robert Atkins kaatui ja loukkasi päänsä. Sairaalassa hänet punnittiin. Robert Atkins painoi sairaalaan tullessaan 88,5 kiloa. Atkins vaipui sairaalassa koomaan ja sai nesteytystä yhdeksän päivää kestäneen kooman ajan. Sairaalassa Atkinsin paino nousi noin 28 kiloa. Hän siis painoi kuollessaan enemmän kuin sairaalaan saapuessaan. Robert Atkins sairasti kardiomyopatiaa (sydännlihaksen sairaus), jonka todennäköisin aiheuttaja oli infektio. Robert Atkins kuoli kaatumisen aiheuttamaan aivovammaan. Tämä on virallinen lääketieteellinen totuus.

Tutkimusten mukaan Atkinsin dieetti on turvallinen ja tehokas

Vuoden 2000 jälkeen tehdyt tutkimukset ovat osoittaneet, että Atkinsin dieetti on tehokas ruokavalio painonpudotuksessa ja hyödyllinen sydänterveyden riskitekijöiden kannalta. Tutkimukset eivät ole kuitenkaan vakuuttaneet läheskään kaikkia.

Kun sata lääkäriä julkaisi taannoin ketogeenisen ruokavalion terveyshyötyjä painottavan julkilausuman Huffington Postissa, vain muutama viikko myöhemmin ketogeeninen ruokavalio ja Atkinsin dieetti teilattiin mediassa täysin. Kamppailu on ankaraa. Paradigmat kaatuvat väistämättä, mutta väärien tietojen kumoaminen on hidasta.

Miksi ihminen lihoo?

Nykyihminen kehittyi noin 200 000 vuotta sitten. Ravitsemussuositukset otettiin käyttöön Yhdysvalloissa vuonna 1977. Ihmiskunta selvisi ja kehittyi 200 000 vuotta ilman virallisia ohjeita. Kuinka se on mahdollista? Miksi ihminen lihoo, vaikka meillä on vimpan päälle ohjeet oikein syömiseen?

Ihminen kehittyi sekasyöjäksi,koska se oli ainoa tapa selvitä. Ravinto kerättiin luonnosta silloin kun jotain ravintoa oli kerättävissä. Eläimiä saalistettiin ravinnoksi aina kuin se oli mahdollista tai tarpeen. Talvisin saaliseläimet olivat käytännössä varhaisten ihmisten ainoa ravinnonlähde. Tähän kehityshistoriaan nojaa paleodieetin perusta. Ruokaa syötiin silloin, kun sitä oli. Ylimääräisen energian elimistö varastoi rasvasoluihin.

Ihminen lihoo siksi, että evoluutio on mahdollistanut energian varastoimisen rasvasoluihin pahan päivän varalle. Ihminen selviää erinomaisesti ilman ravintoa pitkiäkin aikoja. Miten ihminen lihoo, on kokonaan toinen kysymys, joka liittyy energiansaannin ja kulutuksen tasapainoon sekä noin kymmeneen muuhun muuttujaan.

Luontokappaleet joko varastoivat energiaa tai vaihtolämpöisinä säästävät energian kulutuksessa. Varastoiminen tarkoittaa rasvan keräämistä, koska ravinnon saanti ei aina ollut itsestään selvää.

Lähes kaikki eläimet varastoivat energiaa rasvasoluihin. Lihominen on siis luonnollinen tapa varautua siihen, että ravintoa ei olekaan saatavilla. Rasvasoluihin varastoituu myös rasvaliukoisia vitamiineja.

Kun ihminen ei saa energiaa ravinnosta, elimistössä aktivoituu aineenvaihduntaprosessi, joka purkaa rasvasoluihin varastoituneita triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi verenkiertoon. Vapaiden rasvahappojen karboksyyliryhmät hapetetaan solujen beetaoksidaatiossa asetyylikoentsyymi-A:ksi, jota mitokondriot voivat sitruunahappokierrossa hapettaa energiaksi. Osa asetyylikoentsyymi-A:sta voidaan edelleen muuttaa solujen energiaksi kelpaaviksi ketoaineiksi. Maksa muuttaa ketogeneesissä vapaita rasvahappoja ketoaineiksi, kuten betahydroksibutyraatiksi.

Vapaita aminohappoja, sitruunahappokierron välituotteita, ketoaineita, vettä ja glyserolia voidaan muuttaa glukoosiksi glukoneogeneesissä. Veren punasolut tarvitsevat välttämättä glukoosia, jonka keho osaa itse valmistaa. Aiempien oletusten mukaan aivojen solut eivät ole riippuvaisia glukoosin saannista.

Evoluutio on varmistanut näin sen, että me emme kuole nälkään, jos emme saa heti ruokaa. Terve ihminen voi paastota pelkällä vedellä jopa 30 vuorokautta ja pysyä terveenä ja toimintakykyisenä.

Maailman pisimpään paastosi skotlantilainen Angus Barbieri, joka paastosi veden ja vitamiinipillereiden avulla kokonaista 382 vuorokautta. Paaston aikana hänen painonsa putosi 125 kiloa. Tapaus on hyvin dokumentoitu ja mainitaan mm. Guinnesin ennätysten kirjassa.

Angus Barbieri
Lähde: Wikipedia

Lämpöopin ensimmäinen pääsääntö

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Ongelma on se, että monimutkaiset asiat halutaan yksinkertaistaa. Lihomisen selittäminen energian säilymisellä tarkoittaa sitä, että viivat vedetään suoriksi ja kaikki häiritsevät taustavaikuttajat pyyhitään yhtälöstä.

Tutkiva journalismi on lähestulkoon haudattu. Uutiset julkaistaan sen tarkemmin asioihin paneutumaatta. Monet journalistit käytännössä vain kääntävät uutistoimistojen uutisia ymmärtämättä uutisen aiheesta juuri mitään. Se on valitettavaa, mutta totta.

Kalorioppi toimii periaatteessa hyvin paperilla. Ikävä tieteellinen fakta on, että rumat tosiasiat pilaavat kauniit teoriat. Biologia on likaista. En tarkoita saastaista, vaan tarkoitan, että kaikkien yhtälöön vaikuttavien tekijöiden laskeminen ja mallintaminen jokaiseen ihmiseen päteväksi universaaliksi lainalaisuudeksi on mahdotonta.

Biologia on likaista, koska aineenvaihdunnasta ei voi vetää universaaleja lakeja. Se sisältää liikaa rumia tosiasioita, jotka pilaavat kauniin teorian.

Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biokemiallinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan mekanismeja.

Kalorioppi

Kalori on vanha energian mittayksikkö. Se tarkoittaa lämpömäärää, joka kasvattaa yhden 14,5 asteisen vesigramman lämpötilaa assteella normaalipaineessa. Ravinnosta puhuttaessa pitäisi puhua kilokaloreista.

Tohtorit Newburg ja Johnston esittivät vuonna 1930 hypoteesin, jonka mukaan lihavuus johtuu kalorein mitattuna liian rusaasta ravinnosta, eikä aineenvaihdunnan häiriöstä. Tutkimusaineisto oli niukka, mutta kaloriteoria otettiin vastaan kumoamattomana tieteellisenä faktana.

Montignacin kritiikki kaloriteoriaa vastaan

Ranskalaisen Michel Montignacin periaate on seuraava: ”Lihominen ei johdu liiasta syömisestä vaan huonosta syömisestä.”

Montignacin mukaan kalorien vähentämiseen perustuva laihdutusteoria on 20. vuosisadan suurin ”tieteellinen ankka”. ”Se on ansa, huiputus, hölmö ja vaarallinen olettamus, jolla ei ole mitään tieteellistä perustaa. Ja kuitenkin se on ohjannut ravitsemuskäyttäymistämme yli puolen vuosisadan ajan.”

Montignac selvittää painon kertymisen logiikan seuraavasti: Olettakaamme, että yksilön päivittäinen tarve on 2500 kcal ja hänen saamansa kalorimäärä on pitkän ajan vastannut tätä tarvetta. Mikäli päivittäinen kaloriannos putoaa äkkiä 2000 kcal:iin, seurauksena on todellakin vastaavan vararasvamäärän käyttö ja toteamme painon pudonneen.

Jos päivittäinen kalorimäärä sen sijaan vakiintuu 2000:ksi aiemman 2500:n sijasta, elimistön eloonjäämisvaisto mukauttaa energiatarpeen nopeasti uudelle tasolle. Koska ihmiselle annetaan vain 2000 kcal, hän kuluttaa vain 2000 kcal. Painonmenetys keskeytyy nopeasti. Mutta elimistö ei jää tähän. Itsesäilytysvaisto houkuttelee sen entistä suurempaan varovaisuuteen. Ja tämä varovaisuus johtaa uusien varastojen muodostamiseen. Mikäpä siinä, jos sille annetaan vain 2000 kcal, se vähentää energiantarvettaan entisestään ja kuluttaa esimerkiksi vain 1700 kcal ja tallettaa ylimääräiset 300 kcal vararasvoiksi.

Montignacin mukaan vararasvojen muodostuminen tai muodostumatta jääminen on suoraan riippuvainen insuliinin erityksestä. Insuliinin eritys käynnistyy aina silloin kun veren sokeripitoisuus on nousemassa liian korkeaksi. Sen tehtävänä on auttaa veren glukoosin imeytymistä elimistön kudoksiin. Tarjolla oleva glukoosi käytetään joko tyydyttämään kehon välitöntä energiantarvetta tai, mikäli sitä esiintyy runsaasti, vararasvojen muodostamiseen. (1)
Ajatus, että jokaisen ihmisen biokemiallinen kone noudattaa täsmälleen samalla tavalla termodynamiikan ensimmäistä pääsääntöä, on yhtä hölmö, kuin väite, että kaikkien autojen bensiininkulutus on täsmälleen sama.

Termodynamiikan ensimmäinen pääsääntö:

  • Energiaa ei voida hävittää, se vain muuttaa muotoaan.
  • Termodynaamiseen systeemiin voidaan tuoda energiaa kahdessa eri muodossa työnä W ja lämpönä Q.
  • Tuotu energia muuttuu systeemin sisäenergiaksi U.
  • Sisäenergian muutos on siis systeemiin tuodun energian määrä:

ΔU=Q+W

  • Sisäenergian muutos ilmenee muutoksena systeemin lämpötilassa, paineessa, tilavuudessa tai olomuodossa.
  • Systeemistä voi myös lähteä energiaa. Tällöin systeemi, joko luovuttaa lämpömäärän -Q tai tekee ympäristölle työn -W. Huomaa miinus merkki energian lähtiessä systeemistä.

Syötyjen ja kulutettujen kaloreiden laskeminen on käytännössä mahdotonta. Erilaiset laskurit ja laskentakaavat helpottavat seurantaa, mutta nekin antavat epätäsmällisiä osatotuuksia.

Tietenkin ihminen laihtuu, jos syödyn energian määrä on vähäisempi kuin kulutetun energian määrä, mutta jos aineenvaihdunta toimii normaalisti, se purkaa energianpuutteessa mm. lihasten proteiineja polttoaineeksi. Äärimmäisellä rasvoja rajoittavalla ruokavaliolla ihminen voi ”syödä” omat lihaksensa. (1)

Kaikki laihduttajat tietävät, että laihduttaminen on vaikeampaa kuin lihominen. Meidät on ehdollistettu syömään 4-6 kertaa päivässä (mukaanlukien välipalat), että verensokerimme pysyy tasaisena.

Koska ravintomme koostuu pääasiassa sokereista, verensokerin ja insuliinipitoisuuden vaihtelut aiheuttavat energiapiikkejä ja energiatason nopeita laskuja. Tämä pitää meidät nälkäisinä ympäri vuorokauden. Jatkuvaa nälkää kompensoidaan välipalapatukoilla, pullakahveilla, välipaloilla, snackseillä, virvoitusjuomilla jne.

Tämä aiheuttaa toisaalta kokonaisenergian huomaamattoman kasvun, mutta tärkeämpää on se, kuinka ruoka vaikuttaa verensokeriin ja insuliiniin.

Miksi insuliini on tärkeää?

Kuvaparissa tyypin 1 diabetesta sairastava potilas ennen ja jälkeen insuliinihoidon. Kun haima lopettaa insuliinintuotannon, aineenvaihdunta ei voi käyttää syötyä ravintoa polttoaineena, joten se turvaa välttämättömien elintoimintojen jatkuvuuden purkamalla lihaksiin, maksaan ja rasvakudokseen varastoitua energiaa solujen polttoaineeksi.

Ennen insuliinilääkitystä tyypin 1 diabeetikot nääntyivät nälkään riippumatta siitä, kuinka paljon he söivät.

Haiman beetasolut erittävät vereen insuliinia kahdella mekanismilla.

  1. Ensinnäkin syöminen signaloi aivoille, että elimistö saa ravintoa. Tällöin hypotalamus signaloi haimalle, että ruokaa olisi pian tulossa, joten eritäpä sitä insuliinia vereen.Syöminen vaikuttaa insuliinin eritykseen makuaisti-hypotalamas-haima reitillä. Hypotalamuksen säätelemään insuliinin eritykseen vaikuttaa ainakin makuaisti. (1, 2).
  2. Veren glukoosipitoisuuden kasvu vaikuttaa haiman insuliinin eritykseen suoraan. Haiman Langerhansin saarekkeiden beetasolut aistivat verensokerin muutoksia ja pystyvät autonomisesti säätelemään verensokeria.Verensokerin noustessa haiman beetasolut erittävät vereen insuliinia, joka siivoaa glukoosin (ja muut ravinteet) verestä soluihin. Verensokerin laskiessa haiman alfasolut erittävät vereen glukagonia, joka aktivoi lihaksiin ja maksaan varastoitujen glykogeenien purkamisen glukoosimolekyyleiksi.

Insuliinin merkitystä painonhallinnalle ja terveydelle ei voi vähätellä.

  1. Insuliini on elintärkeä hormoni, jota ilman me kuolisimme.
  2. Insuliini vaikuttaa glukoosin ja muiden ravintoaineiden soluunottoon, glykolyysiin, glykogeenien synteesiin, proteiinien synteesiin sekä elektroninsiirtoketjun toimintaan.
  3. Insuliini estää glukoosia tuottavan glukoneogeneesin käynnistymisen, maksan ja lihasten sokerivarastoja purkavan glykogenolyysin, rasvahappoja purkavan lipolyysin, proteolyysin ja ketogeneesin.

Insuliinin toiminta

Insuliini on energia-aineenvaihdunnan tarvitsema elintärkeä hormoni. Se toimii kuin liikennevalvoja, joka ohjaa solujen energia-aineenvaihduntaa ja energian varastointia.

Solujen energiakylläisyyden perusteella solujen insuliinireseptoreihin kiinnittyneet insuliinimolekyylit päästävät ravintoaineita soluihin, jotka tarvitsevat energiaa ja/tai soluihin, joissa on tilaa varastoida energiaa.

Soluun kiinnittynyt insuliinimolekyyli näyttää glukoosi- ja rasvamolekyyleille vihreää valoa; tänne mahtuu.

Insuliini on porttivahti, joka avaa solut vain yhteen suuntaan: sisälle. Glukagoni insuliinin vastavaikuttajana puolestaan toimii solusta ulos periaatteella ja purkaa mm. glykogeeneihin varastoituneita sokereita verenkiertoon.

Veressä on aina insuliinia, mutta, kun insuliinipitoisuus laskee riittävästi, haima erittää glukagonia,joka purkaa energiavarastoja. Kun maksan ja lihasten sokerivarastot on kulutettu, verenkiertoon erittyy lipolyyttisiä hormoneja (adrenaliini, noradrenaliini, kortikotropiini ja glukagoni), jotka käynnistävät rasvasolujen purkamisen. Insuliini estää rasvasolujen purkamista, eli lipolyysiä. Jos verensokeri on jatkuvasti korkea ja veressä on paljon insuliinia, rasvasolujen purkaminen energiakäyttöön estyy.

Insuliiniresistenssi ja hyperinsulinemia

Jos haiman kyky tuottaa insuliinia loppuu, kuten tyypin 1 diabeteksessa tapahtuu, ravintoaineet eivät pääse verestä soluihin. Insuliinin puutteessa energian tuotanto loppuu ja ihminen nääntyy nälkään, vaikka söisi koko ajan. Tyypin 2 diabeteksessa haima tuottaa alkuun jopa normaalia enemmän insuliinia, mutta solujen insuliiniherkkyyden heikentyminen johtaa siihen, että veressä on liikaa insuliinia (hyperinsulinemia).

Insuliiniresistenssi ja hyperinsulinemia assosioituvat kaikkiin yleisimpiin kroonisiin sairauksiin. Tätä ei vielä tiedetty viime vuosisadan puolivälissä, mutta tieto lisääntyy ja se korjaa vanhoja käsityksiä.

Useimpien sairauksien taustalla on aineenvaihdunnan toimintahäiriö ja tämän aiheuttamat komplikaatiot. Lihavuus on lähes aina oire siitä, että aineenvaihdunnan toiminta on häiriintynyt. Nykyisin on tapana syyllistää ja leimata lihavia, mutta se on väärin. Lihavuus on oire, ei syy.

Hyperinsulinemiaan assosioituvat mm. Alzheimerin ja Parkinsonin taudit, tyypin 2 diabetes, alkoholista riippumaton rasvamaksa, haavainen paksusuolentulehdus, krooninen inflammaatio, lihavuus, ateroskleroosi, kardiomyopatia, sydänhalvaukset ja verenpaine. Edelliset kuvankaappaukset Catherine Kroftsin videolta.

Insuliini rakentaa lihas- ja rasvakudosta

Insuliini vaikuttaa myös anabolisiin aineenvaihduntatapahtumiin, kuten energian varastoimiseen lihasten ja maksan glykogeeneihin ja rasvasoluihin sekä esimerkiksi lihaskudosta rakentavaan proteiinisynteesiin. Tämä on äärimmäisen tärkeää.

Kun verenkierrossa on liikaa energiaravinteita (glukoosia ja rasvaa), ravintoaineet ohjataan ensin soluihin, jotka tarvitsevat energiaa. Ylimääräinen glukoosi varastoidaan ensimmäiseksi maksan ja lihasten sokerivarastoihin (glykogeenit), johon mahtuu keskimäärin 250-500 grammaa sokeria ihmisen lihaskunnosta riippuen.

Glukoosi, joka ei mahdu glykogeeneihin, varastoidaan rasvasoluihin. Myös ylimääräinen rasva ohjataan rasvasoluihin. Insuliinilla on keskeinen rooli energiaravinteiden ohjaamisessa soluihin. Solut käyttävät energian lähteenä joko rasvaa tai glukoosia. Solu ei voi samanaikaisesti sekä polttaa, että varastoida energiaa. Niin ei vain tapahdu. Tämä on periaatteessa perinteisen kaloriopin mukainen mekanismi.

Kiinnostavaksi tilanne muuttuu, kun likainen biologia kumoaa perinteisen mallin. Jos ja kun veressä on liikaa sokeria (hyperglykemia) ja insuliinia (hyperinsulinemia), sokeri voidaan varastoida vain rasvasoluihin, jossa glukoosi muutetaan lipogeneesissä triglyserideiksi. Jatkuvasti koholla oleva insuliini johtaa solujen insuliiniresistenssiin, minkä seurauksena insuliinin kyky siivota verestä ravintoaineet soluihin heikkenee. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, joten insuliini ohjaa yhä enemmän ravintoa verenkierrosta rasvasoluihin samalla, kun insuliiniresistenttien lihassolujen energiansaanti vähenee. Tämän seurauksena ihminen alkaa lihoa.

Insuliiniresistentti varastoi enemmän energiaa rasvasoluihn

Mitä tämä käytännössä tarkoittaa? Se tarkoittaa sitä, että samasta syödystä energiamäärästä insuliini varastoi suhteessa suuremman osan rasvakudokseen, koska ravintoa energiaksi polttavien lihassolujen kyky vastaanottaa energiaa on heikentynyt. Insuliiniresistentin ihmisen lihominen voi alkaa, vaikka kilokalorimääräisesti energiansaanti pysyisi aiemmalla tasolla. Insuliiniresistenssi vaikuttaa lihomiseen satunnaista ylensyöntiä enemmän.

Veressä on aina hieman insuliinia. Proteiinit ja rasvat lisäävät insuliinin eritystä, koska energia-aineenvaihdunta loppuu ja ihminen nääntyy nälkään, jos insuliinia ei ole saatavilla. Glukoosi kohottaa insuliinitasoja tuplasti enemmän kuin proteiini ja moninkertaisesti enemmän kuin rasva. Liikaa hiilihydraatteja sisältävä ravinto pitää verensokerin liian korkealla, jolloin insuliinin eritys lisääntyy ja vähitellen jatkuvasti koholla olevat verensokeri ja insuliini alkavat vaikuttaa negatiivisesti aineenvaihdunnan toimintaan. Tämä ennakoi insuliiniresistenssia, joka on useimpien kardiometabolisten sairauksien tärkein aiheuttaja.

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biologinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan jänniä mekanismeja.

Se, että eräät konservatiiviset ja institutionalisoituneet tieteestä piittaamattomat ravitsemusneuvojat väittävät, ettei hormoneilla, kuten insuliinilla ole suurtakaan merkitystä painon kannalta, on raivostuttavaa paskapuhetta.

Yksinkertaisesti: keho ei voi varastoida sokereita tai läskiä ilman insuliinin välittävää vaikutusta.

Etanolin aineenvaihdunta

Entä, jos laitamme energian tilalle alkoholin? Termodynamiikan ensimmäisen pääsäännön mukaan juodun alkoholin pitäisi poistua kehosta, koska muuten ylimääräinen alkohli varastoituisi elimistöön alkoholina tai läskinä.

Aineenvaihdunta polttaa juotua alkoholia muiksi aineiksi. Myös ravinnon sisältämä energia muuttuu aineenvaihdunnassa. Ravinto ei ole pelkkää energiaa.

Lämpöoppi toimii, mutta siinä on huomioitava myös yhtälöön vaikuttavat lukemattomat muuttujat, koska muuten siihen ei voi luottaa.
Etanoli on luonnosta ja alkoholijuomista löytyvä alkoholi, joka metaboloituu monimutkaisella katabolisella aineenvaihduntareitillä. Useat entsyymit osallistuvat etanolin prosessointiin ensin asetaldehydiksi ja edelleen etikkahapoksi ja asetyylikoentsyymi-A:ksi.

Kun asetyylikoentsyymi-A on muodostunut, siitä tulee sitruunahappokierron substraatti, joka hapetetaan solujen mitokondrioissa energiaksi. Sitruunahappokierron jäännöstuotteina on vettä ja hiilidioksidia.

Entsyymien esiintymisessä ja saatavuudessa olevien erojen vuoksi eri ikäiset ihmiset käsittelevät etanolia eri aineenvaihduntareiteillä. Maksa on tärkein etanolin aineenvaihduntaan osallistuva elin, koska maksassa esiintyy korkeina pitoisuuksina etanolin aineenvaihdunnan tarvitsemia entsyymeitä.

Ruoansulatusjärjestelmä tuottaa noin 3 g etanolia päivässä fermentoimalla ravintoa. Etanolin katabolinen hajoaminen on välttämätöntä paitsi ihmisten, myös kaikkien tunnettujen organismien, elämälle.

Eräät etanolin aineenvaihduntaan liittyvien entsyymien aminohapposekvenssit eivät ole muuttuneet 3,5 miljardiin vuoteen. Kaikki organismit tuottavat alkoholia pieninä määrinä useilla aineenvaihduntareiteillä.

Etanolia syntyy pääasiassa rasvahappojen synteesin, glyserolipidimetabolian, ja sappihapon biosynteesireittien kautta. Jos keholla ei olisi mekanismia alkoholien katabolisoimiseksi, alkoholit kumuloituisivat elimistöön ja muuttuisivat myrkyllisiksi.

Ehkä tämän vuoksi evoluutio on kehittänyt keinon katabolisoida etanolia myös sulfotransferaasin avulla. Sulfotransferaasit sulfonoivat serebrosideja sulfatideiksi. Serebrosidit ovat sfingolipideihin kuuluvia glykolipidejä, jotka vaikuttavat mm. hermokudoksessa.

Serebrosidien rakenne koostuu sfingosiinistä, rasvahappo-osasta ja glukoosista tai galaktoosista. Galaktooseja sisältäviä serebrosideja esiintyy erityisesti myeliinistä. No niin. Pitikö se viina vetää tähänkin juttuun? Ohessa etanolin aineenvaihduntareitti

Kuvankaappaus: Wikipedia

Kuinka etanolin aineenvaihdunta liittyy termodynamiikan ensimmäiseen pääsääntöön?Aineenvaihdunta muuttaa etanolin energiaksi, mutta ei varastoi etanolia soluihin alkoholina. Itse asiassa aineenvaihdunta ei edes osaa muuttaa etanolia läskiksi.

Lihottaako alkoholi ja miten se lihottaa?

Alkoholi sisältää noin 7 kcal/g energiaa. Puhtaassa etanolissa on enemmän energiaa kuin sokerissa ja melkein saman verran kuin rasvassa.

Alkoholi voi vaikuttaa lihomiseen ja rasvoittaa maksaa, mutta ei sen vuoksi, että laskennallisesti etanolissa on paljon energiaa. Lihomiseen ja maksan rasvoittumiseen vaikuttavat ne muuttujat, jotka sotkevat puhtaan termodynamiikan ensimmäisen pääsäännön kauniin yhtälön likaisella biologialla.

Mitä alkoholille tapahtuu? Kun ihminen juo alkoholia, maksa paiskii ylitöitä. Entsyymi nimeltä Alkoholidehydrogenaasi (ADH) hapettaa alkoholin asetaldehydiksi. Alkoholia palaa noin 0,1 g/painokilo/h, eli 70-kiloinen henkilö polttaa 7 grammaa alkoholia tunnissa.

Aldehydidehydrogenaasi metaboloi asetaldehydistä edelleen asetaattia. Asyyli-CoA syntaasi (ACSS2) ja asetyyli-CoA syntaasi (ACSS1) syntetisoivat asetaatista asetyylikoentsyymi-A:ta. Kun asetyylikoentsyymi-A on muodostunut, se siirtyy mitokondrioiden sitruunahappokiertoon, jossa siitä hapetetaan energiaa ja jäännöstuotteena on vettä ja hiilidioksidia. Kaikki energiaa tuottavat ravinteet muuttuvat aineenvaihdunnassa asetyylikoentsyymi-A:ksi, joka poltetaan vedeksi ja hiilidioksidiksi.

Alkoholin sisältämät sokerit lihottavat, alkoholi hidastaa rasvan palamista ja kasvattaa ruokahalua. Jos alkoholin yhteydessä syö energiatiheää ruokaa, alkoholi lisää ravinnon sisältämän rasvan ja hiilihydraattien varastoimista mm. maksaan. Puhdas alkoholi ei muutu elimistössä läskiksi. Se on sitä likaista biologiaa, joka ei sovi yhteen termodynamiikan ensimmäisen pääsäännön kanssa. Eräs alkoliin liittyvä kiinnostava huomio on se, että alkoholi itse asiassa parantaa solujen insuliinisensitiivisyyttä.

Runsaan alkoholin nauttimisen seurauksena veren alkoholipitoisuus pysyy korkeana kunnes maksa on prosessoinut kaiken alkoholin asetaldehydiksi, astetaatiksi ja asetyylikoentsyymi-A:ksi, joka hapetetaan sitruunahappokierrossa energiaksi. Jo tämä itsessään todistaa, että keho ei osaa muuttaa alkoholia läskiksi. Elimistö metabolisoi alkoholin ennen muita ravinteita. Jos ihminen syö, kun veressä on alkoholia, syöty ravinto muutetaan energiaksi tai varastoidaan vasta alkoholin palamisen jälkeen. Tämä voi lihottaa.

Aineenvaihdunta on siitä merkillinen biokemiallinen järjestelmä, että rasvat eivät aina varastoidu läskinä, mutta hiilihydraatit joudutaan joskus muuttamaan läskiksi.

Energiaravinteet: rasvat, hiilihydraatit ja proteiinit seuraavat kukin omia kemiallisia aineenvaihduntareittejään. Niillä on elimistössä muitakin tehtäviä kuin energian tuottaminen.

Alkoholiesimerkin takoituksena oli havainnollistaa, että aineenvaihdunnan kannalta tapahtumat eivät ole yksinkertaisesti sisään-ulos-tapahtumia, vaan paljon paljon monimutkaisempia reaktioketjuja, joihin vaikuttavat mm. geenit, sukupuoli, ikä ja hormonit.

Me tiesimme tämän aina, mutta emme ymmärtäneet. Alkoholin aiheuttama humalatila jatkuu, kunnes maksa on polttanut kaiken alkoholin verestä. Alkoholin sisältämä energia (kalorit) palaa, mutta ei varastoidu.

Lihava ihminen – Homo Corpulentus

Lihomiseen vaikuttaa ravinnon sisältämän energian lisäksi mm. ympäristö, geenit, hormonit, sukupuoli,ikä, suolistoflooran koostumus, stressi, unen määrä ja laatu, sekä ruumiinrakenne, eli kehon rasva- ja lihaskudoksen suhde. Näillä kaikilla on huomattava merkitys siihen, kuinka elimistö käyttää ravinnosta saatuja kaloreita, ja kuinka ihminen lihoo. Lihomiseen vaikuttavia tekijöitä kutsutaan obesogeneettiseksi potentiaaliksi.

Yleisesti ottaen aineenvaihdunta varastoi energiaa silloin kun energiansaanti ylittää kulutuksen. Tämä on selvää, mutta tutkimuksista tiedetään, että samaa ruokaa saman verran syövien ihmisten aineenvaihdunnan tapa käsitellä ravinnosta saatua energiaa poikkeaa toisistaan.

Tämä on osoitettu mm. identtisillä kaksosilla, jotka ovat syöneet laskennallisesti saman verran energiaa, mutta toinen on pysynyt hoikkana ja toinen lihonut. Kuinka se on mahdollista? Identtisillä kaksosilla on havaittu suoliston mikrobiomin vaikutus energia-aineenvaihduntaan. Lajistoltaan runsaampi mikrobiomi on yhteydessä tehokkaamaan aineenvaihduntaan ja energian kulutukseen, kun lajistoltaan köyhempi mikrobiomi assosioituu lihomiseen.

Ravinnolla on lihomisen kannalta merkittävä rooli, mutta jopa 70 % kehonpainoon vaikuttavista muuttujista johtuu geneettisistä tekijöistä, kertoi Professori Alfredo Martinez (Center of Nutrition Research at the University of Navarra, Pamplona, Espanja) Nature Reviews Disease Primers-lehdelle.

Melanokortiini 4 reseptori -geenimuutos näyttää liittyvän lihavilla ihmisillä selvästi ahmimishäiriöön. Sveitsiläistutkijat totesivat, että kaikki tätä geenimuutosta kantavat erittäin lihavat potilaat kärsivät ahmimishäiriöstä. Melanokortiini 4 reseptorin geenimuutosta on kahden tuoreen tutkimuksen mukaan runsaalla viidellä prosentilla lihavista ihmisistä. Geenimuunnos vaikuttaa ruokahalun sääntelyyn aivojen hypotalamuksessa.”Duodecim

Lihomisalttiuteen vaikuttavia geenimuutoksia on löydetty 118. Yksittäinen muutos ei kasvata lihomisen riskiä merkittävästi, mutta ihmisillä, joilla on useita lihomisalttiuteen vaikuttavia geenimuutoksia, on vahva taipumus lihomiseen kaloreista ja liikunnan määrästä riippumatta. Esimerkiksi ankyrin-B geenin muutokset lisäävät glukoosin kulkua rasvasoluihin.

Myös äidin paino vaikuttaa raskauden ja imetyksen aikana lapsen kehitykseen. Professori Martinezin mukaan raskaudenaikainen lihominen ensimmäisten 20 raskausviikon aikana lisää syntyvän lapsen ylipainoisuuden riskiä. Ilmiö palautuu sikiöaikaiseen aineenvaihduntaan, joka vaikuttaa pysyvästi lapsen geeneihin.

Toisaalta äidin imetyksen aikainen ravinto voi aiheuttaa vastaavanlaisia epigeneettisiä muutoksia lapsen insuliininsäätelyä ohjaavissa geeneissä ja altistaa lapsen myöhemmin elämässä insuliiniherkkyyden alenemiselle ja insuliiniresistenssille, kertoo professori Mark H. Vickers (Liggins Institute at the University of Auckland, New Zealand) Frontiers in Endocinology-lehdessä.

Kolesteroli

Yritän kirjoittaa kolesterolista oman tutkielman, koska aihe on äärimmäisen laaja ja monimutkainen.

Ei ole olemassa hyvää tai pahaa kolesterolia. On vain kolesterolia. Jos kolesterolimolekyyliä muutetaan yhdelläkin atomilla puoleen tai toiseen, se ei enää ole kolesterolia.

LDL, HDL ja kylomikronit (yms.) ovat rasvaa, kolesterolia ja vitamiineja kuljettavia lipoproteiineja. Sellaisina ne ovat aivan välttämättömiä rasva-aineenvaihdunnan normaalille toiminnalle. Se, että lipoproteiineja kutsutaan kolesteroliksi on hyvin harhaanjohtavaa.

Kolesterolisynteesi tuottaa kolesterolia, joka on mm. steroidihormonien, kuten estrogeenin, testosteronin ja D-vitamiinin synteesin välttämätön lähtöaine. Ruoansulatusnesteet tarvitsevat kolesterolia, aivot tarvitsevat kolesterolia, hermoratoja suojaavissa myeliinikalvoissa on kolesterolia ja solut tarvitsevat kolesterolia solukalvoihin. Joka päivä uusiutuu noin 200 grammaa soluja, joiden solukalvojen yksi rakennusaine on kolesteroli. Ihmisen kolesterolista 25 % on aivoissa, ja ravinto ei lisää kokonaiskolesterolia juuri lainkaan. Elimistö tuottaa sen verran kolesterolia kuin se tarvitsee.

Esimerkiksi suomalaisen väitöstutkimuksen mukaan naisten kuolleisuus lähtee kasvuun, jos kokonaiskolesteroli laskee neljään tai sen alle. Mutta tutustutaan kolesteroliin toisessa artikkelissa.

Inspiraation ja tiedon lähteitä

Gary Taubes

Robert Lustig

Paul Mason

Catherine Crofts

Nina Teicholz

Andreas Eenfeldt

Jason Fung

Georgia Erde

Benjamin Bikaman

Stephen Phinney

Darius Mozaffarian
Tim Noakes

David Unwin

Jeffry Gerber

Ted Naiman

Ivor Cummins

Dave Feldman




Ketogeeninen ruokavalio ja terveys

Korkea verenpaine on huonojen ravitsemustottumusten jälkeen toiseksi yleisin sairastumisen riskiä lisäävä tekijä, kertoo David J. Unwin (lue tutkimus tästä). Unwin on vuoden 2012 jälkeen hoitanut lihavia, korkeaa verenpainetta ja aikuistyypin diabetesta sairastavia potilaita ketogeenisellä ruokavaliolla. Tulokset ovat olleet hyviä.  Ketogeeninen ruokavalio ja terveys on laaja katsaus ketoilun positiivisiin terveysvaikutuksiin.

Kymmenet lääkärit ympäri maailman suosittelevat ketogeenistä ruokavaliota laihduttamiseen ja kardiometabolisten sairauksien hoitoon.

Uuden ravitsemusmallin omaksumisen vaikeus on siinä, että kasvavasta tutkimusnäytöstä ja parantuneista potilaista huolimatta ketogeeninen ruokavalio ei sovi nykyisiin ravitsemusmalleihin. Se haastaa vuosikymmeniä vallalla olleet ravitsemusopit ja lääketieteen paradigmat.

Ketogeeninen ruokavalio olettaa, että tyydyttyneisiin rasvoihin perustuva energiansaanti laihduttaa ja pitää kehon terveenä. Se sotii kaikkea oppimaamme vastaan.

Tieteen itseään korjaava periaate sopii huonosti ravitsemustieteen institutionalisoituihin dogmeihin. Jos tutkimukset antavat tuloksia, jotka eivät tue vallalla olevia käsityksiä, vanhoja oppeja pitää korjata vastaamaan uusia havaintoja.

Onko ketoilu vaarallista, koska siinä syödään paljon rasvaa?

Oppi rasvojen terveyshaitoista on rakennettu tieteellisesti hataralle perustalle. Rasvojen yhteys sydän- ja verisuonitauteihin on tieteellisesti kyseenalaistettu, mutta tämän paradigman asema ravitsemustieteessä on horjumaton.

Laajan kohorttitutkimusten meta-analyysin mukaan tyydyttyneet rasvat eivät lisää sydän- ja verisuonitautien riskiä.

” This current meta-analysis of cohort studies suggested that total fat, SFA, MUFA, and PUFA intake were not associated with the risk of cardiovascular disease. However, we found that higher TFA intake is associated with greater risk of CVDs in a dose-response fashion. Furthermore, the subgroup analysis found a cardio-protective effect of PUFA in studies followed up for more than 10 years.” Lue meta-analyysi tästä!

Olen laihtunut ketogeenisellä ruokavaliolla kolmessa kuukaudessa 9-10 kiloa. Ruokavalioni perusravinne on rasva, jota syön valtavasti virallisiin saantisuosituksiin nähden.  Verensokerini on hyvä 4,5-5,5. Verenpaineet ovat keskimäärin 135/85/80 -tasolla, mutta vaihteluväli on +/-10 suuntaansa.

Laihtuminen on ollut käsittämättömän helppoa, ja oloni on säilynyt koko ajan energisenä. Tältä osin uskallan suositella ruokavaliota muillekin. Tässä esiin tulevat lääketieteelliset havainnot ja väitteet perustuvat useisiin lähteisiin, joihin viittaan tekstissä ja tekstin jälkeen.

Kardiometabolinen syndrooma (CMS)

Kardiometaboliseen syndroomaan (CMS) sisältyy joukko aineenvaihduntaan, verenkiertoon ja munuaisiin assosioituvia häiriöitä. Yhteisiä nimittäjiä kardiometabolisille sairauksille ovat viskeraalinen rasva, keskivartalolihavuus ja insuliiniresistenssi.

Keskivartalolihavuuteen liittyy usein insuliinin heikompi vaikutus ääreiskudoksissa ja/tai seerumin korkea insuliinipitoisuus.

CMS:n oireisiin kuuluvat mm. korkea verenpaine, poikkeavuudet verenpaineen ja sykkeen vuorokausivaihtelussa, diabetekseen viittaavat rasva- ja sokeriaineenvaihdunnan muutokset, aikuistyypin diabetes, alkoholista riippumaton rasvamaksa, lisääntynyt verenhyytymistaipumus, kihti sekä sydän- ja verenkiertoelinten lisääntynyt tulehdusriski.

Epidemiologisissa tutkimuksissa on havaittu, että kardiometabolinen oireyhtymä kasvattaa sepelvaltimotauti-, aivohalvaus-, sydän- ja verisuonitautikuolleisuus- ja kokonaiskuolleisuus-riskejä.

Rohkeimpien lääkäreiden ja ketogeenisen ruokavalion puolestapuhujien, kuten Joseph R. Kraftin ja Ted Naimanin mukaan useimmat sydän- ja verisuonitaudit assosioituvat diagnosoituun tai diagnosoimattomaan diabetekseen. Tämä näkemys sopii hyvin havaintoon, että diabeetikoiden sydän- ja verisuonitautikuolleisuus on hyvin korkea.

Diabeteksen laboratoriodiagnoosin kehitykseen 1970-luvulla osallistuneen tri Joseph R. Kraftin mukaan hyperinsulinemia liittyy vahvasti verenpainetaudin, lihavuuden, ateroskleroosin, neurodegeneratiivisten sairauksien (Parkinsonin tauti, Alzheimerin tauti), eräiden syöpien ja verisuonitautien kehittymiseen.

Kardiometabolinen oireyhtymä ja kardiometaboliset sairaudet yleistyvät vauhdilla. Kraft varoitti diabetesepidemiasta ja hyperinsulinemiaan assosioituvista sairauksista jo 1970-luvulla.

Yhteinen nimittäjä kardiometabolisille sairauksille on samanaikainen insuliiniresistenssin aiheuttama hyperinsulinemia. Paikallinen insuliiniresistenssi ei yksistään yleensä aiheuta sairauksia, sillä aineenvaihdunta turvautuu siihen joskus tarkoituksella. Insuliiniresistenssi ja korkeat insuliinitasot yhdessä ovat vakava uhka terveydelle.

Lihavien prosentuaalinen osuus väestöstä Euroopassa

Synkkiä lukuja

Monet sairastuvat, vaikka he liikkuvat ja noudattavat yleisiä ravitsemussuosituksia. Länsimaissa on maailman paras sairaanhoitojärjestelmä, mutta samanaikaisesti todella sairas väestö.

Ylipainoisten ja lihavien määrä on Maailman terveysjärjestön (WHO) mukaan kolminkertaistunut vuoden 1975 jälkeen.

Kiinassa lihavia on 5-6 prosenttia väestöstä, mutta suurissa kiinalaiskaupungeissa, joissa syödään eniten pikaruokaa, lihavien osuus on lyhyessä ajassa kasvanut yli 20 prosenttiin; ylipainoisten ja lihavien kiinalaisten määrä on vain 10 viime vuoden aikana kolminkertaistunut. Keskivartalolihavien kiinalaisten määrä on samana aikana lisääntynyt 50 prosenttia.

Amerikkalaisista 35,4 prosenttia on lihavia, 61,5 % vyötärölihavia. Noin 100 miljoonaa amerikkalaista sairastaa tyypin 2 diabetesta tai esidiabetesta. Euroopan unionin alueella 30-70 % ihmisistä on jo ylipainoisia ja 10-30 % lihavia. EU:ssa lähes 30 miljoonaa ihmistä sairastaa diabetesta. Koko Euroopan (56 valtiota) alueella diabetesta sairastaa noin 60 miljoonaa ihmistä.

Diabetes

Aikuistyypin diabetesta sairastavien määrä on kasvanut noin 108 miljoonasta (1980) 422 miljoonaan (2014). Prosentuaalisesti maailman väestössä diabeteksen esiintyvyys on kasvanut 4,3 prosentista 8,8 prosenttiin neljässä vuosikymmenessä. Kasvun uskotaan jatkuvan. Nykyisen trendin perusteella vuonna 2045 joka kymmenes maailman ihminen sairastaa diabetesta.

Diabetesta sairastavien lisäksi jopa 352 miljoonan ihmisen glukoosin sieto on heikentynyt ja he sairastavat esidiabetesta. Mikä tällaisen selittää ja pitääkö tästä huolestua?

Minun mielestäni pitää huolestua. Diabetes yleistyy nopeimmin pieni- ja keskituloisten parissa, mutta se yleistyy myös muissa sosioekonomisissa väestöryhmissä. Diabetes on tärkein sokeutta, munuaisvaurioita, sydänkohtauksia ja alaraajojen amputaatioita aiheuttava sairaus.

Vuonna 2016 1,6 miljoonaa ihmistä menehtyi diabeteksen seurauksena ja näiden lisäksi 2,2 miljoonaa kuolemantapausta assosioitui vahvasti korkeaan verensokeriin (WHO).

IDF:n tilastojen mukaan diabetes ja siihen liittyvät komplikaatiot tappavat vuosittain noin 4 miljoonaa ihmistä. Tilastollisesti yksi ihminen kuolee diabeteksen seurauksena seitsemän sekunnin välein. Inhimillisen kärsimyksen lisäksi tyypin 2 diabetes tulee yhteiskunnille mahdottoman kalliiksi.

”The figures given in the IDF Atlas fit well with the estimates of an international consortium reporting worldwide trends in diabetes since 1980 based on a pooled analysis of 751 population-based studies with 4·4 million participants. According to this group global age-standardised diabetes prevalence increased from 4.3% (95% CI 2.4-7.0) in 1980 to 9.0% (7.2-11.1) in 2014 in men, and from 5.0% (2.9-7.9) to 7.9% (6.4-9.7) in women.”

Syitä diabetesepidemialle voidaan etsiä esimerkiksi vähentyneestä arkiliikunnasta, väestön lisääntymisestä ja ihmisten odotettavissa olevan elinajan kasvusta. Nämä eivät kuitenkaan selitä nykyistä diabetesepidemiaa riittävän hyvin, sillä miljoonat raskasta fyysistä työtä tekevät ja ravintosuosituksia noudattavat lihovat ja sairastuvat diabetekseen.

Eräs tärkeimmistä diabeteksen kasvua selittävistä tekijöistä on keskivartalolihavuuden nopea lisääntyminen lähes kaikissa sosioekonomisissa ryhmissä ympäri maailman.

Mistä tiedän, onko minulla diabetes?

Terveellä ihmisellä paaston jälkeinen plasman sokeri on 6 mmol/l tai vähemmän. Kahden tunnin sokerirasituksessa terveen ihmisen verensokeri pysyy alle 7,8 mmol/l.

Kun paastoverinäytteestä mitataan sokeria 6,1–6,9 mmol/l, kyseessä on kohonnut paastoplasman sokeri eli heikentynyt paastosokeri (IFG, impaired fasting glucose).

Heikentynyt sokerinsieto (IGT, impaired glucose tolerance) todetaan, kun verensokeripitoisuus on 7,8–11 mmol/l sokerirasituskokeessa 2 tunnin kohdalla tai 2 tuntia aterian jälkeen.

Tutkimuksessa ketogeeninen ruokavalio oli perinteistä vähärasvaista diabetesruokavaliota parempi:

”Individuals with type 2 diabetes improved their glycemic control and lost more weight after being randomized to a very low-carbohydrate ketogenic diet and lifestyle online program rather than a conventional, low-fat diabetes diet online program. Thus, the online delivery of these very low-carbohydrate ketogenic diet and lifestyle recommendations may allow them to have a wider reach in the successful self-management of type 2 diabetes.”

Hyvä uutinen on se, että tyypin 2 diabetes ei ole krooninen sairaus. Se on voitettavissa! Tyypin 2 diabetes voidaan hoitaa esimerkiksi vähäkalorisella tai ketogeenisellä ruokavaliolla. Näistä jälkimmäinen on tutkimusten perusteella parempi.

”A literature search was performed, and a total of 99 original articles containing information pertaining to diabetes reversal or remission were included. Results: Evidence exists that T2D reversal is achievable using bariatric surgery, low-calorie diets (LCD), or carbohydrate restriction (LC).” Lue tästä!

Lihavien määrän kasvu eri väestöissä

Pitääkö klassinen ruokapyramidi kaataa?

Perinteiset lautasmallit ja ravintopyramidit eivät selvästikään suojele meitä lihomiselta ja sairastumiselta. Sairaudet yleistyvät, vaikka ihmiset noudattavat suosituksia, liikkuvat ja lääketiede kehittyy. Missä vika?

Eräs perinteisen ravintopyramidin kaatajista on professori Tim Noakes, joka on elämänsä aikana juossut kymmeniä maratoneja ja ultramaratoneja. Noakes kirjoitti uransa alussa vähärasvaiseen ja runsaasti hiilihydraatteja sisältävään ruokavalioon kannustavia kirjoja.

Noakes käänsi oman ravitsemuksensa ylösalaisin sairastuttuaan aikuistyypin diabetekseen. Hän sairastui, vaikka vältteli rasvoja, liikkui hyvin aktiivisesti ja söi virallisten suositusten mukaisesti. Vallalla olevan mallin mukaan maailman ”timnoakesien” ei pitäisi lihoa tai sairastua aikuistyypin diabetekseen, mutta monet maailman ”timnoakesit” sairastuvat.

Tohtori David Unwin kertoo, että vuonna 1986 hänen vastaanotollaan kävi 57 aikuistyypin diabetesta sairastavaa. Tauti oli tuohon aikaan vielä melko harvinainen ja siihen sairastuivat lähinnä iäkkäät ihmiset. Vuonna 2012 samalla vastaanotolla tyypin 2 diabeetikkoja oli jo 472.


Insuliini on anabolinen hormoni

Verenpainetauti, lihavuus, dyslipidemia ja glukoosi-intoleranssi assosioituvat hyperinsulinemiaan. Oirekirjo tunnetaan metabolisena oireyhtymänä. Hyperinsulinemia vaikuttaa verenpaineeseen lisäämällä munuaisten natriumretentiota (natriumin säilytystä).

Insuliini on aminohapoista muodostuva hormoni. Hormonit ovat elimistön valmistamia endogeenisiä viestinvälittäjämolekyylejä, jotka kulkevat erittymispaikasta kohdesoluihin pääosin verenkierron välityksellä. Hormoni voi vaikuttaa pieninäkin määrinä soluun, jossa on hormonille spesifisiä reseptoreja.

Eri puolilla elimistöä sijaitsevat umpirauhaset erittävät hormoneja aivolisäkkeen ja hypotalamuksen säätelemänä. Insuliinin eritystä ohjaa veren sokeripitoisuus. Glukoosi aiheuttaa piikin insuliinin erityksessä. Proteiinit ja rasvat vaikuttavat insuliinin eritykseen paljon sokereita maltillisemmin.


Mitä hormonit ovat?

Hormonit, jotka voivat olla joko vesiliukoisia (katekoliamiinit, glukagoni ja insuliini) tai rasvaliukoisia (D-vitamiini, steroidit ja kilpirauhashormonit) säätelevät lähes kaikkia elimistön aineenvaihduntaprosesseja. Ne ovat aminohappo-, rasvahappo-, proteiini- ja peptidihormoneja tai steroideja.

Aminohappoyhdisteistä muodostuneet hormonit muodostuvat tyrosiinista ja tryptofaanista. näihin hormoneihin kuuluvat kilpirauhasen erittämät kilpirauhashormonit ja lisämunuaisytimen erittämät katekoliamiinit.

Solukalvojen fosfolipidi arakidonihappo toimii rasvahappoyhdisteisten hormonien lähtöaineena. Tällaisia ovat mm. eikosanoidit (esimerkiksi postglandiinit, tromoksiaanit ja leukotrieenit).

Proteiini- ja peptidihormonit ovat muodostuneet muutamista tai jopa sadoista aminohapoista. Tällaisia ovat esimerkiksi vasopressiini ja tyreoliberiini.

Proteiinihormoneja ovat mm. insuliini ja kasvuhormoni. Proteiinihormoneja, joihin on liittyneenä hiilihydraattiryhmä, kutsutaan glykoproteiineiksi. Glykoproteiineja ovat esimerkiksi follikkelia stimuloiva hormoni ja luteinisoiva hormoni. Steroidihormonien lähtöaineena toimii kolesteroli.

Insuliini ja insuliiniresistenssi

Terve aineenvaihdunta reagoi ruokailun kohottamaan verensokeriin erittämällä insuliinia haiman Langerhansin saarekkeiden β-soluista. Insuliinimolekyylit kulkeutuvat verenkierron mukana soluihin ja kiinnittyvät kudosten insuliiniherkkien solujen insuliinireseptoreihin.

Insuliinireseptoriin kiinnittynyt insuliinimolekyyli ”kutsuu” solukalvon läpäisevän kanavan, jota pitkin glukoosimolekyyli pääsee sujahtamaan solun sytoplasmaan.

Insuliini vaikuttaa insuliiniherkkiin kudoksiin, kuten lihas- ja rasvasoluihin sekä maksan soluihin. Sillä on merkittävä tehtävä kehon energiataloudessa ja erityisesti sokeriaineenvaihdunnassa, koska insuliini lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa. Insuliiniresistenssi vaikuttaa ensimmäiseksi lihassoluihin, joten rasvasolujen energian varastoiminen lisääntyy.

Normaalisti insuliinin eritys vähenee verensokerin laskiessa. Terveillä verensokeri pysyy noin 5 mmol /l (90 mg /dl) -tuntumassa. Esidiabeteksessa sokeritasot kohoavat lähelle 7 mmol /l -tasoa. Diabetekseen sairastuneilla yön yli paaston jälkeen mitattu verensokeri on toistuvasti 7,0 mmol/l tai sitä korkeampi. Normaalin verensokerin yläraja on 6,0 mmol/l.

Insuliini on kehon energiatalouden kapellimestari. Se ohjaa ravinteiden käyttöä energian tuotantoon tai varastoimiseen solujen kylläisyysasteen mukaisesti.

Insuliinipitoisuuden laskiessa glukagoni purkaa insuliinin rakentamia energiavarastoja maksan ja lihasten glykogeeneistä. Näiden hormonien pitoisuus veressä vaihtelee jatkuvasti. Välillä glukoosia puretaan glukagonin aktivoimana glykogeeneistä ja välillä glykogeeni- ja rasvavarastoja kootaan insuliinin avulla.

Insuliiniresistentillä henkilöllä insuliini ei laske verensokeria halutulla tavalla. Rasva- ja lihassolut, tarvitsevat insuliinia glukoosin sisäänottoon. Kun nämä solut eivät reagoi insuliiniin, verensokeri nousee.

Pitkään jatkuvalla korkealla verensokerilla on monia haitallisia terveysvaikutuksia: se mm. heikentää verisuonia.  Aterioiden välillä insuliinitasot laskevat. Insuliinin laskun vaikutuksesta haiman alfasolut erittävät vereen glukagonia. Tämä insuliinin vastavaikuttaja aktivoi sokerivarastojen purkamisen maksasta vereen ja lihaksista lihasten omaan käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.

Rasvasolujen insuliiniresistenssissä verenkierrossa olevien lipidien imeytyminen heikkenee ja varastoituneiden triglyseridien hydrolyysi kiihtyy. Tämä lisää vapaiden rasvahappojen määrää veriplasmassa ja voi edelleen pahentaa insuliiniresistenssiä.

Hyperinsulinemia


Lisääntynyt viskeraalinen rasva erittää tulehdusta aiheuttavia sytokiinejä vereen, ja nämä vaikuttavat insuliinireseptorien toimintaa heikentävästi.

Hyperinsulinemia

Insuliiniresistenssi voi johtaa hyperinsulinemiaan, eli tilaan, jossa veressä on aivan liikaa insuliinia. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, minkä vuoksi veren glukoosia varastoidaan rasvasoluihin.

Insuliiniresistenssin vaikutuksesta lihasten toiminta heikkenee, sillä lihassolujen glukoosinsaanti vähenee. Samalla insuliinin vaikutuksesta rasvakudoksen rakentaminen tehostuu ja ihminen lihoo.

Koska insuliini on ensisijainen hormonaalinen signaali energian varastoimiselle insuliiniherkkiin rasvasoluihin, se stimuloi uuden rasvakudoksen muodostumista ja kiihdyttää painonnousua.

Insuliiniresistenssi lisää haiman beetasolujen insuliinin tuotantoa. Tämä nostaa veren insuliinitasoja (hyperinsulinemia) korkean verensokerin kompensoimiseksi.

Kompensoidun insuliiniresistenssivaiheen aikana insuliinitasot kasvavat, mutta verenkierron lisääntynyt insuliini ei kuitenkaan laske verensokeria.

Jos lisääntynyttä verensokeria kompensoiva insuliinieritys epäonnistuu laskemaan verensokeria, paastoglukoosi ja aterianjälkeinen glukoosi näkyvät mittauksissa kohonneina glukoosipitoisuuksina. Normaali glukoosipitoisuus pysyy aina 5 mml/l tuntumassa. Esidiabeteksessa verensokeritasot ovat 6,0-6,9 mml/l ja diabeteksessa yli 7 mml/l. Heikentynyt insuliinisensitiivisyys eli insuliiniresistenssi vaikuttaa näin tyypin 2 diabeteksen kehittymiseen.

Insuliiniherkät rasvasolut maksassa ja haimassa säilyttävät insuliinisensitiivisyyden lihassoluja pidempään. Tämän vuoksi insuliini kompensoi kohonnutta verensokeria ohjaamalla glukoosia rasvasoluihin, jossa glukoosi de novo lipogeneesissä muutetaan triglyserideiksi.

Tämä lisää myös maksan ja haiman rasvoittumista. Maksan rasvoittuminen lisää alkoholista riippumattoman rasvamaksan riskiä, mutta sitä suurempi ongelma insuliiniresistenssin ja aikuistyypin diabeteksen kannalta on haiman rasvoittuminen, sillä se heikentää entisestään insuliinintuotantoa, kunnes lopulta beetasolujen toiminta lakkaa kokonaan.

Insuliiniresistenssi assosioituu vahvasti ihmisiin, joilla on runsaasti viskeraalista keskivartaloläskiä, verenpainetauti, hyperglykemia, dyslipidemia, kohonneet triglyseriditasot, kohonnut hyvin pienten matalan tiheyden lipoproteiinien (sdLDL) tasot ja pienentyneet HDL-tasot.

Viskeraalinen keskivartalorasva assosioituu tutkimusten perusteella vahvasti insuliiniresistenssiin kahdella tavalla:

Ensinnäkin toisin kuin ihonalainen rasvakudos, viskeraalinen rasva tuottaa tulehduksellisia sytokiinejä, kuten tuumorinekroositekijä-alfa (TNF-a), interleukiini-1 ja interleukiini-6. Monissa kokeissa on osoitettu, että nämä proinflammatoriset, eli tulehdusta edistävät sytokiinit, hajottavat insuliinia tai estävät insuliinin normaalia toimintaa. Suuri osa tulehduksellisten sytokiinien tuotannosta on keskittynyt IKK-beeta / NF-kappa-B-reitille, proteiiniverkolle, joka tehostaa insuliiniresistenssiä vaikuttamalla tulehduksellisten markkerien ja välittäjien transkriptioon.

Toisaalta viskeraalinen rasva vaikuttaa myös rasvan kerääntymiseen maksaan, mikä aiheuttaa alkoholista riippumattoman rasvamaksan kehittymistä (NAFLD). Tämän seurauksena verenkiertoon vapautuu liikaa vapaita rasvahappoja lisääntyneen lipolyysin seurauksena. Edelleen NAFLD:n seurauksena maksan glykogenolyysi (glykogeenien pilkkominen glukoosiksi) ja maksan glukoosin tuotanto kiihtyvät, mikä pahentaa perifeeristä insuliiniresistenssiä ja kasvattaa tyypin 2 diabeteksen riskiä.

Insuliiniresistenssiin liittyy usein myös hyperkoaguloituva tila (heikentynyt fibrinolyysi) ja lisääntyneet tulehdukselliset sytokiinitasot.

Molekyylitasolla

Molekyylitasolla solu havaitsee insuliinin insuliinireseptoreiden välityksellä signaalin kulkiessa signalointikaskadin läpi. Tämä tunnetaan nimellä PI3K / Akt / mTOR signalointireitti.

Tuoreet tutkimukset viittaavat siihen, että tämä signalointireitti voi toimia fysiologisista olosuhteista riippuvaisena kaksisuuntaisena eli bistabiilina kytkimenä tietyntyyppisille soluille, jossa insuliinivaste voi olla kynnysilmiö.

Tämän signalointireitin herkkyys insuliinille voi heikentyä monien tekijöiden, kuten vapaiden rasvahappojen aiheuttaman insuliiniresistenssin seurauksena. Laajemmasta näkökulmasta herkkyyden virittäminen (tai herkkyyden vähentäminen) on organismin normaali tapa sopeutua muuttuvan ympäristön tai aineenvaihdunnan olosuhteisiin. Eli insuliiniresistenssi voi joissain tilanteissa olla elimistön kannalta toivottava tila.

Esimerkiksi raskaus muuttaa odottavan äidin aineenvaihduntaa. Odottavan äidin elimistön on vähennettävä lihaksiensa insuliiniherkkyyttä varatakseen enemmän glukoosia aivan erityisesti sikiön aivojen kehitykselle. Tämä voidaan saavuttaa siirtämällä insuliinin vastekynnystä, eli herkkyyttä erittämällä vereen istukan kasvutekijää, joka estää insuliinireseptorisubstraatin (IRS) ja PI3K:n vuorovaikutusta. Tämä on ns. säädettävän kynnyshypoteesin ydin.

Insuliiniresistenssi superoksidaasidismutaasi

Insuliiniresistenssi voi olla lisääntyneen ravinnonsaannin aiheuttama solutason reaktio. Ylimääräinen energiansaanti vaikuttaa solujen mitokondrioissa superoksidaasidismutaasin toimintaan.

Superoksidisdaasimutaasi on yksi tärkeimmistä antioksidanteista. Tällaisesta molekyylitason vaikutuksesta on viitteitä erilaisissa insuliiniresistenssistä tehdyissä havainnoissa. Kokeissa on havaittu myös, että insuliiniresistenssi voidaan kääntää nopeasti altistamalla solut esimerkiksi elektronin kuljetusketjun estäjille tai mitokondrioiden superoksididismutaasia jäljitteleville aineille.

Superoksidaasidismutaasi

Insuliiniresistenssi on yhteydessä verenpaineeseen. Nakamura tutkijakollegoineen. osoitti insuliiniresistenteillä jyrsijöillä ja ihmisillä, että vaikka insuliinin stimuloiva vaikutus adiposyyttien glukoosin imeytymisen insuliinireseptorisubstraatin 1 (IRS1) välityksellä heikentyi voimakkaasti, IRS2 välittämä vaikutus suolan imeytymiseen munuaisten proksimaaliseen tubulukseen, säilyi.

Kompensoiva hyperinsulinemia yksilöillä, joilla on insuliiniresistenssi, voi lisätä natriumin kerääntymistä proksimaaliseen tubulukseen, mikä johtaa natriumin ylikuormitukseen ja verenpaineen kohoamiseen.

Superoksidaasidismutaasi (SOD3) on useimmissa kudoksissa esiintyvä antioksidanttientsyymi, joka muuttaa haitallista superoksidia vähemmän haitalliseksi vetyperoksidiksi. Sekin on reaktiivinen happiyhdiste, mutta se toimii myös solujen viestinnässä viestinvälitysmolekyylinä. SOD3 saattaa siis osallistua solujen viestintään.

FM, PhD Lilja Laatikainen selvitti väitöstutkimuksessaan, kuinka solunulkoinen superoksididismutaasi-entsyymi suojaa kudoksia tulehdusreaktion aiheuttamilta vaurioilta. Tutkimus osoitti, että kudokseen virusvektorin avulla siirretty SOD3 estää tulehdussolujen, erityisesti makrofagien, kulkeutumisen vaurioituneeseen kohtaan.

Mekanismi on Laatikaisen tutkimuksen perusteella tulehdussolujen tarvitsemien tarttumismolekyylien ja tulehdusta edistävien sytokiinien tuoton vähentäminen estämällä keskeisen NF-kappa-B-molekyylin toimintaa. Tämän lisäksi SOD3 voimisti viestien välitystä Erk- ja Akt-signalointireiteillä, jotka edistävät solujen eloonjääntiä stressitilanteissa, ja vastaavasti vähensi solukuolemaan johtavien tekijöiden ilmentymistä, vähensi kudosvaurion laajuutta ja nopeutti kudoksen paranemista.

Insuliiniresistenssi tai heikentynyt insuliiniherkkyys on olennainen piirre aineenvaihdunnan oireyhtymässä, johon assosioituvat liikalihavuus, heikentynyt glukoosin sieto, dyslipidemia ja verenpaine. Dyslipidemialla tarkoitetaan rasva-aineenvaihdunnan häiriötä, jossa jokin veren rasva-arvoista (LDL, HDL, triglyseridit) ei vastaa suosituksia. Dyslipidemiasta puhutaan, jos seerumin LDL on yli 3 mmol litrassa, triglyseridipitoisuus yli 2 mmol/l tai HDL-pitoisuus alle 1mmol/l.

Insuliinin toiminta

Heikentynyt insuliiniherkkyys johtaa kompensoivaan hyperinsulinemiaan normaalin verensokerin ylläpitämiseksi. Insuliiniresistenssi voi olla toissijainen vaste insuliinireseptorin (IR) ja telakointiproteiinien, kuten insuliinireseptorisubstraattien (IRS) vaimennussäätelyä tai inaktivaatiota ohjaavalle signaloinnille.

Insuliinilla on tärkeä tehtävä verensokerin säätelyssä, sillä se stimuloi glukoosin kuljetusta rasvasolujen ja luurankolihasten kudosten läpi insuliinireseptorisubstraattien aktivaation jälkeen.

Insuliini stimuloi glukoosin kuljettajien (GLUT) siirtämistä solunsisäisistä kalvo-osastoista plasmakalvoon lisäämällä sokerin imeytymistä. Rasva- ja luurankolihaskudoksissa vaikuttaa useita glukoosin kuljetusmolekyylejä, mutta havaintojen perusteella GLUT4 on glukoosin solukalvojen läpi kuljettamisen kannalta tärkein kuljetusmolekyyli.

Insuliini sitoutuu ja aktivoi insuliinireseptori-tyrosiinikinaasia (IR), mikä johtaa IRS1:n, IRS2:n, IRS3:n ja IRS4:n fosforylaatioon. Sitoutumalla signalointipartnereiden, kuten fosfoinositidi-3-kinaasin (PI3K) kanssa insuliini aktivoi Akt/proteiinikinaasi B- ja proteiinikinaasi C-ζ -kaskadit, joilla on tärkeä tehtävä insuliinin toiminnassa.

IRS-alatyypit jakautuvat kudosspesifisesti, ja niillä on selkeät signalointikanavat. IRS1 välittää insuliinin vaikutusta glukoosin imeytymiseen rasvasoluissa ja luurankolihaksissa. IRS2 toimii ensisijaisesti välittäen insuliinin vaikutusta munuaistiehyihin.

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssin ja verenpaineen välinen yhteys on joko kahden itsenäisen prosessin yhteys, joka ei ole ainakaan suoraan yhteydessä verenpaineeseen, tai syy-seuraussuhde, jossa insuliiniresistenssi aiheuttaa kohonneen verenpaineen.

Jos insuliiniresistenssi ei aiheuta kohonnutta verenpainetta, insuliiniresistenssi ja kohonnut verenpaine voivat olla saman soluhäiriön toisiinsa liittymättömiä seurauksia. Eli kyse voi olla solunsisäisen vapaan kalsiumin määrän lisääntymisestä, mikä johtaa verisuonten supistumiseen ja insuliinin heikentyneeseen toimintaan.

Insuliiniresistenssi on toisaalta myös moniin verenpaineen kohoamista aiheuttaviin aineenvaihdunnan poikkeamiin assosioituva molekyylimarkkeri.

Toinen vaihtoehto on, että hyperinsulinemia vaikuttaa verenpainetaudin syntyyn, lisäämällä natriumin imeytymistä munuaisiin, aktivoimalla sympaattista hermostoa ja muuttamalla verisuonten resistenssiä.

Kudoksen heikentynyt insuliiniherkkyys on yhteinen nimittäjä useille sairauksille, kuten metabolinen oireyhtymä, keskivartalolihavuus, hyperglykemia, dyslipidemia, hypertensio ja insuliiniresistenssi. Vaikka insuliiniresistenssin osuutta hyperglykemian ja dyslipidemian osalta on tutkittu, insuliiniresistenssin merkityksestä verenpainetaudin patogeneesissä tiedetään vähemmän kuin insuliiniresistenssin merkityksestä metabolisen oireyhtymän ja tyypin 2 diabeteksen sekä lihavuuden synnyssä.

Miten Suomessa?

Diabetesliiton mukaan Suomessa vajaat puoli miljoonaa ihmistä sairastaa aikuistyypin diabetesta. Arviolta 100 000 sairastaa diabetesta tietämättään. Joka vuosi yli 20 000 suomalaista sairastuu tyypin 2 diabetekseen.

Diabetes on suurin yksittäinen valtimotautien, aivoverenkiertohäiriöiden ja alaraaja-amputaatioiden syy. Se lisää myös munuais- ja silmäsairauksia. Suomessa diabeteksen hoitokustannuksiin kuluu ihan helvetisti rahaa. Diabeteksen hoitoon käytetään 15 % terveydenhuollon menoista.

FinTerveys 2017 -tutkimuksen mukaan yli 30-vuotiaista miehistä 72 % ja naisista 63 % oli vähintään ylipainoisia. Miehistä 26 % ja naisista 28 % oli lihavia. Melkein puolet suomalaisista on vyötärölihavia.

Jo noin puoli miljoonaa ihmistä käyttää verenpainelääkkeitä. Tuhansilla verenpaineet ovat jatkuvasti riskirajoilla.  

Ketogeeninen ruokavalio toimii painonhallinnassa, pitää verensokerin tasaisena ympäri vuorokauden ja laskee tutkitusti verenpainetta. Voisiko ketogeeninen ruokavalio auttaa verenpaineen, painon ja huonojen lipidiprofiilien kanssa kamppailevia myös Suomessa?

Miksi ketoilu laskee verenpainetta?

David J. Unwin kertoo hiljattain tehdystä pilottitutkimuksesta, jossa tutkijat havaitsivat, että hyvin vähän hiilihydraatteja sisältävään ruokavalioon assosioitui merkittäviä verenpaineen, painon ja lipidiprofiilien paranemista, minkä vuoksi potilaiden lääkitystä voitiin tutkimuksen aikana vähentää.

Kysymys on: Voidaanko samanlaisia positiivisia terveyshyötyjä saada laajemmassa tutkimuksessa? Unwin tutkijaryhmineen rekrytoi perusterveydenhuollon seurantatutkimukseen 154 potilasta, jotka sairastivat aikuistyypin diabetesta, tai joilla sokerin sietokyky oli merkittävästi heikentynyt.

Vähähiilihydraattisen ruokavalion vaikutuksia sydämen ja verisuonitautien riskitekijöihin tutkittiin keskimäärin kaksi vuotta. Seurattujen potilaiden verenpaine laski merkittävästi LCHF-ruokavaliolla:

* Systolinen verenpaine laski keskimäärin 10,9 mmHg
*Diastolinen verenpaine laski keskimääräinen 6,3 mmHg
*Tutkimukseen osallistuneiden potilaiden paino laski keskimäärin 9,5 kg    *lipidiprofiilit paranivat selvästi

Tutkimuksen aikana potilaiden verenpainelääkitystä vähennettiin 20 prosentilla.  Kansallinen terveydenhuollon huippuosaamisinstituutti (National Institute for Health and Care Excellence – NICE) määrittelee kohonneen verenpaineen riskirajaksi 140/90 mmHg ja sitä korkeammat tulokset. Kotioloissa mitatut päivittäiset verenpaineen keskiarvot, jotka ovat vähintään135/85 mmHg ovat korkean verenpaineen riskirajoilla. Ymmärtääkseni näitä arvoja noudatetaan myös suomalaisessa terveydenhuollossa.

Hiljattain julkaistun tutkimuksen (lue tästä) mukaan huonojen ravitsemustottumusten jälkeen korkea verenpaine on globaalisti merkittävin sairastumisen riskitekijä.

Isossa-Britanniassa korkea verenpaine on tupakoinnin ja huonojen ravitsemustottumusten jälkeen kolmanneksi merkittävin sairastumiselle altistava riskitekijä.

Usein korkean verenpaineen syy voi johtua esimerkiksi ylipainosta, tupakoinnista, runsaasta suolan käytöstä tai perinnöllisistä tekijöistä, mutta toisinaan kohonneelle verenpaineelle ei löydetä mitään suoraa kausaalista syytä. Tällöin puhutaan essentiaalisesta hypertensiosta. Se on viisaalta kuulostava diagnoosi, joka kertoo, että syytä kohonneelle verenpaineelle ei tiedetä.

Tutkijat laativat vuonna 2013 ohjeita vähähiilihydraattisen ruokavalion (vähemmän kuin 130 g hiilihydraattia / päivä) hoitosuosituksia tyypin 2 diabeteksen. 19 potilaan pilottitutkimuksen potilaat sairastivat aikuistyypin diabetesta tai heidän sokerinsietokykynsä (IGT) oli merkittävästi heikentynyt. Kahdeksan kuukauden tutkimuksen hämmästyttävimmät seuraukset olivat potilaiden verenpaineen merkittävä parantuminen.  è systolinen 148 ± 17–133 ± 15 mmHg, p <0,005 è diastolinen 91 ± 8–83 ± 11 mmHg, p <0,05).  Koehenkilöiden verenpaineet laskivat huolimatta verenpainelääkkeiden käytön lopettamisesta.

Hypoteesi vuoden 2013 pilottitutkimuksen tuloksille oli, että vähähiilihydraattiset ruokavaliot voivat toimia diabeteksen ja painonhallinnan hoidossa perinteisiä hoitomuotoja paremmin. Aluksi hypoteesi herätti lääketieteellisessä yhteisössä runsaasti kritiikkiä ja epäilyjä, mutta sittemmin ketogeeninen ruokavalio on laajemmin hyväksytty osaksi aikuistyypin diabeteksen hoitoa. (Lue tästä ja tästä).

Hiilihydraattien vähentämisen vaikutukset insuliinin aktiivisuuteen ja metabolisen oireyhtymän oireiden hoitoon osoitettiin jo vuonna 2005 (lue tutkimus). Lisätyn sokerin lisäksi kaikkien ravinnon glukoosilähteiden, kuten leivän, perunan, viljan ja riisin rajoittaminen vähentää insuliinin eritystä ja parantaa insuliiniherkkyyttä.

Metabolinen oireyhtymä, korkea verenpaine DB2, keskivartalolihavuus, dyslipidemia ja alkoholista riippumaton rasvamaksa (NAFLD) ovat vain jäävuoren huippu. Kaikki nämä sairaudet palautuvat pinnan alla vaanivaan insuliiniresistenssiin.

Vuonna 2013 valmistunut vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion ja vähärasvaisen ruokavalion pitkäaikaisia vaikutuksia selvittänyt satunnaistettujen kontrolloitujen tutkimusten (> 12 kuukauden kesto) meta-analyysi, osoitti vähän hiilihydraatteja sisältävällä ruokavaliolla selvää laskua diastolisessa verenpaineessa, mutta ei systolisessa verenpaineessa.

Samana vuonna valmistunut toinen satunnaistettu kontrolloitu tutkimus havaitsi, että sekä systolinen että diastolinen verenpaine laskivat kuuden viikon kuluttua.

Tyypin 2 diabetesta sairastavilla hyperinsulinemia lisää munuaisten natriumin pidättämistä. Samaa ei tapahdu terveillä verrokeilla. Vuonna 2017 satunnaistettujen vertailututkimusten systemaattinen katsaus ja meta-analyysi osoitti, että pienemmän glykeemisen kuorman ruokavalio laskee merkittävästi verenpainetta. (Lue tästä)

Huolimatta ketogeenisen ruokavalion hyötyjen laajemmasta hyväksynnästä, vähähiilihydraattisen ruokavalion pitkäaikaisvaikutukset herättävät yhä kysymyksiä.

Iso-Britannian diabetesyhdistyksen marraskuussa 2018 antaman lausunnon mukaan: vaikka vähän hiilihydraatteja sisältävän ruokavalion ”lyhytaikaiset” hyödyt diabetesta sairastavan painonhallintaan, parantunut glykeeminen kontrolli ja pienentynyt sydän- ja verisuonitautien riski on osoitettu, ketogeenisen ruokavalion pitkäaikaisvaikutuksista tarvitaan lisää tutkimuksia.

Tutkimus ja menetelmät

Tutkimuksessa analysoitiin retrospektiivisesti yleislääkäreiden tutkimusta varten keräämiä kliinisiä tietoja 9700 potilaasta Pohjois-Englannista.  Lääkärit ja sairaanhoitajat tarjosivat tyypin 2 diabetesta tai heikentynyttä glukoositoleranssia (IGT) sairastaville potilaille vaihtoehtoisena hoitomuotona vähän hiilihydraatteja sisältävää ruokavaliota.

Tutkimuksesta poissuljettiin: raskaana olevat, syömishäiriöiset, alipainoiset, tyypin 1 diabetesta sairastavat ja alle 18-vuotiaat. Tietoja kerättiin maliskuusta 2013 marraskuuhun 2018.

Ruokavalio-kokeeseen osallistuneille annettiin kirjalliset ohjeet ja lisätukea potilaan valinnasta ja kliinisestä tarpeesta riippuen.  Kokeeseen valikoitui monenkirjava joukko eri ikäisiä ja erilaisissa elämäntilanteissa eläviä ihmisiä.  Lääkärin ja sairaanhoitajan tapaamisten lisäksi kokeeseen osallistuville tarjottiin säännöllisiä 90 minuutin ”ryhmäistuntoja” lähes kuukausittain.

Ryhmäistuntoihin osallistui myös perheenjäseniä. Kohorttiin valikoitui 154 osallistujaa: 90 miestä ja 64 naista. Kunkin potilaan paino, verenpaine ja verenkuva tutkittiin ennen tutkimuksen alkua. 89 oli tyypin 2 diabetes. Kokeeseen osallistuvien ikähajonta oli 40-89 ja ryhmän keski-ikä 63 vuotta tutkimuksen alkaessa. Useimmat seurantaan osallistuvista olivat ylipainoisia (keskimääräinen painoindeksi 34).

Alkutiedot Lähtötason mittauksiin sisältyivät seuraavat: Paino, verenpaine, kokonaiskolesteroli, HDL-kolesteroli, paaston triglyseriditasot ja verenpainetaudit. Kaikki mittaukset kerättiin käyttämällä Yhdistyneen kuningaskunnan kansallisen terveyspalvelun standardilaitteita ja laboratorioanalyysejä.

Tutkittavia ohjeistettiin vähentämään merkittävästi ruokavalion sisältämiä piilosokereita ja tärkkelyspitoisia elintarvikkeita, kuten perunoita, leipää ja riisiä. Ohjeistuksessa käytettiin apuna tutkimusta varten kehitettyä sokeriekvivalenttijärjestelmää, joka edustaa erilaisten elintarvikkeiden glykeemistä kuormaa.

Esimerkiksi pieni viipale leipää aiheuttaa vastaavan verensokerin nousun kuin kolme teelusikallista sokeria, ja 150 g keitettyä riisiä nostaa verensokeria saman verran kuin kymmenen teelusikallista sokeria.  Sokeriekvivalenttijärjestelmän avulla potilaat ymmärsivät, että esimerkiksi maissihiutaleista, paahtoleivästä ja mehusta muodostuva aamiainen on käytännössä sokeria.

Tulokset

Kahden vuoden tutkimuksen aikana tutkittavien potilaiden verenpaine, paino ja lipidiprofiilit paranivat selvästi ketogeenisellä ruokavaliolla.

Tutkimus osoitti, että hiilihydraattien rajoittaminen on turvallinen ja tehokas tapa hoitaa tyypin 2 diabeteksen oireita.


Yhteenveto

Ketogeenisen ruokavalion vaaroja liioitellaan. Todennäköisesti näin tehdään, koska keto-dieetti ei mahdu perinteisiin oppeihin hyvästä ja terveellisestä ruokavaliosta.

Tutkimuksia ketogeenisen ruokavalion terveyshyödyistä julkaistaan kiihtyvään tahtiin ja yhä useammat lääketieteen ammattilaiset ovat ottaneet ketogeenisen ruokavalion osaksi lihavuutta, verenpainetautia, metabolista oireyhtymää, tyypin 2 diabetesta jne. sairastavien potilaiden hoitosuunnitelmaa.

Ketogeeninen ruokavalio pitää verensokerin ja veren insuliinipitoisuuden tasaisena. Korkea verensokeri ja korkea insuliini assosioituvat  kardiometabolisiin ja kroonisiin sairauksiin, kuten tyypin 2 diabetekseen. Ketogeeninen ruokavalio on paras tapa hoitaa insuliiniresistenssiä, joka on monien sairauksien perussyy. Ruokavalio hillitsee oksidatiivista stressiä ja inflammaatiota, jotka assosioituvat lukemattomiin kroonisiin sairauksiin.

Kansainvälisesti yhä suurempi joukko lääketieteen ammattilaisia ja ketogeeniseen ruokavalioon syvällisesti perehtyneitä ravintoterapeutteja, insinöörejä ja nörttejä luennoi ja kirjoittaa ketogeenisen ruokavalion hyödyistä.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6695889/

https://en.wikipedia.org/wiki/Insulin_resistance

https://www.sciencedirect.com/science/article/pii/S0085253815301745

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6359196/

https://lipidworld.biomedcentral.com/articles/10.1186/s12944-019-1035-2

https://www.ncbi.nlm.nih.gov/pubmed/28193599

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664869/

 




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Ketogeeninen ruokavalio ja MS

Noudatin vähähiilihydraattista ruokavaliota vuosia sitten. Kokeilu jäi vain vajaan vuoden mittaiseksi, mutta kokemukseni olivat sekä painonhallinnan että yleisen hyvinvoinnin kannalta rohkaisevia. Oloni oli erinomaisen hyvä ja painoni laski.

Ruokavalion noudattaminen kaatui jouluherkkuihin. Noiden aikojen jälkeen olen lihonut 20 kiloa ja rasvaa on kerääntynyt erityisesti keskivartalolle haitallisena viskeraalisena läskinä. On aika tehdä jotain.

Ketogeeninen ruokavalio ja MS selvittää vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion vaikutuksia etenevää MS-tautia sairastavan terveyteen. 

Ketogeeninen ruokavalio herättää voimakkaita tunteita. Monien on yhä vaikea hyväksyä sitä, että syöty rasva voi laihduttaa. Ketogeeninen ruokavalio kuitenkin toimii mainiosti laihdutusruokavaliona.

MS on siinä mielessä viheliäinen sairaus, että se vaikuttaa vääjäämättä fyysiseen aktiivisuuteen. Painoa alkaa kertyä huomaamatta. Minä olen nauttinut invaliditeetin tuomasta joutenolosta syömällä epäterveellisesti ja juomalla pikkukylän vuosittaista vedenkulutusta vastaavan määrän olutta. Siinäpä tekosyyt.

Mitä ketogeenisella ruokavaliolla tarkoitetaan?

Ketogeeninen dieetti on vähähiilihydraattinen ja runsaasti rasvaa sisältävä ruokavalio. Proteiinien määrä pidetään ruokavaliossa maltillisena.

Evidenssiä tämän ruokavalion hyödyistä laihdutusruokavaliona on runsaasti. Sen sijaan näyttö siitä, että ketogeeninen ruokavalio helpottaisi etenevän multippeliskleroosin oireita, on vähäistä.

Laihtumisella ja elimistön hiljaisen tulehduksen – inflammaation – hillitsemisellä on terveyttä edistäviä vaikutuksia. En usko, että ruokavalio tekee ihmeitä sairaudelleni, mutta toivon laihtuvani sen avulla.

Ruokavaliossa hiilihydraattien, kuten tärkkelyksen ja sokereiden määrää rajoitetaan. Tämä tarkoittaa, että monet yleiset ruoka-aineet, kuten perunat, pastat, riisi, leivät ja hedelmät ovat rajoitettavien ravintoaineiden listalla.

Lihakasvis-vartaat

Ruokavalion puolestapuhujat korostavat, että ketogeeninen ruokavalio voi auttaa laihtumaan ja hillitsemään keskushermostoa degeneroivia tulehdusreaktioita.

Ketogeenisen aineenvaihdunnan perusteet ja toivotut hyödyt

Ketogeeninen ruokavalio voi mahdollisesti hillitä multippeliskleroosin oireita. Mihin ruokavalio ja tällaiset väitteet perustuvat?

Ketogeenisen ruokavalion tarkoituksena on ohjata solujen energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Kehon energiantuotantoa säätelee monet hormonit ja entsyymit, joista ketogeenisen ruokavalion kannalta mielenkiintoisimpia ovat insuliini ja glukagoni.
Ketogeeninen ruokavalio perustuu pitkälti juuri insuliinin ja glukagonin toiminnan ymmärtämiseen ja hyödyntämiseen.

Solujen energiantuotanto

Solut rakastavat glukoosia, sillä se on helppo ja nopea energianlähde. Ruoansulatuskanavassa hiilihydraatit, kuten tärkkelystä sisältävät perunat ja riisi, pilkotaan sokereiksi ja muiksi ravinteiksi. Glukoosi kulkee ohutsuolen endoteelin läpi verenkiertoon eräiden glut-molekyylien kuljettamana ja kohottaa verensokeria.

Haima reagoi sokeripitoisuuden lisääntymiseen erittämällä vereen insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, jolloin solun sisältämät solukalvon läpäisevät glukoosia kuljettavat kanavat tulevat solukalvolle. Näiden avulla glukoosi pääsee soluun.

Solun sytoplasmassa käynnistyy glykolyysi, jossa glukoosimolekyyli pilkotaan kahdeksi pyruvaatiksi. Reaktiossa syntyy myös kaksi korkeaenergistä ATP-molekyyliä ja kuusi vetyionia kumpaakin pyruvaattia kohden. Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit.

NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen. Anaerobinen (hapeton) energiantuotanto loppuu siihen, että pyruvaatit pelkistyvät laktaatiksi.

Sitruunahappokierto
Kuvan lähde: Wikipedia

Aerobinen (hapellinen) energiantuotanto jatkuu soluhengityksenä sitruunahappokierrossa sellaisissa soluissa, joilla on käytettävänään happea ja mitokondrioita. Sitruunahappokierto (Krebsin sykli, trikarboksyylihappokierto (TCA-kierto)) käynnistyy sitraattisyntaasientsyymin katalysoidessa sitraatin muodostumista oksaaliasetaatista ja asetyylikoentsyymi-A:sta.  

Sitraatista kierto etenee isositraattiin, siitä alfa-ketoglutaraattiin, edelleen sukkinyyli-koentsyymi-A:han, sitten sukkinaattiin, edelleen fumaraattiin, sitten malaattiin, kunnes kierto palaa oksaaliasetaattiin. Tuloksena asetyyliryhmä on hapetettu täydellisesti hiilidioksidiksi ja kolme NADH:ta, yksi FADH2 ja yksi GTP on tuotettu. Ketoilijoiden kannalta oleellista on, että rasva muutetaan sitruunahappokierron väliaineeksi – asetyylikoentsyymi-A:ksi.

Ennen kuin hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi.

 Mitokondrioissa tapahtuvassa sitruunahappokierrossa syntyy vielä parikymmentä korkeaenergistä ATP-molekyyliä ja protoneja elektroninsiirtoketjuun. Soluhengityksen lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat ihon ja hengityksen kautta. Sokerit ja rasvat siis palavat solujen mitokondrioissa vedeksi ja hiilidioksidiksi. Glukoosi kelpaa sellaisenaan solujen energiantuotantoon. Rasvat ja proteiinit on ensin muokattava asetyylikoentsyymi-A:ksi ja sokerit glukoosiksi.

Kun elimistö pakotetaan hyödyntämään rasvasoluihin varastoitua rasvaa energianlähteenä, läskin palaminen tehostuu huomattavasti.

Kaikki sokerit eivät kelpaa suoraan energiantuotantoon, vaan ne pitää ensin muuttaa glukoosiksi ja glykogeeneiksi, jotka muodostuvat jopa kymmenistä tuhansista yksittäisistä glukoosimolekyyleistä. Ravinnosta saatavan fruktoosin aineenvaihdunta eli fruktolyysi tapahtuu maksassa. Suurin osa fruktoosista syntetisoidaan glykogeeneiksi maksan nopeisiin sokerivarastoihin. Osa fruktoosista muutetaan maksassa glukoosiksi, joka vapautuu verenkiertoon ja ravitsee solujen energiantarvetta. Pari prosenttia fruktoosista muutetaan maksassa suoraan triglyserideiksi eli varastorasvaksi. Fruktoosin aineenvaihdunta rasittaa ja voi pahimmillaan rasvoittaa maksaa. Ilmeisesti epidemiaksi äitynyt alkoholista riippumaton rasvamaksa palautuu väestön ylettömään sokerin kulutukseen.

Jos veressä on liikaa glukoosia solujen ravinteiksi sekä lihasten ja maksan glykogeenivarastoihin, aineenvaihdunta alkaa muuttaa sokereita triglyserideiksi eli varastorasvaksi de novo lipogeneesissa. Insuliini osallistuu myös rasvanhappojen varastoimiseen rasvasoluihin. Tähän perustuu sokereiden lihottava vaikutus.

Kun veren sokeripitoisuus laskee, haima erittää vereen glukagonia. Glukagoni on insuliinin vastavaikuttaja ja sillä on monia tärkeitä tehtäviä aineenvaihdunnan säätelyssä.

1. Glukagoni purkaa maksan glykogeenivarastoja glukoosiksi verenkiertoon solujen energiantuotannon turvaamiseksi ja lihasten glykogeenivarastoja lihasten energiantuotantoon.

2. Glukagonin vaikutuksesta rasvasoluihin varastoituja triglyseridejä vapautuu verenkiertoon. Maksassa ja munuaisissa käynnistyvät ketogeneesi ja glukoneogeneesi. Ne valmistavat verenkiertoon vapautuneista vapaista rasvahapoista yms. aineista solujen energiantuotantoon kelpaavia ketoaineita ja glukoosia. Glukoneogeneesi syntetisoi mm. vapaista aminohapoista ja sitruunahappokierron välituotteista glukoosia.

Verensokerin kohotessa insuliini keskeyttää ketogeneesin ja glukoneogeneesin.

3. Rasvahappojen beetaoksidaatio käynnistyy

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Sen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta, kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Ketogeenisessä ruokavaliossa elimistö alkaa aktiivisesti muuttaa varastoimiaan rasvoja energiaksi kelpaavaan muotoon, koska soluille ei tarjota helppoa ja nopeaa glukoosia energianlähteeksi. Keho siis pakotetaan polttamaan rasvaa. Tästä ketoosissa ja ketogeenisessä ruokavaliossa on kyse.

Aineenvaihduntaprosessi on täysin luonnollinen. Elimistö osaa käyttää rasvaa polttoaineena, mutta koska solut on lapsuudesta lähtien tehokkaasti opetettu käyttämään polttoaineena sokeria, rasvavarastoja ei juurikaan pureta; lihominen jatkuu niin kauan kuin tarjolla on helppoja hiilihydraatteja ja veren insuliinipitoisuus säilyy korkeana. Elimistö alkaa purkaa rasvavarastoja, kun sille ei tarjota helppoa energiaa. Tavallaan kaloreita merkittävästi rajoittamalla päädytään samaan tilanteeseen, jossa kehon on turvauduttava varastoenergiaan.


Ketoosin hyödyt

Elimistö menee ketoosiin, kun veren sokeripitoisuus ja sen seurauksena insuliinipitoisuus ovat matalat. Varsinainen ketoaineita tuottava ketoosi käynnistyy muutamassa vuorokaudessa, jos hiilihydraattien saantia rajoitetaan 20-50 grammaan vuorokaudessa. Kehon varastoimien rasvojen tehokas käyttö energianlähteenä alkaa noin kolmessa viikossa edellyttäen, että hiilihydraattien saanti pysyy hyvin matalana. Ketoosissa:

  • paino laskee ja elimistö käyttää tehokkaasti varastorasvoja energianlähteenä
  • muuttunut aineenvaihdunta suojaa soluja
  • inflammaatio ja hapetus-pelkistysreaktion epätasapainon seurauksena syntyneet happiradikaalit vähenevät ja antioksidatiiviset prosessit tehostuvat
  • stressihormonien määrä elimistössä ja stressitasot laskevat


Ketogeeninen ruokavalio ja MS

Eräs ketogeeniseen ruokavalioon liitetty vaikutus on se, että se suojelee elimistöä solutasolla vaikuttamalla hapetusstressiin (oksidatiivinen stressi). Verensokerin nousu assosioituu oksidatiiviseen stressiin ja se ylläpitää inflammaatiota.  

Lihavilla myös ylimääräinen rasvakudos ylläpitää elimistön tulehdustilaa, koska rasvakudos erittää erilaisia tulehdussytokiineja eli tulehdusta välittäviä aineita. Laihduttaminen vähentää tällaista inflammaatiota ja tehokas laihtuminen voi laskea tulehdusarvoja (CRP) merkittävästi ja siten parantaa yleistä terveyttä.  

Mitä tutkimukset sanovat?

Saksalaisen 2015 toteutetun seurantatutkimuksen perusteella ketogeeninen ruokavalio parantaa multippeliskleroosia sairastavien elämänlaatua. Tutkimuksen miinuksena on, että se oli hyvin pienimuotoinen (60 osallistujaa) ja kesti vain puoli vuotta.

Saman vuoden aikana ilmestynyt tutkimusraportti löysi viitteitä siitä, että ketogeeninen ruokavalio suojaa etenevää multippeliskleroosia sairastavien keskushermostoa etenevään multippeliskleroosiin assosioituvilta neurodegeneratiivisilta tuhoilta.

”Until recently, multiple sclerosis has been viewed as an entirely inflammatory disease without acknowledgment of the significant neurodegenerative component responsible for disease progression and disability. This perspective is being challenged by observations of a dissociation between inflammation and neurodegeneration where the neurodegenerative component may play a more significant role in disease progression. In this review, we explore the relationship between mitochondrial dysfunction and neurodegeneration in multiple sclerosis. We review evidence that the ketogenic diet can improve mitochondrial function and discuss the potential of the ketogenic diet in treating progressive multiple sclerosis for which no treatment currently exists.” Lue tutkimus
tästä.

Ketogeeninen ruokavalio näyttää hyödyttävän multippeliskleroosia sairastavia solutasolla. Se vähentää oksidatiivista stressiä ja lisää veren antioksidanttitasoja. Tämä suojaa hermo- ja aivosoluja neurodegeneraatiolta. Vastaavia havaintoja on tehty dementian ja Alzheimerin taudin kohdalla; ketogeeninen ruokavalio on tutkimuksissa liitetty pienempään muistisairauksien riskiin.

Oksidatiivinen stressi ja antioksidantit

Oksidatiivinen stressi tarkoittaa solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Käytännössä hapettavien tekijöiden liiallinen määrä ja antioksidatiivisten järjestelmien vajavainen toiminta välittyy reaktiivisten happi- ja typpiradikaalien kautta, mikä ylläpitää elimistön inflammaatiota.

Verensokeri vaikuttaa oksidatiiviseen stressiin ja inflammaatioon sitä enemmän, mitä korkeammalle verensokeri nousee ja mitä suuremmasta syödystä hiilihydraattimäärästä on kyse. Suuren glykeemisen kuorman sisältävät ruoka-annokset nostavat verensokeria rajusti. Oksidatiivisen stressin aiheuttamia tulehdusta lisääviä vaikutuksia voi vähentää tulehdusta jarruttavilla tekijöillä: polyfenoleilla, C-vitamiinilla, kanelilla ja etikalla, kuiduilla ja rasvalla.

Miten se toimii?

Reaktiivinen happiradikaali sisältää parittoman elektronin ja on siksi hyvin reaktiivinen. Energiataloudellisesti parittomat elektronit ovat epäedullisia ja siksi yhdiste pyrkii parilliseen elektronimäärään reagoimalla läheisyydessä olevien muiden yhdisteiden kanssa. Happiradikaali vaurioittaa kohtaamiaan molekyylejä. Tämä voi ilmetä eri tavoin:

Lipidiperoksidaatiossa rasvat härskiintyvät. Oksidatiivisessa stressissä rasvat hapettuvat happiradikaalien liiallisen määrän vuoksi ja seurauksena voi olla esimerkiksi rasvakalvojen virheellinen toiminta, joka vaikuttaa hormonien ja muiden viestiaineiden aikaansaamien signaalien välittymisessä solukalvon kautta soluun.
– Proteiinien vauriot. Proteiinit toimivat entsyymikatalyytteina, jotka mahdollistavat elintoiminnoille välttämättömät kemialliset reaktiot. Jotkin proteiinit toimivat reseptoreina, jotka vastaanottavat soluun tulevia kemiallisia viestejä. Happiradikaalien vaikutukset proteiineihin voivat aiheuttaa monenlaisia elintoimintojen häiriöitä.
– Myös DNA voi vaurioitua hapettumisen seurauksena. Tämä aiheuttaa geneettisiä vaurioita eli mutaatioita DNA:n emäsjärjestyksissä. Tällaiset muutokset voivat muuttaa ko. aluetta koodinaan käyttävän proteiinin rakennetta ja edelleen pysyvästi solun toimintaa, minkä seurauksena solut saattavat muuttua pahanlaatuisiksi. Se altistaa syövän kehittymiselle.  

Happiradikaaleja syntyy elimistön normaalin toiminnan seurauksena esimerkiksi ruokailun jälkeen ja soluhengityksessä, kun mitokondrioiden elektroninsiirtoketju käyttää happea energiantuotannossa. Happiradikaalien muodostuminen on osa perusaineenvaihduntaa, mutta niiden määrää rajoittaa elimistön omat antioksidatiiviset järjestelmät. Hapetus-pelkistystiloissa tapahtuvat muutokset ovat osa solujen välistä viestintämekanismia (redox signaling). Keho voi hyödyntää happiradikaaleja myös immuunijärjestelmän osana. Luontainen immuniteetti ja siihen liittyvät fagosytoivat solut tuhoavat elimistölle vieraita mikrobeja tuottamalla happiradikaaleja.

Elimistöllä on omia mekanismeja reaktiivisten happiradikaalien määrän rajoittamiseen. Näistä tärkeimpiä ovat happiradikaaleja vaarattomiksi molekyyleiksi muuttavat entsyymit, kuten superoksididismutaasi, katalaasi ja glutationiperoksidaasi.  Ravinnosta saatavat pienimolekyyliset antioksidantit pystyvät myös inaktivoimaan happiradikaaleja. Antioksidantteihin kuuluu eräitä vitamiineja ja flavonoideja. Tutuimpia ovat C- ja E-vitamiinit.

Liiallinen oksidatiivinen stressi voi johtaa solukuolemaan ja kudostuhoon. Inflammaatio on kaikkien kroonisten sairauksien riskitekijä.

Tässä on syytä painottaa sitä, että kovin paljon tutkimustietoa ketogeenisen ruokavalion hyödyistä multippeliskleroosia sairastavien oireiden helpottajana ei ole. Havaitut hyödyt on todennettu lähinnä eläinkokeissa ja pitkäaikaisvaikutuksista ei ole tietoa. Toisaalta tutkimusten tulokset ovat hyvin rohkaisevia.

Huomioitavaa

Ketogeenisen ruokavalion noudattaminen voi aiheuttaa multippeliskleroosia sairastavilla väsymystä (fatiikkia). Omalla kohdallani en sellaista huomannut, mutta multippeliskleroosi vaikuttaa eri ihmisiin eri tavoin, joten varoituksen sana on paikallaan.

Usein vähän hiilihydraatteja sisältävää ruokavaliota noudattavia varoitetaan kuitujen ja välttämättömien ravintoaineiden mahdollisista puutoksista hiilihydraattirajoitteiden seurauksena. Se voi olla yksipuolisella ketogeenisella dieetillä ongelma, mutta myös vähän hiilihydraatteja sisältävällä ruokavaliolla saa kaikki välttämättömät ravintoaineet ja riittävästi kuituja, jos ruokavalio on riittävän monipuolinen.

Mitä pitäisi vältellä

Ketoosi edellyttää hiilihydraattien tuntuvaa rajoittamista päivittäisessä ruokavaliossa ja hiilihydraattien korvaamista rasvalla ja proteiineilla. Välteltäviä ravintoaineita ovat erityisesti sokerit ja tärkkelys, jauhot ja niistä valmistetut ruoat sekä riisi, peruna, maissi ja hedelmät.

Rasvat

Hyväksyttyihin ravintoaineisiin kuuluvat hyvät rasvat ja proteiinit sekä vähän hiilihydraatteja sisältävät kasvikset ja pähkinät. Voi kuuluu monissa virallisissa ravintosuosituksissa vältettäviin epäterveellisiin rasvoihin, mutta minä suhtaudun voihin äärimmäisen myönteisesti. Sen sijaan margariineja en mielelläni syö. Voin terveysvaikutuksista vallitsee kaksi koulukuntaa: klassinen rasvavastainen koulukunta ja uusimpiin tutkimuksiin perustuva modernimpi lähestymistapa. Jokainen tehköön valintansa itse. Yhtä totuutta voin terveysvaikutuksista ei ole olemassa.

  • oliiviöljy
  • voi (tai ei, jos syö mieluummin voimakkaasti raffinoituja margariineja)
  • avokadot
  • pähkinät, mantelit, pistaasit
  • rasvaiset kalat, kuten lohi, sardiinit ja makrilli

Proteiinit

Ketogeeniseen ruokavalioon voi sisältyä sekä eläin- että kasvisperäisiä proteiineja.

  • liha
  • meijerituotteet (juustot yms.)
  • munat
  • pähkinät, maapähkinät ja cashew-pähkinät

Hiilihydraatit

Ketogeenisella ruokavaliolla rajoitetaan erityisesti seuraavien hiilihydraattien saantia:

  • sokerit
  • hedelmämehut, virvoitusjuomat ja makeutetut teet
  • makeiset ja leivonnaiset
  • maitoa, sillä se sisältää maitosokeria eli laktoosia
  • pasta
  • leipä
  • pavut
  • hedelmät
  • murot, puurot yms.
  • tärkkelyspitoiset vihannekset, kuten perunat ja maissi

Esimerkki päivän ruoista ketogeenisella ruokavaliolla

Aamiainen

  • pari paistettua munaa
  • pekonia
  • kahvia

Välipala

  • puolikas avokado, kourallinen pähkinöitä

Lounas

  • viipaloitua kurpitsaa
  • lihapullia ja tomaattikastiketta

Välipala

  • manteleita

Päivällinen

  • paistettua lohta
  • kukkakaalia ja voita
  • pinaattia

Tuo on vain eräs esimerkki päivittäisen ruokavalion sisällöstä. Tulen lisäämään tänne ketonurkkaukseen erilaisia hyviksi koettuja reseptejä sekä muuta aihetta sivuavaa infoa.  

Lopuksi

En voi sietää sanaa ”karppaaminen”. Siinä on jotenkin negatiivinen sointi. Lisäksi se kuulostaa pikemminkin hiilihydraattien syömiseltä kuin niiden rajoittamiselta. Käytän itse ketoilu-sanaa vähän hiilihydraatteja ja runsaasti rasvaa sisältävästä ruokavaliosta.

 Aloitin ketoilun eilen 2.12.2019. Söin päivän aikana kaksi ateriaa. Brunssi-lounaalla naudan jauhelihapihvin, runsaasti paistettua valkosipulilla ja chilillä maustettua kaali-paprika-sekoitusta ja juustoraastetta. Päivällisellä 3 paistettua munaa, kaali-paprikasekoituksen jämät ja paistetun naudan jauhelihapihvin. Pysyin kylläisenä, enkä kaivannut välipaloja tai iltapalaa.

Aloitan tulevien viikkojen aikana kokoamaan Ruokasotaan erityistä Ketonurkkausta, jossa kerron ketoiluun liittyvistä tutkimuksista, omista havainnoistani ja hyvistä resepteistä.

 




Atkinsin dieetti

Atkinsin dieetti on tunnetuin pysyvään laihtumiseen tähtäävä vähähiilihydraattinen ruokavalio.

Atkinsin mukaan insuliinilla on tärkeä rooli rasvan varastoimisessa ja rasvakudoksen rakentamisessa. Atkinsin dieetin tavoitteena on hiilihydraatteja rajoittamalla laskea haiman erittämän insuliinin määrää verenkierrossa, mikä Atkinsin mukaan vähentää rasvan varastoitumista rasvakudokseen, tehostaa varastoidun rasvan ”polttamista” energiaksi ja auttaa laihtumaan.

Amerikkalainen kardiologi Robert Atkins laati Atkinsin dieetin 1970-luvun alussa. Ruokavalio on kehittynyt vuosikymmenten saatossa. Nykyisin Atkinsin dieetti kehottaa täydentämään liha- ja rasva-painotteisen ruokavalion laihduttavia vaikutuksia runsaskuituisilla, vähän tärkkelystä sisältävillä kasviksilla ja liikunnalla.

Kahden viikon vähähiilihydraattisen induktiovaiheen tavoitteena on käynnistää ketoosi. Induktion jälkeen hiilihydraattien määrää lisätään varovasti jatkuvan laihtumisen, esiylläpidon- ja ylläpidon vaiheiden aikana, kunnes ihannepaino saavutetaan.


Atkinsin dieetti ja aineenvaihdunta


Ketoosi on aineenvaihdunnan tila, joka käynnistyy, kun ravinnosta saatavien hiilihydraattien määrä ei riitä täyttämään elimistön energiantarvetta. Hiilihydraateista saatava glukoosi on elimistön ensisijainen ”polttoaine”, mutta aineenvaihdunta osaa tuottaa tarvitsemansa energian myös rasvasta ja proteiineista. Kun glukoosi ei täytä energiantarvetta, aineenvaihdunta aloittaa energiantuotannon rasvoista.

Kun veren insuliinipitoisuus laskee, haiman erittämän glukagonin määrä veressä lisääntyy. Glukagoni käynnistää maksaan ja lihaksiin varastoitujen glykogeenien purkamisen vereen glukoosi- eli sokerimolekyyleiksi. Glukagonin vaikutuksesta maksassa ja munuaisisten kuoriosissa alkaa glukoneogeneesi ja ketogeneesi sekä rasvahappojen hiiliä asetyylikoentsyymi-A:ksi hapettavan β-oksidaatio.

Ketoosissa vapaista rasvahapoista muodostetaan ketoaineita, joita solut voivat käyttää energiantuotantoon.

Ketoosin aikana rasvasoluista vapautuu rasvahappoja verenkiertoon. jolloin aineenvaihdunta alkaa hyödyntää vapaita rasvahappoja energianlähteenä.

Ketoosi ja varastorasvojen hyödyntäminen

Glukoneogeneesin käynnistyessä elimistö alkaa muodostaa glukoosia vapaista aminohapoista, rasvojen glyseroliosista ja maitohaposta. Glukoneogeneesin rinnalla käynnistyy ketogeneesi.

Ketogeneesi vähentää glukoosin tuottamisen tarvetta, mikä säästää vapaita aminohappoja solujen uusiutumiseen.

Ketogeneesi muodostaa verenkierron vapaista rasvahapoista ketoaineita (asetoasetaatti, beeta-hydroksibutyraatti), joita useimmat solut pystyvät käyttämään energianlähteenä palauttaen ketoaineet asetyylikoentsyymi-A:ksi, joka on suoraan käytettävissä oksidatiiviseen energiantuotantoon sitruunahappokierron kautta mitokondrioissa samaan tapaan kuin glukoosi.

Insuliini

Insuliini, jolla on keskeinen merkitys Atkinsin ajattelussa, on ihmiselle elintärkeä sokeriaineenvaihduntaa säätelevä hormoni, jota erittyy haiman Langerhansin saarekkeiden β-soluista, kun hiilihydraateista ohutsuolesta verenkiertoon imeytyvä sokeri (glukoosi) nostaa veren sokeripitoisuutta.

Vereen erittyneet insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, mikä saa solussa olevat solukalvon läpäisevät glukoosinsiirtäjäproteiinit siirtymään solukalvolle. Näiden avulla glukoosimolekyylit pääsevät verestä solun sisälle.

Solussa glukoosimolekyylit osallistuvat energiantuotantoon glykolyysissä ja sitruunahappokierrossa. Ylimääräinen glukoosi varastoidaan lihasten ja maksan glykogeeneihin ja / tai muutetaan rasvasynteesin avulla varastorasvaksi.

Veren sokeripitoisuuden kasvu lisää insuliinin eritystä. Verensokerin lasku puolestaan aktivoi haimaa erittämään glukagonia, jonka vaikutuksesta maksan ja lihassolujen glykogeenejä puretaan glukoosimolekyyleiksi. Kun glykogeenivarastot tyhjentyvät, elimistö siirtyy ketoosiin ja alkaa tuottaa energianlähteiksi kelpaavia ketoaineita mm. rasvahapoista.

Insuliinireseptori

Insuliinireseptorin tehtävä on ohjata veren sokeria siirtävät proteiinit kuten SLC2A4 solukalvolle, edelleen ohjata näiden reseptoreiden suorittamaa glukoosin siirtoa soluihin ja glykogeenin sekä rasvahappojen synteesiä.

Insuliinimolekyylin elinkaari kestää noin 71 minuuttia. Haiman erittämästä insuliinista suuri osa on tavallisesti kiinnittyneenä maksan insuliinireseptoreihin. Osa insuliinista vapautuu reseptoreista takaisin verenkiertoon. Insuliinimolekyylit voivat hajota verenkierrossa monella tavalla.

Endoteliinit

Verenkierrossa insuliini stimuloi myös endoteliinien, eli verisuonten endoteelisolujen tuottamien peptidihormonien tuotantoa. Endoteliinit säätelevät verisuonten sileiden lihassyiden supistumista ja osallistuvat verenkierron paikalliseen säätelyyn. Endoteliinit voivat myös paksuntaa ja jäykentää verisuonia, mikä kohottaa verenpainetta ja altistaa sydän- ja verisuonitaudeille.


Atkinsin dieetti käytännössä


Atkinsin ruokavalioon sopivat vähähiilihydraattiset vihannekset, proteiinit ja rasvat.

Atkinsin kehittämässä ruokavaliossa hiilihydraattien saantia ravinnosta vähennetään rajusti, mutta rasvojen ja proteiinien määrää ei tavallisesti rajoiteta lainkaan.

Atkinsin mukaan prosessoidut hiilihydraatit, sokerit, maissisiirappi ja valkoiset jauhot ovat lihomisen tärkeimmät aiheuttajat. Atkins ei usko perinteiseen kaloriteoriaan.

Atkinsin ruokavalion päämääränä on vähentää glykeemistä kuormaa ja tehostaa laihtumista.

Glykeeminen kuorma (GL) ja glykeeminen indeksi (GI) kertovat ravinnon sisältämien hiilihydraattien laadusta, määrästä ja imeytymisnopeudesta. Sitä voidaan hyödyntää arvioitaessa aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen.

Nopeilla ja hitailla hiilihydraateilla viitataan korkean glykeemisen indeksin hiilihydraatteihin ja matalan glykeemisen indeksin hiilihydraatteihin. Yleensä nopean glykeemisen indeksin hiilihydraatteja pidetään terveyden ja painonhallinnan kannalta huonompina kuin hitaasti imeytyviä hiilihydraatteja.

Glykeeminen kuorma

Glykeeminen kuorma voidaan laskea, ja siten selvittää syödyn ravinnon vaikutus veren sokeriin ja elimistön insuliinivasteeseen. Suuri hiilihydraattimäärä ja hiilihydraattien korkea glykeeminen indeksi kasvattavat ravinnon glykeemista kuormaa. Glykeemisen indeksin ja kuorman ymmärtäminen on erityisen tärkeää diabeetikoille.

Glykeeminen kuorma lasketaan seuraavasti: aterian glykeeminen indeksi x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa määritettäessä lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Glykeeminen indeksi

Glykeeminen indeksi määrittelee ruoka-aineen imeytyvien hiilihydraattien aiheuttaman vaikutuksen verensokeriin verrattuna referenssiruoka-aineeseen kuten glukoosiliuokseen tai valkoiseen leipään.

Hiilihydraatin korkea GI kertoo, että se kohottaa verensokeria nopeasti ja vereen vapautuu paljon insuliinia. Matala GI kertoo, että hiilihydraattien imeytyminen on hitaampaa ja tasaisempaa.

Runsaasti prosessoidut hiilihydraatit, kuten leivokset, karamellit ja valkoinen leipä sekä runsaasti tärkkelystä sisältävät hiilihydraatit, kuten perunat ja riisi, ovat korkean glykeemisen indeksin ruokia ja ne kohottavat verensokeri- ja insuliinitasoja nopeasti aterian jälkeen. Määrä on kuitenkin laatua keskeisemmässä asemassa, joten glykeeminen kuorma on parempi indikaattori aterian vaikutuksista verensokeri- ja insuliinitasoihin.

Jotkin hiilihydraatit, kuten kaura, kohottavat veren glukoositasoja hitaasti ja tasaisesti. Niiden glykeeminen indeksi on matala.

Nettohiilihydraatit

Nettohiilihydraattien määrä saadaan, kun hiilihydraattien kokonaismäärästä vähennetään kuidut ja sokerialkoholit. Sokerialkoholeilla on minimaalinen vaikutus veren sokeripitoisuuteen. Atkinsin mukaan parhaita hiilihydraatteja ovat ne, joiden glykeeminen kuorma on vähäisin.

Vitamiinit lisäravinteina

Atkinsin ruokavaliossa vältetään monia mineraali- ja vitamiinirikkaita vihanneksia ja hedelmiä, joten vitamiini- ja mineraalilisien ottaminen on suositeltavaa Atkinsin dieetin aikana.

Kuinka Atkinsin ruokavalio toimii?

Atkinsin ruokavalion neljä perustavoitetta:  

  • Laihtuminen
  • Painonhallinta
  • Hyvä terveys
  • Sairauksien ehkäisy

Atkinsin ruokavalion tavoitteena on muuttaa elimistön energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Se muistuttaa monin tavoin muita vähähiilihydraattisia ruokavalioita, kuten ketogeenistä ruokavaliota.

Hiilihydraattien korvaaminen rasvalla ja proteiineilla ohjaa elimistön käyttämään energianlähteenä ravinnon sisältämien rasvojen lisäksi kehoon varastoituneita rasvoja.

Aloittaminen

Atkinsin dieetti aloitetaan kahden viikon idnuktiovaiheella, jossa hiilihydraattien saanti rajoitetaan alle 20 grammaan vuorokaudessa. Tavoitteena on elimistön ketoositilan nopea saavuttaminen.

Induktion jälkeen hiilihydraattien määrää nostetaan kuukausien mittaan eri vaiheissa vähitellen, kunnes saavutetaan ihannepaino ja sopiva ylläpitotaso.

Ruokavalion laihduttava vaikutus perustuu siihen, että elimistö oppii käyttämään energianlähteenä rasvasoluihin varastoimiaan rasvoja, kun energia-aineenvaihdunnan kannalta nopeita ja helppoja hiilihydraatteja ei ole tarjolla ja veren insuliinitaso pidetään hiilihydraatteja rajoittamalla matalana.

Toisaalta Atkinsin ruokavalio hillitsee myös ruokahalua, jolloin ravinnosta saatava energiamäärä laskee luonnostaan.

Huomioi ennen Atkinsin dieetin aloittamista!

Jos sairastat jotain kroonista sairautta ja syöt siihen säännöllisesti lääkkeitä, sinun on syytä neuvotella lääkärin tai ravitsemusasiantuntijan kanssa ennen Atkinsin ruokavalion aloittamista.
Eräillä lääkkeillä, kuten insuliinilla, voi Atkinsin ruokavaliota noudatettaessa olla odottamattomia ja negatiivisia vaikutuksia.

Muista juoda riittävästi

Atkinsin dieetti on diureettinen, eli nesteitä poistava, joten myös nesteitä poistavien lääkkeiden ja muiden diureettien, kuten kahvin ja alkoholin välttäminen on suotavaa dieetin aikana. Riittävän nesteensaannin turvaaminen ja kehon nestetasapainon ylläpitäminen on Atkinsin ruokavaliossa erittäin tärkeää. Nestehukka aiheuttaa yleensä päänsärkyä, joten Atkinsin ruokavalioon liittyvä päänsärky viittaa usein liian vähäiseen nesteytykseen.

Diabeetikoilla insuliinintarve muuttuu Atkinsin ruokavalion seurauksena, joten on ehdottoman tärkeää, että diabetesta sairastavat neuvottelevat Atkinsin ruokavalioon siirtymisestä lääkärin kanssa ja noudattavat ruokavaliota asiantuntijan tai lääkärin valvonnassa.


Induktio ja syöminen


Atkinsin ruokavaliossa ketoosi käynnistetään nopeasti pudottamalla syötyjen hiilihydraattien määrä alle 20 grammaan vuorokaudessa. Tämä induktiovaihe jatkuu kaksi viikkoa. Proteiineja ja rasvaa voi induktiovaiheen aikana syödä nälkäänsä rajoituksetta.

Ruokavalioon sopivat kaikki lihat, kalat, linnut, äyriäiset, kananmunat ja juustot ja vihannekset, joissa on alle 10 % hiilihydraatteja. Atkinsin ruokavaliossa ei syödä induktio-, laihdutus- ja esiylläpitovaiheen aikana hedelmiä, viljoja, margariinia, tärkkelystä (kuten perunat, riisi, maissi), pastoja tai vähärasvaisia maitotuotteita.

Hiilihydraattien rajoittamisesta seuraava verensokerin lasku aktivoi haiman erittämään insuliinin vastavaikuttajaa, glukagonia, joka käynnistää ketogeneesin ja glukoneogeneesin. Glukagoni myös aktivoi soluissa tapahtuvan β-oksidaation käynnistymisen.

β-oksidaatio

β-oksidaatio tapahtuu solujen mitokondrioissa ja peroksisomeissa. Oksidaatiossa ravinnon ja rasvasolujen rasvahappojen β-hiiliä hapetetaan karbonyyleiksi. Reaktioketju tapahtuu neljässä vaiheessa:

– Dehydraus
– Hydraatio
– Hapetus-pelkistysreaktio
– Tiolyysi

Reaktiosarja toistuu, kunnes rasvahappo on kulunut loppuun. Joka toistossa rasvahapoista poistuu 2 hiiltä asetyylikoentsyymi-A:na. Tiolyysin asetyylikoentsyymi-A siirtyy yleensä sitruunahappokiertoon mennen siten ATP:n tuottoon. Muissa vaiheissa saadut NADH ja FADH2 päätyvät ATP:n tuottoon menemällä mitokondrion elektroninsiirtoketjuun. Lähde: Wikipedia


Kuvakaappauksen lähde. Wikipedia

Ketoosin käynnistyminen

Tavoitteena oleva ketoosi saavutetaan yleensä parissa viikossa, kun maksan ja lihasten polysakkarideista muodostuvat glykogeenivarastot tyhjenevät. Tämän vaiheen tavoitteena on katkaista energia-aineenvaihdunnan hiilihydraattiriippuvuus ja siirtää elimistön aineenvaihdunta käyttämään sokerin sijasta rasvaa ja varastorasvoja energianlähteenä.

Atkinsin ruokavalion alkuvaiheessa elimistöstä poistuu paljon nesteitä. Ensimmäisen puolentoista viikon aikana painonpudotus johtuu pääasiassa elimistöstä poistuvista nesteistä.


Atkinsin dieetti sisältää neljä vaihetta


Vaihe 1: Induktio

Hiilihydraattien saanti lasketaan alle 20 grammaan päivässä. Päivittäiset hiilihydraatit saadaan hyvin vähän tärkkelystä ja hiilihydraatteja sisältävistä vihanneksista.

Ruokavaliossa syödään runsaasti rasvaa ja proteiineja sekä salaatteja tms. vihreitä lehtivihanneksia.

Vaihe 2: Jatkuva laihtuminen / tasapainottaminen

Ravinnerikkaita ja runsaasti kuituja sisältäviä ruokia lisätään päivittäiseen ruokavalioon. Hiilihydraattien päivittäistä määrää nostetaan viidellä grammalla kerrallaan niin kauan kuin laihtuminen jatkuu.

Sallittuihin ruokiin sisältyvät edellisten lisäksi mm. pähkinät, vähähiilihydraattiset vihannekset ja vähäinen määrä hedelmää.

Vaihe 3: Esiylläpitovaihe

Hiilihydraattien määrää nostetaan tasolle, jossa painonpudotus hidastuu tai loppuu. (25-90 g /vuorokausi), kun dieetissä on päästy noin viiden kilon päähän tavoitepainosta. Tämä esiylläpitovaihe jatkuu vähintään 2 kuukautta siten, että painoa putoaa alle puoli kiloa viikossa.

Vaihe 4: Ylläpitovaihe

Kun asetettu tavoitepaino on saavutettu, siirrytään Atkinsin dieetissä ylläpitovaiheeseen. Laihduttaja lisää ruokavalioonsa monipuolisesti erilaisia hiilihydraatteja, mutta tarkkailee samalla, että paino pysyy vakiona, eikä lähde kasvuun. Ylläpitovaiheessa ketoosi ei enää ole tarpeellinen.

Ylläpitovaiheen aikana voi jo syödä lihan ja rasvan lisäksi monipuolisemmin useimpia vihanneksia, pähkinöitä, marjoja ja kokojyväviljoja sekä joskus hiukan perunaa ja hedelmiä. Lisättyä sokeria ei suositella. Alkoholia ja kahvia tulee käyttää kohtuudella. Robert Atkinsin mukaan liikunta on tärkeä osa Atkinsin laihdutusohjelmaa.

Atkins suositteli, että tyydyttyneen rasvan osuus päivittäisestä energiansaannista pysyisi alle 20 prosentissa.

Atkins 40:

Atkinsin ruokavaliosta on olemassa erilaisia variaatioita. Atkins 40 on hieman helpompi noudattaa, sillä alun induktiovaiheessa saa syödä 40 grammaa hiilihydraatteja vuorokaudessa.

Atkinsin ruokavaliota noudatettaessa omaan hyvinvointiin tulee kiinnittää huomiota. Ruokavalio ei välttämättä sovi kaikille. Jos paino alkaa nousta, päivittäisten hiilihydraattien määrää tulee jälleen laskea laihduttavalle tasolle.

Atkins ja kasvisruokavalio

Atkinsin dieetin noudattaminen kasvisruokavaliona on ongelmallista, koska kasviproteiinit esiintyvät yleensä yhdessä hiilihydraattien kanssa. Dieetistä voi toisaalta muokata kasvisruokavalion, kun siihen sisällyttää maitotuotteita ja kananmunia. Lakto-ovovegetaristinen Atkinsin dieetti suositellaan aloittamaan kakkosvaiheesta, eli jatkuvan painonpudotuksen vaiheesta, jossa hiilihydraattien määrä pidetään 30 grammassa vuorokaudessa.

Atkinsin kasvisversio sisältää runsaasti kasviöljyjä. Myös vegaaninen Atkinsin dieetti on mahdollinen, jos hiilihydraattien määrä pidetään 50 grammassa päivässä, mutta siinä proteiinien saannin kanssa on oltava erityisen tarkkana. Proteiininlähteiksi soveltuvat esimerkiksi siemenet, pähkinät, soijaruoat, kvinoa ja vegaanisessa Atkinsin dieetissä myös palkokasvit.

Mitä Atkinsin dieetissä saa ja ei saa syödä

Syötävät ruoat:

Laihduttajat saavat syödä avokadoja, sillä ne sisältävät terveellisiä rasvoja.

  • kaikki lihat ovat
  • rasvaiset kalat ja äyriäiset
  • munat
  • avokadot
  • vähän hiilihydraatteja sisältävät vihannekset, kuten valkokaali, parsakaali ja parsa
  • täysirasvaiset maitotuotteet, kuten juustot
  • pähkinät ja siemenet
  • terveelliset rasvat, kuten neitsytoliiviöljy, kookosöljy ja avokadoöljy

Dieettiin sopivia juomia ovat vesi, kahvi ja vihreä tee

Päivän ruokavalio on esimerkiksi tällainen:

  • Aamiainen: Juustomunakas ja vähän hiilihydraatteja sisältäviä vihanneksia
  • Lounas: Kanasalaatti ja pähkinöitä
  • Päivällinen: Lihapullia ja vähähiilihydraattisia vihanneksia

Välipaloiksi sopivat esimerkiksi pähkinät, siemenet, kananmunat ja kreikkalainen jogurtti

Vältettävät ruoat:

  • sokeri, virvoitusjuomat, leivokset ja makeiset
  • kaikki viljat, kuten vehnä, speltti ja riisi
  • vähärasvaiset laihdutusruoat, koska niissä rasva on usein korvattu hiilihydraateilla
  • palkokasvit, kuten linssit, pavut, herneet

Induktiovaiheen aikana runsashiilihydraattisia hedelmiä, kuten banaaneita, omenoita ja rypäleitä sekä runsashiilihydraattisia vihanneksia, kuten porkkanoita, tulee välttää.

TL;DR

Atkinsin mukaan verensokeri ja pohjukaissuolen erittämä GIP-hormoni stimuloivat insuliinin eritystä ja insuliinia tarvitaan rasvan ja sokereiden varastoimiseen rasvasoluihin. Rasvasoluissa myös sokerimolekyyleistä syntetisoidaan rasvahappoja. Insuliinin erityksen vähentäminen hiilihydraattien rajoittamisella vähentää rasvan varastoitumista, tehostaa varastorasvojen käyttämistä energiaksi ja auttaa laihduttamaan.


Kritiikki


”Insuliinilla on aineenvaihdunnassa muitakin tehtäviä. Verensokerin ohella se säätelee myös rasvahappojen siirtymistä verestä rasvasoluihin, jotka varastoivat ne rasvana. Varastorasva on juuri sitä tuttua rasvaa, jota nimitämme läskiksi. – – – Vaikka päättely insuliinista saattaa kuulostaa loogiselta, se on täysin virheellinen yksinkertaistus. Sen esittäjät ovat poimineet ihmisen aineenvaihdunnasta yhden palan ymmärtämättä rasvan varastoitumisen kokonaisuutta.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Pertti Mustajoki korostaa, että Atkinsin dieetin laihduttavat ominaisuudet perustuvat siihen, että Atkinsin ruokavaliota noudattava saa ravinnostaan vähemmän kaloreita. Vastakkain ovat klassinen kaloriteoria ja uudempi aineenvaihdunnan erilaisia mekanismeja korostava näkemys. Tutkimuksissa on osoitettu, että vähähiilihydraattinen ruokavalio laihduttaa vähän kaloreita sisältävää ravintoa selvästi tehokkaammin dieetin ensimmäiset kuukaudet, mutta erot ruokavalioiden välillä tasoittuvat noin vuoden laihduttamisen jälkeen.

”Oikeastaan ei tarvita edellä kuvattujen monimutkaisten aineenvaihdunnan tapahtumien tuntemusta. Energian häviämättömyyden lain perusteella voidaan helposti ymmärtää, että painonhallinnassa ruuan rasva ei suinkaan ole viaton. Jos saamme ruuasta energiaa enemmän kuin ”poltamme” eli kulutamme, ainoa mahdollisuus on varastoida se. Ylimääräinen energia ei voi hävitä. Se jää meihin, oli se sitten peräisin hiilihydraateista, proteiinista tai rasvoista.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Kuinka rasvasolut vaikuttavat painonhallintaan?

Rasvasolut eli adiposyytit tai liposyytit ovat kantasoluista kehittyneitä soluja, joiden tärkein tehtävä on varastoida ylimääräistä energiaa. Ihmisillä on kahdenlaisia rasvasoluja: valkoisia rasvasoluja (WAT) ja ruskeita rasvasoluja (BAT).

Ravinnon sisältämä ylimääräinen energia varastoidaan rasvasoluihin. Kun rasvasolut täyttyvät ja kasvavat riittävän suuriksi, ne jakautuvat ja tekevät näin varastoitavalle energialle enemmän tilaa.

Kerran muodostuneet rasvasolut eivät katoa mihinkään, vaikka paino putoaisi. Se on eräs laihduttamisen vaikeuteen vaikuttava tekijä. Laihtumisen ja lihomisen seurauksena rasvasoluihin varastoituneen rasvan määrä vaihtelee; solut eivät katoa.

Valkoiset rasvasolut

Valkoiset rasvasolut ovat yhden nesterakkulan soluja, jotka sisältävät ohuen sytoplasman ympäröimän ”rasvapisaran”. Valkoiset rasvasolut varastoivat ensisijaisesti triglyseridejä.

Valkoiset rasvasolut muistuttavat toiminnaltaan elintä, sillä ne erittävät aineenvaihduntaan vaikuttavia hormoneja, adipokiinejä kuten resistiiniä, adiponektiinia, leptiiniä ja apeliinia. Näillä hormoneilla on suuri vaikutus painonhallintaan. Esimerkiksi rasvasolujen erittämä leptiini kertoo aivoille, kun kehon energiavarastot ovat täyttyneet. Leptiini on siis kylläisyyshormoni.

Mitä enemmän ihmisellä on rasvasoluja, sitä hitaammin kehon energiavarastot täyttyvät ja rasvasolujen kemiallinen viesti energiavarastojen täyttymisestä hidastuu.

Suuri määrä energiatyydyttyneitä rasvasoluja voi aiheuttaa leptiinisignaaleilla eräänlaisen oikosulun aivojen leptiinireseptoreissa. Tällainen aiheuttaa leptiiniresistenssin, jossa aivot eivät enää reagoi kylläisyyshormoniin normaalisti. Kun rasvasolujen määrä kasvaa tai leptiinin toiminta heikkenee, ihminen syö enemmän kuin tarvitsee.

Ihmisellä on keskimäärin 30 miljardia valkoista rasvasolua, joihin on varastoitunut noin 13,5 kiloa rasvaa.

Ruskeat rasvasolut

Ruskeat rasvasolut sisältävät useita nesterakkuloita, joihin on varastoitunut rasvapisaroita. Ruskeat rasvasolut poikkeavat valkoisista rasvasoluista erityisesti koska ne sisältävät runsaasti energiaa tuottavia mitokondrioita. Ruskeaa rasvaa kutsutaan joskus vauvanrasvaksi ja se tuottaa elimistöön lämpöä.

Atkinsin dieetti voi vaikuttaa suotuisasti tyypin 2 diabetesta tai metabolista oireyhtymää sairastavien terveyteen ja vähentää lääkkeiden tarvetta. Diabetekseen erikoistuneet lääkärit varoittavat kuitenkin, että Atkinsin dieetti ei ole yksinkertainen ratkaisu tyypin 2 diabeteksen hoitoon, vaikka hiilihydraattien ja glukoosin saannin seuraaminen on tärkeä osa diabeteksen hoitoa.


Entä vaikutukset – toimiiko Atkinsin dieetti?


Atkinsin ruokavalion tavoitteena on laihtua ja ehkäistä eräitä sairauksia, kuten metabolista oireyhtymää, tyypin 2 diabetesta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja.

Tutkimuksen mukaan useimmat lopettavat Atkinsin ruokavalion noudattamisen 2-3 vuodessa.

Stanfordin yliopiston tutkimuksessa Atkinsin dieettiä noudattavien verenpaine ja kolesterolitasot kehittyivät suotuisaan suuntaan, ja dieetti laihdutti tehokkaammin kuin vertailtavat laihdutusruokavaliot.

Ruokavalion alkuvaiheessa joillain laihduttajilla ilmenee:

  • päänsärkyä
  • huimausta
  • heikotusta
  • väsymystä
  • ummetusta

Atkinsin dieetin puolestapuhujien mukaan ruokavalio sopii painonpudotuksen ohella diabeteksen ja korkean verenpaineen hoitoon. Muunneltua Atkinsin dieettiä käytetään myös lasten vaikean epilepsian lääketieteelliseen hoitoon.

Hyödyt

Ruokavalion kehittäjän Robert Atkinsin mukaan vähähiilihydraattisen ruokavalion etuja ovat:

  • Ruoan määrää tai kalorimäärää ei rajoiteta
  • Nälkää ei tarvitse tuntea
  • Ruokahalu vähenee
  • Ruoansulatus paranee
  • Paino laskee eikä tule takaisin, koska ruokavalio sopii pysyvään painonhallintaan
  • Useimmat ylipainoisuuteen liittyvät terveysongelmat helpottuvat

Atkinsin mukaan vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion myötä veren kolesteroliarvot paranevat ja sydäntautien riski vähenee. Atkinsin mukaansa ruokavalioon liitetyt terveysongelmat eivät johdu rasvasta, vaan 1800-luvun jälkeen yleistyneiden prosessoitujen hiilihydraattien käytöstä.

ketogeenisen ruokavalion hyötyjä:

1. Vähähiilihydraattinen ruokavalio vähentää ruokahalua

Monissa laihdutusruokavalioissa jatkuva näläntunne tuottaa ongelmia. Se johtaa helposti dieetin lopettamiseen. Vähähiilihydraattinen ruokavalio ylläpitää kylläisyyden tunnetta erinomaisesti, vaikka se samalla leikkaa energiansaantia.

Tutkimusten mukaan hiilihydraatteja rasvalla ja proteiineilla korvaavat saavat ravinnosta vähemmän kaloreita kuin hiilihydraattipainotteista ruokavaliota noudattavat.

2. Atkinsin dieetti on tehokkain laihdutusruokavalio ensimmäiset kuukaudet

Hiilihydraattien rajoittaminen on yksinkertaisin ja tehokkain tapa laihtua. Tutkimusten mukaan vähän hiilihydraatteja sisältävää ruokavaliota noudattavat laihtuvat nopeammin kuin laihduttajat, jotka rajoittavat rasvaa ja laskevat kaloreita.

Tutkimuksissa, joissa on vertailtu vähähiilihydraattisen ruokavalion ja vähärasvaisen ruokavalion tehoa laihduttamisessa, on havaittu, että hiilihydraatteja rajoittamalla laihtuu selvästi nopeammin ja enemmän tuntematta nälkää.

Vähän hiilihydraatteja sisältävä dieetti on muita laihdutusruokavalioita tehokkaampi ensimmäisen puolen vuoden aikana, mutta sen jälkeen erot ruokavalioiden välillä tasoittuvat.

3. Viskeraalinen vyötärölihavuus vähenee selvästi

Kaikki rasvat eivät ole samanarvoisia. Pahinta elimistöön kertyvää rasvaa on vatsaonteloon elinten ympärille varastoituva viskeraalinen rasva eli sisälmysrasva.

Sillä mihin kehon osaan rasva varastoituu, on merkitystä terveyden ja sairastumisriskin kannalta. Viskeraalinen rasva on yleisintä ylipainoisilla miehillä. Vyötärölihavuuteen liittyy usein myös maksan rasvoittuminen.

Viskeraalinen rasva kerääntyy vatsaontelossa elinten ympärille ja kasvattaa inflammaation sekä insuliiniresistenssin riskiä.

Vähän hiilihydraatteja sisältävät ruokavaliot, kuten Atkinsin dieetti, vähentävät hyvin tehokkaasti erityisesti vatsaonteloon kerääntyvää viskeraalista rasvaa.

4. Triglyseridien määrä veressä laskee merkittävästi

Triglyseridit ovat verenkierrossa kiertäviä vapaita rasvahappoja. Koholla olevat triglyseridit on tunnettu sydäntautien riskitekijä. Runsaasti hiilihydraatteja sisältävä ravinto ja etenkin fruktoosi kasvattavat veren triglyseridipitoisuutta.

Hiilihydraatteja rajoittavassa ruokavaliossa veren vapaat rasvahapot – triglyseridit siirtyvät ketoaineiden ja energiantuotantoon.

5. Atkinsin ruokavalio lisää hyvän HDL-kolesterolin määrää

HDL tunnetaan ns. ”hyvänä” kolesterolina: ts. mitä enemmän HDL-kolesterolia veressä on suhteessa LDL-kolesteroliin, sitä pienempi sydäntautiriski. Vastaavasti LDL-kolesterolin kasvu kasvattaa sydäntautien riskiä.

Paras tapa lisätä hyvän HDL-kolesterolin määrää, on syödä rasvaa. Atkinsin ruokavalio ja muut ketogeeniset ruokavaliot ovat runsasrasvaisia dieettejä. Lähde1, Lähde2.

6. Veren sokeri- ja insuliinipitoisuus laskee

Vähähiilihydraattiset ja ketogeeniset ruokavaliot saattavat vähentää lääkkeiden tarvetta metabolista oireyhtymää ja tyypin 2 diabetesta sairastavilla. Hiilihydraattien rajoittaminen laskee verensokeria ja veren insuliinitasoja.

Joidenkin aikuistyypin diabetesta sairastavien insuliinintarve laskee Atkinsin ruokavalion myötä jopa 50 %. Yhden tutkimuksen mukaan tyypin 2 diabetesta sairastavista 95 prosenttia vähensi lääkkeiden käyttöä 6 kuukauden sisällä Atkinsin dietiin aloittamisesta. Lähde.

Jos sairastat diabetesta ja aloitat vähähiilihydraattisen ja ketogeenisen ruokavalion, konsultoi asiasta lääkäriäs, sillä riskinä on hypglykemia.

7. Atkinsin ruokavalio voi laskea verenpainetta

Kohonnut verenpaine lisää sydän- ja verisuonitautien riskiä. Vähän hiilihydraatteja sisältävät ruokavaliot voivat joidenkin tutkimusten mukaan laskea verenpainetta.

Lähteitä:

Glykemiakuorma
Ketoosi
What to know about low-carb, high-fat diets
Atkins diet: What is it and should I try it?
Aktins.com
Atkinsin dieetti




Ketogeeninen ruokavalio ja aineenvaihdunta

Ketogeeninen ruokavalio kääntää perinteiset ravintosuositukset päälaelleen. Vähähiilihydraattisena ruokavaliona se ylittää aika ajoin uutiskynnyksen ja keskustelu sen ympärillä on ollut kiivasta karppausbuumin alkuajoista alkaen.

Viime kuussa joukko amerikkalaisia asiantuntijoita rankkasi ketogeenisen ruokavalion 40 dieetin vertailussa pitkäaikaisvaikutuksiltaan huonoimmaksi laihdutusruokavalioksi. Luulen, että ketogeeniseen ruokavalioon liittyy paljon epätietoisuutta. Mitä ketogeenisellä ruokavaliolla tarkoitetaan ja kuinka se toimii?

Ketogeeninen ruokavalio ja aineenvaihdunta

Ketogeeninen dieetti on vähähiilihydraattinen ruokavalio, jossa tavoitellaan aineenvaihdunnan ketoositilaa. Kun maksaan ja lihaksiin varastoidut hiilihydraattivarastot tyhjenevät, maksa ryhtyy tuottamaan ketoaineita ketogeneesissä ja käyttämään rasvakudokseen säilöttyä energiaa tasapainottaakseen elimistön energiavajetta.

Käytännössä ketogeenisessä ruokavaliossa tavoitellaan sellaista aineenvaihdunnan tilaa, jossa elimistö oppii käyttämään tehokkaasti rasvakudokseen varastoitua läskiä energianlähteenä.

Ketogeneesin käynnistyminen edellyttää, että ravinnon hiilihydraattien saantia rajoitetaan. Ketoosi alkaa, kun elimistö ei saa riittävästi hiilihydraatteja ja elimistön hiilihydraattivarastot eli glykogeenit tyhjenevät.

Varsinkin ruokavalion alkuvaiheessa hiilihydraatteja rajoitetaan reilusti. Tämän ”induktiovaiheen” tavoitteena on uudelleenohjelmoida elimistö käyttämään energianlähteenä aluksi ketoaineita ja myöhemmin pääasiassa rasvaa. Hiilihydraattien saanti lasketaan 20-100 grammaan vuorokaudessa.

Ketogeeninen ruokavalio lääketieteessä

Lääketieteessä ketogeenista ruokavaliota käytetään erityisesti vaikean epilepsian hoitoon lapsilla. Käypä hoito -suosituksissa neuvotaan harkitsemaan ketogeenista ruokavaliota yhteistyössä ravitsemusterapeutin kanssa vaikean epilepsian hoidossa silloin, kun epilepsialääkkeet eivät käy eikä kirurgisen hoidon mahdollisuutta ole. Ketogeenista ruokavaliota on käytetty myös lasten lihavuuden hoidossa.

Vähähiilihydraattinen ruokavalio on hyväksi diabeetikoille, sydän- ja syöpäpotilaille sekä ylipainoisille. Vähän hiilihydraatteja sisältävä ravinto laihduttaa ja vähentää ylipainoisten ihmisten sydäntautien riskiä tehokkaammin kuin vähärasvainen ruokavalio, osoittaa laajameta-analyysi, jossa käytiin läpi tutkimukset vuosilta 1966-2014 (Sackner-Bernstein ym. 2015).

Induktiovaiheen ravintosisältö

Alkuvaiheessa ketogeeninen ruokavalio sisältää yleensä noin 20 – 50 grammaa hiilihydraatteja vuorokaudessa hieman henkilöstä ja ruokavalion tavoitteista riippuen. Proteiinien saanniksi suositellaan 1-2 grammaa / painokilo, mutta ikääntyneillä proteiinien saanti voi olla korkeampikin lihaksia energianlähteeksi pilkkovan katabolisen aineenvaihdunnan vuoksi. Suurin osa ravinnosta muodostuu ketogeenisessä ruokavaliossa rasvasta.

Vettä on tärkeää juoda runsaasti (3-4 l/vuorokaudessa), sillä ketogeeninen ruokavalio poistaa vettä sitovien hiilihydraattien puutoksen vuoksi runsaasti kehoon sitoutuneita nesteitä. Myös suolan saannista on tärkeä huolehtia, koska se sitoo elimistöön nestettä ja ehkäisee elimistön kuivumista hiilihydraattien puuttuessa.

Noin neljän viikon induktiojakson jälkeen hiilihydraattien määrää voi lisätä  alle 50 grammasta 50-100 grammaan vuorokaudessa esimerkiksi kasviksia lisäämällä.

  • 5-10 % Ravinnon energiamäärästä (kcal) tulisi saada hiilihydraateista
  • 30 % Ravinnon energiamäärästä (kcal) tulisi saada proteiineista
  • 60 % Ravinnon energiamäärästä (kcal) tulisi saada rasvasta

Ketogeenisen ruokavalion tiedetään aiheuttavan päänsärkyä monilla, mutta se on yleensä seurausta veden liian vähäisen juomisen aiheuttamasta nestehukasta.Silloin kannattaa juoda enemmän vettä.

Ketoosi ja ketoasidoosi eivät ole sama asia

Ketoasidoosi eli happomyrkytys on toksinen tila, jossa ketoaineiden määrä verenkierrossa voi kasvaa monikymmenkertaiseksi ketoosiin verrattuna. Lievimmillään ketoasidoosia ei välttämättä edes huomaa, mutta vakavimmillaan se on hengenvaarallinen myrkytystila. Ketoosi ja ketoasidoosi ovat siis kaksi eri asiaa.

Ketogeeninen ruokavalio ja aineenvaihdunta

Aineenvaihdunnan tasolla ketogeneesi tarkoittaa energianlähteiksi kelpaavien ketoaineiden tuottamista rasvahapoista silloin kun hiilihydraattien saanti on niukkaa tai olematonta.

Ketoaineet ovat rasvasta ja etanolista muodostuvia pienimolekyylisia yhdisteitä. Elimistössä muodostuu kolmea eri ketoainetta:

  • asetoasetaattia
  • beeta-hydroksibutyraattia
  • asetonia

Ketoaineiden tuotannon käynnistyminen

Aineenvaihdunta aloittaa ketoaineiden tuotannon, kun maksan ja lihasten sokerivarastot (glykogeenit) on kulutettu loppuun esimerkiksi intensiivisen urheilusuorituksen, vähän hiilihydraatteja sisältävän ravinnon tai paaston vaikutuksesta.

Ketoaineiden tuotannon käynnistyminen ei tarkoita, että elimistö on ketoosissa. Se on vain merkki siitä, että hiilihydraattivarastot ovat loppu ja elimistö siirtyy ”varavoimanlähteen” käyttöön. Ketoosi alkaa yleensä muutamassa päivässä ja rasvan käyttäminen solujen polttoaineena vakiintuu 3-4 viikossa.

Kun keho menee ketoosiin, aineenvaihdunta turvaa elintoimintojen tarvitseman energian saannin glukoneogeneesillä ja ketogeneesillä myös paaston ja hiilihydraatittoman ruokavalion aikana. 3-4 viikossa elimistö korvaa ketoaineet energianlähteinä rasvakudoksen ja ravinnon rasvoilla.

Näiden aineenvaihduntamekanismien ansiosta terve ihminen selviää elossa pelkällä vedellä jopa kuukauden ajan.

Ketoaineita syntyy maksassa ja munuaisissa

Yleensä ketoaineita syntyy maksan ja munuaisten solujen mitokondrioissa solujen glukoneogeneesin sivutuotteina. Kun solut tuottavat glukoosia, ne tuottavat tarvitsemansa energian hapettamalla rasvahappoja asetyylikoentsyymi-A:ksi.

Asetyylikoentsyymi-A

Wikipedia kertoo, että asetyylikoentsyymi-A, eli aktiivinen etikkahappo, on kaikille ravintoaineille yhteinen välituote solun valmistaessa energiaa.  Asetyylikoentsyymi-A:ta saadaan monosakkarideista (sokereista), triglyserideistä (rasvoista) ja aminohapoista (proteiineista) erilaisten reaktiovaiheiden kautta.

Asetyylikoentsyymi-A:n asetyyliryhmän hiilet hapettuvat hiilidioksidiksi Krebsin syklissä (sitruunahappokierto) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, esimerkiksi ATP:ksi.

Glukoosi hajoaa solulimassa tapahtuvassa glykolyysissä kahdeksi pyruvaatiksi, joista molemmista saadaan edelleen oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta. Jos happea ja mitokondrioita ei ole riittävästi, pyruvaatti pelkistyy maitohapon anioniksi laktaatiksi.

Rasvahapot hajoavat hapettumalla β-oksidaatiossa niin, että rasvahappoketjusta irtoaa kahden hiilen asetyyliryhmiä, jotka ovat kiinnittyneenä reaktioon osallistuvaan koentsyymi-A:han.

– Wikipedia

Asetyylikoentsyymi-A, joka ei hapetu normaalisti sitruunahappokierrossa glukoneogeneesin ollessa käynnissä, muuntuu ketogeneesissä asetoasetaatiksi ja edelleen betahydroksibutyraatiksi.

Ketoaineet kulkeutuvat verenkierron mukana maksasta ja munuaisista muualle elimistöön. Aivojen gliasolut käyttävät asetoasetaattia ja betahydroksibutyraattia lipidien rakennusaineena. Sydän, lihakset ja aivot voivat tarvittaessa käyttää ketoaineita solujen energianlähteenä.

Ketogeneesi on elintoimintojen varavoimanlähde

Glukoneogeneesi ja ketogeneesi toimivat itsenäisesti energiantuotannon taustaprosesseina ja ylläpitävät solujen energiansaantia silloin, kun syömisestä on kulunut paljon aikaa. Glukoneogeneesi käynnistyy haiman erittämän glukagonin aktivoimana maksassa ja munuaisissa ja se johtaa edelleen ketogeneesin käynnistymiseen maksan ja munuaisten mitokondrioissa.

Ilman näitä aineenvaihdunnan prosesseja evoluutio ja aivojen kehitys olisivat pysähtyneet esihistorian aamuhämärissä, eikä nykyihmistä olisi koskaan kehittynyt.

In essence, a ketogenic diet mimics starvation, allowing the body to go into a metabolic state called ketosis (key-tow-sis). Normally, human bodies are sugar-driven machines: ingested carbohydrates are broken down into glucose, which is mainly transported and used as energy or stored as glycogen in liver and muscle tissue. When deprived of dietary carbohydrates (usually below 50g/day), the liver becomes the sole provider of glucose to feed your hungry organs – especially the brain, a particularly greedy entity accounting for ~20% of total energy expenditure. The brain cannot DIRECTLY use fat for energy. Once liver glycogen is depleted, without a backup energy source, humanity would’ve long disappeared in the eons of evolution. .

Scientific American

Ketogeneesi on osa kehon normaalia aineenvaihduntaa. Nykyisin ravinto on sen verran energiatiheää ja hiilihydraattipainotteista, että elimistö turvautuu ketogeneesiin vain satunnaisesti, vaikka se esi-isillämme oli luontainen osa elimistön energiantuotantoa. Viimeisten vuosisatojen aikana ravintotottumukset ovat muuttuneet valtavasti, mutta aineenvaihdunnan mekanismit muuttuvat hitaammin.

Aineenvaihduntamme on lapsesta lähtien opetettu saamaan energia hiilihydraateista, mutta se ei tarkoita sitä, etteikö energiansaantiin olisi muita tapoja. Aineenvaihdunta voidaan uudelleenohjelmoida ”sokeripolttoisesta” tehtaasta ”rasvapolttoiseksi” ravintoon liittyvillä valinnoilla.

Aineenvaihdunta biohakkeroimalla rasvaa polttavaksi

Ketoosi on ketogeneettisessä ruokavaliossa tavoiteltava aineenvaihdunnan tila. Siihen päästään ”biohakkeroimalla” aineenvaihdunnan toimintaa.

Käytännössä biohakkeroinnilla tarkoitetaan ravinnosta saatavien hiilihydraattien rajoittamista 20-50 grammaan vuorokaudessa. Aineenvaihdunta opetetaan käyttämään ketoaineita ja rasvasolujen sisältämiä energiavarastoja energianlähteenä, koska sille ei tarjota helppoa energianlähdettä hiilihydraattien muodossa.

Kuvan lähde: Wikipedia – Glycogen

Glykogeenit

Oheinen kuva esittää kaksiulotteisen mallin glykogeenistä, joka on jopa 30 000 glukoosimolekyylistä muodostuva monihaarainen ja pitkäketjuinen polysakkaridi. Osa verensokerista varastoidaan tällaisina polysakkarideina maksa- ja lihassoluihin.

Kun verensokeri laskee, haima erittää glukagonia, joka purkaa glykogeenejä maksasta verenkiertoon. Se kohottaa verensokeria ja antaa lihas- ja aivosoluille nopeaa energiaa glukoosin muodossa. Lihassolujen varastoimat glykogeenit eivät vapaudu verenkiertoon, vaan lihas käyttää ne nopeana energianlähteenä itse.

Glykogeneesi

Glykogeenit muodostuvat insuliinin aktivoimana glykogeneesissä maksa- ja lihassoluissa. Maksasolut ylläpitävät veren glukoosipitoisuutta glykogeenivarastojensa avulla syömisten välissä.

Aivot käyttävät valtavasti energiaa

Glykogeenivarastot ovat kooltaan varsin pienet ja elimistö kuluttaa varastosokerit nopeasti loppuun.  Pelkästään aivot kuluttavat vuorokaudessa noin 100 g glukoosia, joka saadaan syödyistä hiilihydraateista sekä glukagonin avulla puretuista maksan varastosokereista.

Glukoneogeneesin sivutuotteena syntyy ketoaineita

Kun glykogeenit tyhjenevät, maksa ryhtyy korvaamaan aivojen tarvitsemaa glukoosia ketoaineilla. Glykogeenejä purkava glukagoni aktivoi glukoosia tuottavan glukoneogeneesin maksassa ja munuaisten kuoriosissa.

Glukoosimolekyylin syntetisoiminen kuluttaa enemmän energiaa kuin glukoosimolekyyli tuottaa

Glukoneogeneesi hyödyntää mm. vapaita aminohappoja ja rasvoja sekä glykolyysissä syntyneitä maitohappoja, sitruunahappokierron sivutuotteita sekä ketoaineita glukoosin syntetisoimisessa.

Yhden glukoosimolekyylin tuottaminen vaatii 2 pyruvaattimolekyyliä, 4 ATP:tä, 2 GTP:tä, 2 NADH-molekyyliä ja neljä vesimolekyyliä. Se vaatii siten enemmän energiaa kuin glykolyysi tuottaa yhdesta glukoosimolekyylistä.

Glykogeenit purkautuvat glukagonin vaikutuksesta glykogenolyysissa

Haiman alfasolujen erittämä glukagoni aktivoi glykogeenien purkamisen eli glykogenolyysin maksassa ja lihassoluissa, jolloin glykogeeni purkautuu glukoosiksi (maksasta) ja glukoosi-1-fosfaatiksi (lihaksissa).

Glukagoni käynnistää glykogenolyysin yhteydessä glukoneogeneesin. Haiman beetasolujen erittämä insuliini puolestaan pysäyttää glukongeogeneesin, kun verensokeri nousee ja aineenvaihdunnan energianlähde muuttuu glukoosiksi.

Induktio

Scientific American kirjoittaa, että aivot toimivat hyvin myös ketoaineilla. Aivojen toiminta on turvattu, jos ~70 % aivojen energiatarpeesta saadaan ketoaineista. Prosessi, jossa aivot oppivat käyttämään ketoaineita energianlähteenä 0 – 70 % vie kolmisen viikkoa. Tämä on eräänlainen aineenvaihdunnan induktiovaihe.

Induktiovaiheen aikana aivoja lukuun ottamatta kaikki kehon kudokset vähentävät ketoaineiden käyttöä energianlähteenä. 3-4 viikon aikana solut sopeutuvat käyttämään energianlähteenä rasvasoluista vapautuvia vapaita rasvahappoja.

Induktion jälkeen elimistö tuottaa hyvin vähän ketoaineita (vähemmän kuin 280 kcal / päivä), mutta riittävästi aivosolujen energiantarpeen turvaamiseksi.

Ketogeenisessä ruokavaliossa painosta putoaa ennen induktiovaiheen loppua lähinnä nesteitä, joten nestetasapainon kanssa tulee olla tarkkana ja juoda reilusti vettä. Rasvan käyttö energianlähteenä tehostuu hitaasti koko ajan ja on tehokkaimmillaan vasta kolmisen viikkoa ruokavalion aloittamisen jälkeen. Sen verran kestää, että solut sopeutuvat uuteen energianlähteeseen.

Aineenvaihdunta

Aineenvaihduntaan vaikuttaa useita tekijöitä: ravinnon määrä ja laatu, makroravinteet, ravinnon sisältämät vitamiinit ja mineraalit, stressi, nestetasapaino, maksan ja haiman terveys, geenit, hormonit, insuliinisensitiivisyys, liikunta, ja uni.

Oheinen Jonathan Bailorin luento sisältää mielenkiintoisia huomioita aineenvaihdunnan toiminnasta, lihomisesta ja laihtumisesta:

Aineenvaihdunta ylläpitää elämää sitkeästi. Se on joustava ja pystyy hyödyntämään tehokkaasti erilaisia ravinnonlähteitä elintoimintojen ylläpidossa.

Perusaineenvaihdunta kuluttaa valtavasti energiaa

Sängyssä makaaminen kuluttaa 80 kg painavalla, 180 cm pitkällä 30 vuotiaalla miehellä noin 1780 kcal vuorokaudessa. Aivojen ja välttämättömien elintoimintojen ylläpito edellyttävät paljon energiaa.

Keskimäärin aikuinen tarvitsee ravinnosta 2000-2500 kcal vuorokaudessa. Liikunta lisää energiantarvetta, mutta ikä, paino ja kehon rakenne vaikuttavat lepokulutukseen.

Tärkeimpiä elintoimintoja ylläpitää perusaineenvaihdunta. Siihen kuuluvat keuhkojen ja sydämen toiminta, kemiallisten yhdisteiden eristys ja synteesit, sekä ionien siirto solukalvojen läpi. Vuorokautisesta kokonaisenergiankulutuksesta 65–75 prosenttia on
perusaineenvaihduntaa, miehillä keskimäärin 4,2 kJ/min ja naisilla 3,8 kJ/min. Perusaineenvaihdunta koostuu aivojen (21 %), lihasten (22 %), maksan (18 %), munuaisten (6 %), sydämen (12 %) ja muiden kudosten (21 %) energiankulutuksesta. Sen suuruuteen vaikuttaa sukupuolen lisäksi ikä, kehon tyyppi ja koostumus, paasto, lämpötila ja laihduttaminen. – Wikipedia

Anabolinen ja katabolinen aineenvaihdunta

Solun aineenvaihdunta voidaan jakaa kahteen toimintamekanismiin: anaboliseen ja kataboliseen aineenvaihduntaan.

Anaboliset reaktiot ovat biosynteettisiä eli kokoavia aineenvaihduntatapahtumia, joissa yksinkertaisemmista molekyyleistä rakennetaan monimutkaisempia molekyylejä.

Katabolisissa reaktioissa monimutkaisempia molekyylirakenteita pilkotaan yksinkertaisemmiksi molekyyleiksi.

Energian tuotanto

ADP + Pi      –                ATP
NAD+              –                 NADH +H+

  • Energianlähteenä voi hyödyntää hiilihydraatteja, rasvoja ja proteiineja
  • Solut saavat energiaa orgaanisista molekyyleistä hapettamalla niitä esimerkiksi:
    – Glukoosin hapetus tapahtuu sytoplasman glykolyysissä
    – Rasvahappojen hapetus = β-oksidaatio

β–oksidaatiossa rasvahappojen käyttö energiantuotantoon alkaa siten, että rasvat hajotetaan rasvahapoiksi ja glyseroliksi.

Glyseroli hapetetaan solulimassa glyseraldehydi-3-fosfaatiksi ja se voidaan käyttää joko energiantuotantoon (n. 5 % triglyseridistä saatavasta energiasta) tai glukoosin tuottamiseen glukoneogeneesissä.

Rasvahapot hapetetaan mitokondrioissa β–oksidaatiossa. Aluksi rasvahapot aktivoidaan mitokondrion ulkokalvolla kiinnittämällä rasvahapon karboksyyliryhmään koentsyymi-A. Näin muodostunut asyyli-KoA kulkee mitokondrion sisäkalvon läpi aktiivisella kuljetuksella. Näin siksi, että soluliman ja mitokondrion asyyli-KoA:lla on eri tehtävät – solulimassa anabolia, mitokondriossa katabolia.

Mitokondrion matriksissa rasvahappo hajotetaan kaksihiilisiksi pätkiksi (asetyyli-KoA), joka edelleen hapetetaan sitruunahappokierrossa.

Kuvan lähde: Nina Peitsaro

Anabolinen ja katabolinen aineenvaihdunta vuorottelevat elimistössä päivittäisten rutiinien lisäksi myös iän ja elämäntilanteen mukaan. Fyysinen harjoittelu ja sairaudesta toipuminen kallistavat aineenvaihduntaa anaboliseksi, jolloin aineenvaihdeunta rakentaa lihaskudosta tai korjaa sairauden aiheuttamia vaurioita. Myös kasvavien lasten aineenvaihdunta on anabolinen, mutta vanhemmilla ihmisillä ja hyvin vähän liikkuvilla aineenvaihdunta on yleensä pitkäkestoisessa katabolisessa tilassa.

Anabolisen aineenvaihdunnan käynnistyminen

Anabolinen aineenvaihdunta käynnistyy yleensä ruokailun jälkeen. Ravinnosta saaduista perusmolekyyleistä muodostetaan elimistössä suurempia molekyylejä, kuten lihasten tarvitsemia proteiineja.

Kun ruokailusta kuluu enemmän aikaa ja ravintoaineiden saatavuus ruoansulatuskanavan kautta vähenee, aineenvaihdunnan painopiste siirtyy katabolisten reaktioiden puolelle.

Anaboliset reaktiot kuluttavat energiaa

Anaboliset reaktiot kuluttavat energiaa ATP:n tai NADH:n (ja NADPH:n) muodossa.
ATP à ADP + Pi
NADH + H+ — NAD+

Katabolinen aineenvaihdunta tuottaa ravintoaineista soluhengityksen avulla energiaa. Anabolinen aineenvaihdunta rakentaa ja uusii elimistön rakenteita mm. proteiinisynteesissä.

Kehon energiantuotanto: Kuinka hiilihydraatit tuottavat energiaa

Hiilihydraatit ovat energiansaannin kannalta tehokkaimpia ravintoaineita. Myös rasvat ja proteiinit voidaan hyödyntää energiaksi.

Rasvat ovat hiilihydraatteja edullisempi tapa varastoida energiaa, sillä niissä on yli kaksinkertainen määrä energiaa painoyksikköä kohden.

Hiilihydraateista pilkotut sokerit imeytyvät verenkiertoon ohutsuolessa. Glukoosi kohottaa verensokeria, johon haima reagoi erittämällä vereen insuliinia. Insuliini kiinnittyy solun pinnassa olevaan insuliinireseptoriin, jolloin solussa olevat sokerikanavat (kalvorakkulat) siirtyvät solukelmulle ja päästävät glukoosimolekyylin solun sisälle.

Solulimassa glukoosi osallistuu glykolyysiin eli reaktioiden sarjaan, jossa glukoosimolekyyli hajotetaan pyruvaatiksi. Glukoosi on solujen energiantuotannon yleisin lähtöaine. Fruktoosin aineenvaihdunta tapahtuu maksassa, jossa se muutetaan lipogeneesissä triglyseridiksi eli rasvaksi.

Glukoosi, joka ei ravitse solujen energiantarvetta, varastoituu maksa- ja lihassoluihin glykogeeneinä, joista energiavarasto on nopeasti purettavissa. Glukoosi, joka ei ravitse solujen energiantarvetta tai mahdu glykogeenivarastoihin, siirtyy insuliinin avaamien sokerikanavien avulla rasvakudoksen rasvasoluihin, jossa se muutetaan lipogeneesissa rasvaksi.

Lipogeneesi

Insuliini säätelee lipogeneesiä, jossa veren ylimääräiset glukoosimolekyylit muutetaan triglyserideiksi eli rasvoiksi maksassa, rasvakudoksessa ja toimivan maitorauhasen soluissa. Lipogeneesissä yhdestä glukoosimolekyylistä muodostuu ensin kaksi glyserolimolekyyliä, joihin liittyy glukoosin auenneesta renkaasta muodostunut, pelkistynyt rasvahappoketju.

  • Keho käyttää arviolta 45 % ravinnosta saatavista hiilihydraateista energiantuotantoon ja 55 % hiilihydraateista muutetaan lipogeneesissä rasvahapoiksi.

Rasva-aineenvaihdunta on hyvin dynaaminen. Osa vapaista rasvahapoista hyödynnetään glukoneogeneesissä ja osa varastoituu rasvasoluihin. Rasvasoluista vapautuu kuitenkin jatkuvasti rasvasoluja verenkiertoon. Yksittäisen lipidimolekyylin elinaika on arviolta 2-10 vuorokautta.

Solulimassa tapahtuva reaktioketju – glykolyysi tuottaa energiaa

Glykolyysi tuottaa energiaa ATP-molekyylien muodossa. Soluissa, joilla on käytettävissään happea, energiaa tuottava reaktio etenee glykolyysistä mitokondrioiden soluhengitykseen.

Haima ja haiman tehtävät aineenvaihdunnassa

Haima osallistuu ravintoaineiden aineenvaihduntaan erittämiensä ruoansulatusentsyymien sekä insuliinin ja glukagonin avulla.

Haima muodostuu kahdesta toiminnallisesti erilaisesta solukkotyypistä: avorauhas- ja umpirauhasosasta. Avorauhasosa tuottaa ruoansulatusentsyymejä, jotka pilkkovat kaikkia ravintoaineita (sokereita, rasvoja, proteiineja ja nukleiinihappoja).

Haiman erittämät ruoansulatusentsyymit ja niiden tehtävät

  • Amylaasi: pilkkoo sokereita
  • Peptidaasit: pilkkovat proteiineja
  • Lipaasit: pilkkovat rasvahappoja
  • Nukleaasit: pilkkovat nukleiinihappoja (DNA ja RNA)

Insuliini ja glukagoni säätelevät sokeriaineenvaihduntaa

Haiman umpirauhasosa tuottaa elintärkeitä hormoneja: insuliinia ja glukagonia. Useimmista kehon umpirauhasista poiketen glukagonin ja insuliinin eritystä säätelee veressä olevan sokerin määrä eikä aivojen hypotalamus.

Jos veren sokeripitoisuus on matala, haiman Alfa-solut erittävät glukagonia, joka nostaa verensokeria purkamalla maksaan ja lihaksiin varastoituneita glykogeenejä.

Jos veren sokeripitoisuus on korkea, haiman Beta-solut erittävät insuliinia, joka kiinnittyessään solun insuliinireseptoriin, päästää sokerimolekyylin solun sisälle, jossa se osallistuu energiantuotantoon glykolyysissa ja mahdollisesti edelleen mitokondrion soluhengityksessä.

Glukagoni ja glykogeenit

Keho varastoi osan ravinnosta saaduista sokereista maksa- ja lihassoluihin glykogeeneinä, joista energia on nopeasti purettavissa energiaa tuottavan glykolyysin ja soluhengityksen tarvitsemiksi lyhytketjuisiksi sokereiksi.

Kun haiman erittämä glukagoni kiinnittyy maksa- tai lihassolun pinnalla olevaan reseptoriinsa, sokerin pitkäketjuiset varastomolekyylit eli glykogeenit alkavat hajota solussa lyhytketjuisemmiksi sokereiksi. Glykogeeneistä puretut sokerit kulkeutuvat maksasta verenkiertoon, jolloin verensokeri nousee.

Glukagonin purkaa glykogeenejä ja käynnistää glukoneogeneesin

Verensokerin lasku lisää glukagonin eritystä haimasta. Glukagoni purkaa maksa- ja lihassolujen sokerivarastoja, jolloin verensokeri jälleen nousee.

Glukagoni käynnistää myös maksassa ja munuaisten kuorikerroksessa tapahtuvan glukoneogeneesin, joka syntetisoi glukoosia muista yhdisteistä. Glukoneogeneesin yhteydessä maksassa ja munuaisissa alkaa syntyä ketoaineita.

Insuliinin merkitys glukoosin aineenvaihdunnalle

Kaikkien solujen pinnalla on insuliinireseptoreita. Insuliinin kiinnittyminen solureseptoriinsa laukaisee solun sisällä toisiolähettijärjestelmän. Tämä saa aikaan sen, että solun sisällä olevat transmembraanisia (kalvon läpi ulottuvia) sokerikanavaproteiineja kuljettavat kalvorakkulat kiinnittyvät solukelmuun.

Insuliini saa siis sokerikanavat siirtymään solun ulkopinnalle jolloin glukoosi pääsee siirtymään verestä sokerikanavan läpi solun sisälle.

Mutta on hyvä muistaa, että insuliini myös varastoi ylimääräiset glukoosimolekyylit rasvakudoksen, maksan ja maitorauhasten rasvasoluihin eli adiposyytteihin, joissa sokerit muutetaan lipogeneesissä rasvahapoiksi. Näin veren runsas insuliini- ja glukoosipitoisuus aiheuttavat lihomista.

Glykolyysi

Solu saa energiantuotantoon tarvitsemansa glukoosin joko solun ulkopuolelta tai lihassolun sisällä olevasta glykogeenistä.

Glykolyysi on monesta reaktiovaiheesta muodostuva reaktioketju. Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan palorypälehapon anionimuodoksi eli pyruvaatiksi. Anaerobinen energiansaanti perustuu glykolyysiin, joka tuottaa kaksi ATP-molekyyliä ja kaksi NADH-molekyyliä.

Jos solulla on happea käytettävissään, energiantuotanto jatkuu soluhengityksessä mitokondrioissa. Pyruvaateista saadaan mitokondrioissa eräiden entsyymien avulla tapahtuvassa oksidatiivisessa dekarboksylaatiossa asetyylikoentsyymi-A:ta.

Jos solulta puuttuu mitokondriot (kuten veren punasoluilta) tai happea ei ole käytettävissä, pyruvaatti pelkistyy maitohapoksi.

  • Anaerobinen glykolyysi päättyy pyruvaatin pelkistyessä maitohapoksi
  • Aerobinen glykolyysi jatkaa energiantuotantoa ja tuottaa pyruvaatista edelleen asetyylikoentsyymi-A:ta.

Sokerikanavaproteiinit kiertävät jatkuvasti soluliman ja solukelmun välillä. Kun insuliinipitoisuus laskee veressä, solu imee sokerikanavia sisältävät solukelmun osat sisäänsä.

Ihminen voi kuluttaa vuorokauden aikana painonsa verran ATP-molekyylejä.

ATP eli Adenosiinitrifosfaatti on runsasenerginen mitokondrioiden soluhengityksessä, tai glykolyysin solulimassa tuottama yhdiste. ATP:tä käytetään energian siirtoon ja lyhytaikaiseen varastointiin lihaksissa.

Kun elimistön solut tarvitsevat ATP-molekyyleihin sitoutunutta energiaa, ATPaasi-entsyymi pilkkoo runsasenergisiä sidoksia fosfaattiryhmien väliltä.

ATP:ssä on emäsoasa (adeniini), sokeriosa (riboosi) ja 3 fosfaattiosaa. Kun ATP:stä irtoaa yksi fosfaattiosa, siitä tulee adenosiinidifosfaattia eli ADP:tä ja kun ADP:stä irtoaa fosfaattiosa, syntyy adenosiinimonofosfaatti eli AMP.

Ihminen kuluttaa vuorokauden aikana arviolta painonsa verran ATP-molekyylejä. Yksi ATP-molekyyli kierrätetään jopa 1000-1500 kertaa vuorokauden aikana.

ATP on lihassupistuksen ainoa energianlähde. Sitä on hieman varastoituneena lihaksissa, mutta nämä varastot hyödynnetään nopeasti.

Energian varastomolekyyli: ADP+ADP à ATP+AMP

Kuinka ketogeneesin aineenvaihdunta toimii

Paasto, intensiivinen liikunta tai vähähiilihydraattinen ruokavalio saa aineenvaihdunnan tuottamaan ketoaineita energianlähteeksi. Muutaman päivän vähähiilihydraattinen jakso siirtää aineenvaihdunnan ketoosiin, jolloin ketoaineiden käyttö energianlähteenä tehostuu. Ketoaineiden tuotanto käynnistyy aina, kun veren insuliinipitoisuus laskee.

Haima erittää insuliinia verensokerin eli glukoosipitoisuuden kohotessa. Kun veressä ei ole glukoosia energianlähteenä, aineenvaihdunta ryhtyy hyödyntämään ketoaineita energianlähteenä ja ”polttamaan” rasvoja.

Rasvahappojen hapetus = β-oksidaatio

β–oksidaatiossa rasvahappojen käyttö energiantuotantoon alkaa siten, että rasvat hajotetaan rasvahapoiksi ja glyseroliksi.

Glyseroli hapetetaan solulimassa glyseraldehydi-3-fosfaatiksi ja se voidaan käyttää joko energiantuotantoon (n. 5 % triglyseridistä saatavasta energiasta) tai glukoosin tuottamiseen glukoneogeneesissä.

Rasvahapot hapetetaan mitokondrioissa β–oksidaatiossa. Aluksi rasvahapot aktivoidaan mitokondrion ulkokalvolla kiinnittämällä rasvahapon karboksyyliryhmään koentsyymi-A. Näin muodostunut asyyli-KoA kulkee mitokondrion sisäkalvon läpi aktiivisella kuljetuksella. Näin siksi, että soluliman ja mitokondrion asyyli-KoA:lla on eri tehtävät – solulimassa anabolia, mitokondriossa katabolia.

Mitokondrion matriksissa rasvahappo hajotetaan kaksihiilisiksi pätkiksi (asetyyli-KoA), joka edelleen hapetetaan sitruunahappokierrossa.

Lähteet:

Scientific American

KetoSchool

CNN

Wikipedia – Ketoasidoosi

Wikipedia – Glykolyysi

Wikipedia – Ketoaine

Wikipedia – Ketogeneesi

Wikipedia – Glukoneogeneesi

Solunetti – Solun aineenvaihdunta

Solun aineenvaihdunta – Nina Peitsaro

Safkatutka

Laihdutus.info




Ovatko sokerit epäterveellisiä?

Ovatko sokerit epäterveellisiä? Keskustelu sokerin terveyshaitoista on saanut viime vuosina kiitettävästi näkyvyyttä myös suomalaisissa medioissa. Miksi lisätyn sokerin määrää ja laatua tulisi tarkkailla?

Eräs syy sokerin haitallisuudelle on se, että sokeri on sataprosenttista energiaa, josta puuttuvat kaikki elimistön tarvitsemat välttämättömät ravintoaineet. Sakkaroosi eli pöytäsokeri koostuu ”tyhjistä kaloreista”, jotka lihottavat.

Emeritusprofessori ja sisätautien erikoislääkäri Jussi Huttunen on kirjoittanut Duodecimiin valaisevan artikkelin sokereista. Artikkelissaan Jussi Huttunen kirjoittaa mm:

”Sakkaroosin sisältämä hedelmäsokeri näyttää olevan terveydelle erityisen haitallista. Vapaaehtoisille koehenkilöille tehdyssä kokeessa hedelmäsokeri aiheutti epäedullisia muutoksia rasva-aineenvaihdunnassa, lisäsi maksan rasvoittumista ja suurensi veren glukoosi- ja insuliinipitoisuutta. Havainnot sopivat siihen, että sakkaroosi ja sen sisältämä hedelmäsokeri voivat olla vyötärölihavuuden (”pömppövatsa”) ja siihen liittyvän metabolisen oireyhtymän tärkeä syy. Metabolinen oireyhtymä ja vyötärölihavuus diabeteksen tavoin ovat nopeasti yleistyneet teollistuneissa yhteiskunnissa, mahdollisesti juuri nopeasti kasvaneen sokerin kulutuksen seurauksena.

Sokeri on nousemassa myös tärkeäksi sepelvaltimotaudin syyksi. Äsken julkaistussa tutkimuksessa sokerilimuja säännöllisesti juoneiden sepelvaltimotautivaara oli viidenneksen suurempi kuin niiden, jotka nauttivat vain keinotekoisilla makeutusaineilla makeutettuja juomia. Osa mutta vain osa muutoksesta näytti johtuvan lihomisesta ja sen seurauksista. Aivan uusi havainto oli sokerijuomien yhteys tulehdusmittareihin (mm. CRP). Sokerijuomat voivat tavalla tai toisella lisäävän ihmisten tulehdusalttiutta ja mahdollisesti sitä kautta myös sydänoireita.” Lue koko artikkeli tästä >>

Mitä hiilihydraatit ja sokerit ovat?

Hiilihydraatteihin luetaan sokerit, tärkkelys ja ravintokuitu (selluloosa). Hiilihydraateista saatava glukoosi on solujen tärkein polttoaine. Glukoosi muutetaan energiaksi ensin glykolyysissä ja glykolyysin jälkeen hapen kanssa soluhengityksessä. Glykolyysi ja soluhengitys tuottavat energiaa ATP-molekyyleinä.

Hiilihydraatit eivät ole elimistölle välttämättömiä ravintoaineita vaikka aivot tarvitsevat glukoosista saatavaa energiaa. Elimistö on evoluution aikana kehittänyt mekanismeja, joilla se tuottaa glukoosia myös silloin, kun sitä ei ole ravinnosta saatavilla. Elimistö on oppinut turvaamaan solujen energiansaannin ketogeneesillä ja glukoneogeneesillä. Ketogeneesissä syntyy ketoaineita, joita elimistö voi käyttää energianlähteinä. Glukoneogeneesi syntetisoi glukoosia muista ravintoaineista ja vedestä.

Näiden evoluution aikana kehittyneiden aineenvaihduntamekanismien ja veden avulla terve normaalipainoinen ihminen selviää ilman ravintoa ainakin kuukauden. Esimerkiksi Gandhi paastosi vielä 74-vuotiaana 21 päivää pelkällä vedellä.

Ensimmäiset ihmiset saivat pääosan sokeristaan hunajasta, hedelmistä, kasviksista, juurista ja marjoista, mutta näistä saatavan sokerin määrä oli murto-osa siitä, mitä nykyihmiset kuluttavat. Sokerinlähteitä ei myöskään aina ollut saatavilla, joten elimistön piti syntetisoida solujen tarvitsemia sokereita mm. varastorasvasta ja proteiineista. Yhdysvalloissa sokerin kulutus on 40-kertaistunut 250 vuodessa.

Sokereiden kulutuksen merkittävin kasvupiikki alkoi 1970-luvulla. Diabeteksen ja lihavuuden kasvukäyrät noudattavat melko täsmällisesti sokereiden kulutuskäyrää, mutta onko sairastuvuuden ja sokerin kulutuksen välillä kausaalisuhdetta?

Hiilihydraatit ja sokerit

Hiilihydraatteihin lukeutuvat viljat ja perunat sisältävät runsaasti tärkkelystä ja pieniä määriä kivennäisaineita, proteiineja, rasvoja sekä vitamiineja. Tärkkelys muodostuu kymmenistä tai sadoista glukoosimolekyyleistä.  Ruoansulatuksessa tärkkelys pilkotaan glukoosimolekyyleiksi.

Hiilihydraattimolekyylit muodostuvat hiilestä, vedystä ja hapesta eli ne ovat hiilen hydraatteja. Yksinkertaiset hiilihydraatit tuottavat 3.87 kcal energiaa/g. Monimutkaisemmat hiilihydraatit tuottavat energiaa 3.57-4.12 kcal/g.

Hiilihydraatit ryhmitellään edelleen sokeriyksiköiden lukumäärän mukaan monosakkarideihin, joita ovat,

  • glukoosi
  • fruktoosi
  • galaktoosi
  • sekä riboosi ja deoksiriboosi, jotka ovat RNA:n ja DNA:n rakennusaineita

disakkarideihin, joita ovat,

  • sakkaroosi
  • maltoosi
  • laktoosi
  • trehaloosi

sekä oligosakkarideihin ja polysakkarideihin.

Tutuimmat monosakkaridit ovat glukoosi (rypälesokeri) ja fruktoosi (hedelmäsokeri). Disakkarideista tutuimmat ovat on glukoosista ja fruktoosista muodostuva sakkaroosi eli pöytäsokeri ja maitosokeri laktoosi.

Laktoosi

Vauvat saavat äidinmaidosta kaikki tarvitsemansa ravinteet, mutta joka kuudennen suomalaisen ohutsuoli ei enää varhaislapsuuden jälkeen tuota laktoosin pilkkomiseen tarvittavaa entsyymiä – laktaasia, minkä vuoksi maitosokeri aiheuttaa erilaisia vatsavaivoja. Laktoosin sietäminen aikuisena on epigeneettinen muutos, jota esiintyy lähinnä eurooppalaistaustaisilla ihmisillä. Suurin osa maailman väestöstä ei juo maitoa varhaislapsuuden jälkeen. Laktoosi-intoleranssi on käytännössä vallitseva ominaisuus Aasiassa ja Afrikassa toisin kuin Pohjoismaissa.

Uppsalan yliopiston ja Karoliinisen instituutin tekemän laajan seurantatutkimuksen mukaan runsas maidonjuonti voi ylläpitää kehon matala-asteista tulehdusta ja johtaa ennenaikaiseen kuolemaan. Lue tästä >>

Suomalaiset asiantuntijat kiirehtivät heti tyynnyttelemään ihmisiä toteamalla, että useimmat tutkimukset osoittavat, että maito on matala-asteisen tulehduksen suhteen neutraali vaikuttaja.

Maidossa ongelmia voi laktoosin ohella aiheuttaa kuitenkin maitoproteiinit, kuten A1 ja A2 beetakaseiinit. A1-beetakaseiini on ilmeisesti haitallista terveydelle.

” Research shows a strong association between the consumption of A1 casein and various health problems. Numerous studies, including data from the World Health Organization (WHO), have linked A1 with increased risk of heart disease, high cholesterol, type 1 diabetes, sudden infant death syndrome, and neurological disorders, such as autism and schizophrenia, and possibly allergies. But these health issues are not associated with consumption of A2 casein.” Tutkimuksia aiheesta löydät täältä >>

Sakkaroosi eli sukroosi (tavallinen sokeri)

Sokerilla tarkoitetaan puhekielessä yleensä sakkaroosia (pöytäsokeri), jota valmistetaan teollisesti sokeriruo’osta ja sokerijuurikkaasta. Sakkaroosi muodostuu yhtäläisestä määrästä tiukasti sitoutuneita glukoosi- ja fruktoosimolekyylejä (ts. sakkaroosia muodostuu, kun α-D-glukoosin 1-hiilen hydroksyyliryhmä sitoutuu β-D-fruktoosin 2-hiileen glykosidisidoksella).

Sakkaroosia esiintyy yleisesti kasveissa. Erityisen paljon sitä on sokeriruo’ossa, sokerijuurikkaassa, ananaksessa, maississa ja porkkanassa. Sokeria tuotetaan vuosittain noin 130 miljoonaa tonnia.

Polysakkaridit

Tavallisia polysakkarideja ovat kasveissa sokereiden varastomuoto tärkkelys ja selluloosa. Ne ovat useista yhteen liittyneistä monosakkarideista muodostuvia hyvin suuria molekyylejä, joissa on tyypillisesti yli 20 monosakkaridiyksikköä – joskus jopa satoja tai tuhansia.

Polysakkaridit eroavat useimmista sokereista siinä, että ne eivät maistu makealta tai liukene veteen. Selluloosa eli kuitu muodostuu jopa miljoonista glukoosimolekyyleistä. Ihmisen suolistossa ei ole selluloosaa pilkkovaa entsyymiä. Kuitu on kuitenkin suoliston hyvinvoinnille tärkeä ravinne, sillä sulamaton kuitu ja resistentti tärkkelys ravitsevat suoliston hyvää mikrobikantaa, joka puolestaan osallistuu kemiallisesti geenien säätelyyn, immuunijärjestelmän ylläpitoon ja eräiden vitamiinien tuotantoon.

Harvinaisempia sokereita ihmisen suolisto ei pysty pilkkomaan, vaan suoliston bakteerit käyttävät niitä ravintona. Esimerkiksi herneissä ja pavuissa on tällaisia oligosakkarideja, joissa sakkarideihin on sitoutunut myös aminohappoja.

Glukoosi eli rypälesokeri

Glukoosi (C6H12O6) on kasvien yhteyttämisen tärkein lopputuote ja useimpien eliöiden soluhengityksen lähtöaine yhdessä hapen kanssa. Glukoosi on ihmiselle elintärkeä sokeri, josta solut vapauttavat soluhengityksessä energiaa elimistön käyttöön.

Glukoosia on monissa muissa sokereissa, kuten sakkaroosissa ja laktoosissa sekä varasto- ja rakennepolysakkarideissa (glukaanit) kuten tärkkelys, glykogeeni ja selluloosa.

Glukoosi ja sen fosfaatit toimivat soluhengityksen lähtöaineina: glukoosi metaboloituu glykolyysin ja sitruunahappokierron seurauksena vedeksi ja hiilidioksidiksi ja tuottaa reaktiossa adenosiinitrifosfaattia eli ATP:ta. Yhdestä glukoosimolekyylistä vapautuu energiaa 26-38 ATP-molekyylin verran.

Hiilihydraatit pilkotaan ruoansulatuskanavassa ja ne imeytyvät ohutsuolesta verenkiertoon. Glukoosi nostaa verenkiertoon imeydyttyään verensokeria, mikä saa haiman erittämään insuliinia. Insuliinia tarvitaan, että glukoosi pääsee kulkemaan rasva- ja lihassolujen solukalvon läpi. Insuliinimolekyylit kiinnittyvät solukalvojen insuliinireseptoreihin.

Insuliinireseptorit säätelevät glukoosin varastoitumista glykogeeniksi ja rasvahapoiksi sekä mahdollistavat glukoosista syntyvien aineenvaihduntatuotteiden käytön sitruunahappokierrossa ja elektroninsiirtoketjussa. Haiman insuliinin eritystä lisää pääasiassa pohjukaissuolen seinämästä verenkiertoon erittyvä GIP-hormoni, parasympaattinen hermosto sekä glukoosin määrä veressä. Insuliinin vastavaikuttajia ovat glukagoni ja adrenaliini.

Insuliinireseptorit säätelevät glukoosin varastoitumista glykogeeniksi ja rasvahapoiksi.

Ylimääräinen glukoosi varastoidaan glykogeeninä maksaan ja lihaksiin, josta glukagoni vapauttaa sitä nopeasti elimistön ja lihasten energiaksi. Kun glykogeenivarastot ovat täynnä, maksa ja rasvakudos ryhtyvät muuttamaan glukoosia lipogeneesissä triglyserideiksi eli rasvahapoiksi, joka varastoidaan rasvasoluihin.

Fruktoosi eli hedelmäsokeri

Fruktoosi eli hedelmäsokeri (C6H12O6) on sokeri, jota esiintyy marjoissa, hedelmissä ja hunajassa. Fruktoosi on maultaan noin kaksi kertaa makeampaa kuin glukoosi ja siksi sitä käytetään paljon makeutusaineena. Fruktoosi ei ravitse solujen energiantarvetta, sillä elimistö voi metaboloida fruktoosia ainoastaan maksassa. Tavallinen fruktoosi imeytyy osalla ihmisistä epätäydellisesti suolistossa ja se voi aiheuttaa runsaasti oireita ärtyvän suolen oireyhtymästä (IBS) kärsiville. HS-artikkeli fruktoosista >>

Fruktoosia on pidetty terveellisenä sokerina, koska sen glykeeminen indeksi eli vaikutus verensokeriin, on matalampi kuin glukoosilla. Fruktoosia on tästä syystä suositeltu erityisesti diabeetikoille.

Viimeisimpien tutkimusten perusteella fruktoosi on glukoosia haitallisempi sokeri.

Suolistosta fruktoosi kulkeutuu maksaan, jossa se metaboloidaan. Osa maksaan kulkeutuneesta fruktoosista muutetaan glukoosiksi ja osa syntetisoidaan rasvahapposynteesissä eli lipogeneesissä triglyserideiksi, jotka lisäävät viskeraalisen rasvan kerääntymistä elimiin ja niiden ympärille. Viskeraalinen rasva altistaa erilaisille sydän- ja verisuonitaudeille. Tutkimuksia aiheesta llöydät täältä >>

Mitä viskeraalinen rasva on?

”Suuri vyötärönympärys kertoo sisäelinten ympärille kertyneestä rasvasta, joka on terveyden kannalta erityisen haitallista. Viskeraalinen, eli sisäelinten ympärille kertyvä rasva lisää huomattavasti enemmän terveysriskejä kuin esimerkiksi ihon alle reisiin, takamukseen tai käsivarsiin kerääntyvä rasva. Tutkimusten mukaan etenkin kakkostyypin diabeteksen vaara suurenee huomattavasti, jos henkilöllä on paljon viskeraalista rasvaa.

Jos rasva kerääntyy vatsaontelon sisään, se asettuu myös sisäelinten, kuten maksan, munuaisten, haiman ja sydämen seutuun. Kun nämä aineenvaihdunnalle ja elämälle tärkeät elimet rasvoittuvat, terveys on uhattuna. Sokeriaineenvaihdunta häiriintyy ja seurauksena on nopeasti tyypin 2 diabetes. Myös verisuonet rasvoittuvat ja kalkkeutuvat. Sydänkohtaukset ja aivohalvaukset ovat vatsakkailla huomattavasti yleisempiä kuin hoikkavatsaisilla.” Lue tästä >>

Triglyseridit varastoituvat mm. maksaan ja altistavat alkoholista riippumattomalle rasvamaksan kehittymiselle, metaboliselle oireyhtymälle ja aikuistyypin diabetekselle. Fruktoosi lihottaa ensinnäkin rasvahapposynteesin kautta, mutta myös siksi, että se ei lisää kylläisyyden tunnetta toisin kuin glukoosi. On myös viitteitä siitä, että runsas fruktoosinsaanti hidastaa oppimiskykyä ja heikentää muistia.

Erityisen haitallisena pidetään fruktoosisiirappia (HFCS, maissisiirappi), joka on glukoosisiirapista teollisten entsyymien avulla fruktoosisiirapiksi muutettu teollisesti prosessoitu makeutusaine. Siinä fruktoosimolekyylit ovat suolesta verenkiertoon nopeasti imeytyvässä muodossa. Fruktoosimolekyylien energiapitoisuus on sama kuin glukoosilla (n. 4 kcal/g), mutta fruktoosisiirapin energia ei ravitse kehon ”energian nälkää”, vaan se varastoidaan läskinä.

Hedelmät ja marjat ovat terveellisiä ja niiden syömistä suositellaan. Hedelmissä fruktoosia on yleensä alle puolet hedelmän sokereista ja sekin esiintyy monimutkaisina muita sokereita, flavonoideja, ravintokuitua, mineraaleja ja vitamiineja sisältävinä komplekseina. Lisäksi hedelmän kuidut hidastavat fruktoosimolekyylien imeytymistä. Mutta edes tuorepuristettuja mehuja ei kaikissa lähteissä suositella, koska ne sisältävät monen hedelmän sokerimäärän yhdessä lasillisessa.

Sakkaroosi on fruktoosia parempi vaihtoehto, koska se on disakkaridi, jossa glukoosi- ja fruktoosimolekyylejä sitoo vahva sidos. Se siis pilkkoutuu ja imeytyy fruktoosimolekyylejä hitaammin suolistossa.

Resistentti tärkkelys

Elimistön hyvää mikrobikantaa ravitsee resistentti tärkkelys. Se on siis suoliston hyvinvointia parantava prebiootti, joka ei imeydy suolistosta, vaan fermentoituu paksusuolessa mikrobien vaikutuksesta. Resistenttiä tärkkelystä saa

  • kokojyväviljoista
  • hieman raaoista banaaneista
  • ruskeasta riisistä
  • pavuista ja muista palkokasveista
  • maissista
  • siemenistä
  • raaoista perunoista
  • keitetyistä ja jäähdytetyistä perunoista sekä riisistä

Pronutritionist Reijo Laatikaisen mukaan resistentti tärkkelys saattaa muiden huonosti ohutsuolesta imeytyvien hiilihydraattien tapaan auttaa painonhallinnassa, suolistoterveyden ylläpidossa, estää sydän- ja verisuonisairauksia sekä infektioita. Pronutritionist >>

FODMAP-hiilihydraatit (Fermentable Oligo-, Di-, and Mono-saccharides And Polyols)

Harvemmin käsiteltyjä sokereita ovat paksusuolessa fermentoituvat lyhytketjuiset FODMAP-hiilihydraatit, jotka voivat aiheuttaa kipu- ja turvotusoireita ärtyvän suolen oireyhtymää sairastavilla. Terveillä FODMAP-hiilihydraatit aiheuttavat lähinnä ilmavaivoja. Fermentoituvat hiilihydraatit tuottavat lyhytketjuisia rasvahappoja, joilla on nykytietämyksen valossa terveyttä edistäviä vaikutuksia.

  • Oligosakkaridit à
  • Fruktaanit à FOS*(DP<10), Inuliini (DP>10), GOS (DP<10)
  • Galaktaanit
  • Raffinoosi

*FOS = frukto-oligosakkaridi eli fruktaani

*GOS = galakto-oligosakkaridi eli galaktaani

*DP = degree of polymerization eli sakkaridimolekyylien määrä

Polyolit eli sokerialkoholit ovat

  • isomalt
  • ksylitoli
  • laktitoli
  • maltitoli
  • sorbitoli

Oligosakkarideja, joissa on fruktoosi-fruktoosi-sidoksia, kutsutaan fruktaaneiksi (frukto-oligosakkarideiksi). Fruktaaneja saa viljoista ja sipulista. Galakto-oligosakkarideja eli galaktaaneja esiintyy mm. sienissä ja palkokasveissa. Raffinoosi on trisakkaridi, joka muodostuu glukoosista, galaktoosista ja fruktoosista. Raffinoosia on erityisesti kaaleissa, soijassa, pavuissa, kokojyväviljoissa ja parsassa. Inuliini on pitkäketjuinen fruktaani, jota on lisäty viime vuosina terveysvaikutteisiin jogurtteihin ja ravintolisiin prebioottisten ominaisuuksien vuoksi.

Sokerialkoholit eli polyolit (ksylitoli, laktitoli, sorbitoli, maltitoli, mannitoli ja isomalt) ovat hiilihydraatteja, joissa hydroksiryhmä (-OH) esiintyy molekyylissä

Inuliini, fruktaanit ja galaktaani ovat prebiootteja, jotka ravitsevat suolen hyvälaatuisia mikrobeja ja lisäävät lyhytketjuisten rasvahappojen syntyä.

Lähde: Pronutritionist

Glukagoni ja glykogeeni

Kasveissa sokeri varastoituu tärkkelyksenä. Eläimillä ja ihmisillä sokeri varastoituu glykogeeninä lihaksiin ja maksaan, josta sitä vapautuu glukagonin vaikutuksesta vereen ja lihassoluihin. Glukagoni, jota erittyy haiman Langerhansin saarekkeiden alfasoluista, säätelee sokeriaineenvaihduntaa ja se toimii haiman Langerhansin saarekkeiden beetasoluista erittyvän insuliinin vastavaikuttajana. Kun verensokeri on alhaalla, glukagoni lisää glukoosia vereen. Se stimuloi edelleen insuliinin eritystä yhdessä ruoansulatuskanavan entsyymien (GIP) kanssa.

Glukagoni vapauttaa adrenaliinin avulla glukoosia maksan glykogeenivarastoista ja käynnistää myös glukoneogeneesin jo ennen glykogeenivarastojen ehtymistä. Tämä aineenvaihduntamekanismi tuottaa solujen tarvitsemaa sokeria myös silloin, kun ravinto ei sisällä hiilihydraatteja.

Tarvitseeko elimistö sokerista saatavaa energiaa?

Ravinto ei ole vain energiaa. Keho tarvitsee energian lisäksi elimistöä ja aineenvaihduntaa ylläpitäviä suojaravinteita sekä solujen uusiutumisen tarvitsemia ravintoaineita.

Solut uusiutuvat jatkuvasti noin 200 gramman päivävauhtia. Keho tarvitsee välttämättömiä ravintoaineita ylläpitämään solujen uusiutumista, aineenvaihduntaa ja immuunijärjestelmää.

”Ihmisen tarvitsema kalorimäärä on melko vakio. Mitä suurempi määrä kaloreista tulee sokereista, sitä vähemmän ihminen syö sellaista ruokaa, jonka tiedetään edistävän terveyttä. Terveysongelmat eivät siis välttämättä aiheudu suoraan sokerista vaan siitä, että muiden ruokien terveysvaikutukset jäävät saamatta, kun niiden sijaan syödään sokeria”, Huttunen sanoo.” HS

Nälkä ei siis tarkoita vain energiavajetta, vaan se kertoo yleisemmin siitä, että elimistö tarvitsee ravintoaineita ylläpitämään kehon uusiutumista ja homeostaasia. Lienee melko yleistä, että päivittäisestä energiasta 10-20 % saadaan lisätyistä sokereista. Tämä ei kuitenkaan tyydytä elimistön ravinteiden tarvetta, vaan ravinteet on välttämättä saatava jostakin.

Paljonko lisättyä sokeria voi syödä?

“We have solid evidence that keeping intake of free sugars to less than 10% of total energy intake reduces the risk of overweight, obesity and tooth decay.” Dr Francesco Branca, Director of WHO’s Department of Nutrition for Health and Development.

Helsingin yliopiston ravitsemustieteen professori Mikael Fogelholm sanoo, ettei sokerinsaanti linkity tutkimuksissa lihomisen riskiin: ”Sakkaroosin lähteitä on niin monia, ja monet eri lähteet ovat eri tavoin yhteydessä lihavuuteen. Sama koskee hiilihydraatteja, rasvaa ja proteiinia. Näillä ei ravintoaineina näytä olevan yhteyksiä painonmuutoksiin.” Mikael Fogelholm / Iltalehti / Keventäjät / MTV3 2015

Kaksi erilaista näkemystä sokereista. Maailman terveysjärjestön (WHO:n) suositus lisätylle sokerille on enintään 5-10 % päivittäisestä energiansaannista. Helsingin yliopiston ravitsemustieteen professorin mielestä 10 % päivittäisestä energiasta voi tulla lisätystä sokerista.

Suomessa puhtaan sokerin kulutus on ravitsemussuositusten mukaisesti keskimäärin 10 % päivittäisestä kokonaisenergian saannista, eli karkeasti 50 g/päivä/hlö. Osa väestöstä kuluttaa lisättyä sokeria selvästi suosituksia enemmän ja osa selvästi vähemmän kuin suositellaan.  Sokerinkulutuksen keskiarvo kertookin vain väestön keskimääräisen kulutuksen.Ilmiöstä tekee huolestuttavan se, että eräs sokeria liikaa käyttävistä väestöryhmistä ovat kasvuikäiset lapset. Sokeria on lisätty jogurtteihin, mehuihin, kiisseleihin ja muroihin puhumattakaan virvoitus- ja energiajuomista tai makeisista. On oikeastaan vaikeaa löytää elintarvikkeita, joihin ei olisi lisätty sokeria tai jotakin muuta makeutusainetta.

Ovatko sokerit terveydelle haitallisia?

”Researchers find strongest link yet between high sugar consumption and obesity. 22,000 cancer cases a year avoidable if we were all healthy weight. People who eat more sugar are much more likely to be obese than those who eat less, according to a landmark finding by University of Reading scientists.” https://www.reading.ac.uk/news-and-events/releases/PR626778.aspx

Readingin yliopiston tutkijat havaitsivat, että runsas sokerin (sakkaroosin) saanti korreloi lihomisen kanssa. Tutkijat Readingin, Cambridgen ja Arizonan yliopistoista vertasivat 1700 Norfolkissa asuvan henkilön sokerin kulutusta ja painoa kolme vuotta kestäneessä seurantatutkimuksessa.

Tutkimukseen osallistuvia pyydettiin raportoimaan omasta sokerin kulutuksestaan ja raportteja verrattiin tutkimukseen osallistuneiden virtsanäytteistä saatuihin tuloksiin. Kolmivuotisen tutkimuksen lopuksi mitattiin osallistuneiden painoindeksi.

Virtsanäytteiden mukaan eniten sokeria kuluttaneet olivat 54 % todennäköisemmin ylipainoisia kuin ne, jotka käyttivät virtsanäytteiden perusteella vähiten sokeria. Tutkimus osoitti myös, että ylipainoiset aliarvioivat oman sokerin kulutuksensa (oma raportointi vs. virtsanäyte). Ne, jotka raportoivat käyttävänsä paljon sokeria, olivat 44 % todennäköisyydellä laihempia, kuin ne, jotka kertoivat syövänsä vain vähän sokeria. Tämä on mielenkiintoista, sillä tutkimus kyseenalaistaa aikaisempien seurantatutkimusten osallistuneiden omaan raportointiin ja kyselyihin perustuvien tulosten luotettavuuden.  Kaikki valehtelevat, sanoisi Dr. House.

Tohtori Giota Mitrou (Head of Research Funding and Science Activities at WCRF) huomautti tutkimusta kommentoidessaan, että on yhdeksän syöpätyyppiä, jotka ovat selvästi yhteydessä lihavuuteen ja että siksi on tärkeää tutkia, onko lihavuuden ja lisätyn sokerin välillä kausaalisuhde.

Dr Gunter Kuhnle, nutritional scientist at the University of Reading, said: ”There have been heated discussions about the role of sugar in the war against obesity, with some claims that sugar doesn’t have anything to do with putting on weight. These claims were based on research which showed that people who consume high amounts of sugar are not heavier than those who don’t.

”However, these studies relied on the information about sugar consumption given by the participants. This turns out to be a big problem, as our study shows that people with a higher BMI tend to underreport the amount of sugar they consume.

Association between sucrose intake and risk of overweight and obesity in a prospective sub-cohort of the European Prospective Investigation into Cancer in Norfolk (EPIC-Norfolk) – Gunter GC Kuhnle, Natasha Tasevska, Marleen AH Lentjes, Julian L Griffin, Matthew A Sims, Larissa Richardson, Sue M Aspinall, Angela A Mulligan, Robert N Luben and Kay-Tee Khaw / Public Health Nutrition / Volume 18 / Issue 15 / October 2015,

Tutkimuksen rahoittivat World Cancer Research Fund (WCRF), Medical Research Council (MRC) ja Cancer Research UK ja tutkimuksessa seurattiin vuosina 1993 ja 1995 pitkäkestoiseen ravinnon ja syövän suhteita kartoittavaan EPIC -seurantatutkimukseen värvättyjä1700 henkilöä. EPIC tutkimushankkeessa on mukana yli 25 000 tutkittavaa ja tutkimusten tuloksiin voi tutustua oheisen linkin kautta: EPIC – European Prospective Invesigation into Cancer and Nutrition.

Muita tutkimuksia

Monien tutkimusten mukaan sokeri ja erityisesti fruktoosi saattavat altistaa lihomiselle, metaboliselle oireyhtymälle ja diabetekselle. Seuraavassa eräitä sokereiden terveysvaikutuksia selvittäviä tutkimuksia.

Sugar-Sweetened Beverages and Risk of Metabolic Syndrome and Type 2 DiabetesA meta-analysis

Vasanti S. Malik, SCD, Barry M. Popkin, PHD, George A. Bray, MD3, Jean-Pierre Després, PHD, Walter C. Willett, MD, DRPH and Frank B. Hu, MD, PHD

RESULTS Based on data from these studies, including 310,819 participants and 15,043 cases of type 2 diabetes, individuals in the highest quantile of SSB (sugar sweetened beverages) intake (most often 1–2 servings/day) had a 26% greater risk of developing type 2 diabetes than those in the lowest quantile (none or <1 serving/month) (relative risk [RR] 1.26 [95% CI 1.12–1.41]). Among studies evaluating metabolic syndrome, including 19,431 participants and 5,803 cases, the pooled RR was 1.20 [1.02–1.42].

CONCLUSIONS In addition to weight gain, higher consumption of SSBs is associated with development of metabolic syndrome and type 2 diabetes. These data provide empirical evidence that intake of SSBs should be limited to reduce obesity-related risk of chronic metabolic diseases.

Sugar-Sweetened Beverages, Weight Gain, and Incidence of Type 2 Diabetes in Young and Middle-Agede Women,

Matthias B. Schulze, DrPH; JoAnn E. Manson, MD; David S. Ludwig, MD; et al

Results Those with stable consumption patterns had no difference in weight gain, but weight gain over a 4-year period was highest among women who increased their sugar-sweetened soft drink consumption from 1 or fewer drinks per week to 1 or more drinks per day (multivariate-adjusted means, 4.69 kg for 1991 to 1995 and 4.20 kg for 1995 to 1999) and was smallest among women who decreased their intake (1.34 and 0.15 kg for the 2 periods, respectively) after adjusting for lifestyle and dietary confounders. Increased consumption of fruit punch was also associated with greater weight gain compared with decreased consumption. After adjustment for potential confounders, women consuming 1 or more sugar-sweetened soft drinks per day had a relative risk [RR] of type 2 diabetes of 1.83 (95% confidence interval [CI], 1.42-2.36; P<.001 for trend) compared with those who consumed less than 1 of these beverages per month. Similarly, consumption of fruit punch was associated with increased diabetes risk (RR for ≥1 drink per day compared with <1 drink per month, 2.00; 95% CI, 1.33-3.03; P = .001).

Conclusion Higher consumption of sugar-sweetened beverages is associated with a greater magnitude of weight gain and an increased risk for development of type 2 diabetes in women, possibly by providing excessive calories and large amounts of rapidly absorbable sugars.

A Prospective Study of Sugar Intake and Risk of Type 2 Diabetes in Women

Sok-Ja Janket, DMD, MPH, JoAnn E. Manson, MD, DRPH, Howard Sesso, SCD, Julie E. Buring, SCD and Simin Liu, MD, SCD

RESULTS—Compared with the lowest quintile of sugar intake, the RRs and 95% CIs for the highest quintiles were 0.84 (0.67–1.04) for sucrose, 0.96 (0.78–1.19) for fructose, 1.04 (0.85–1.28) for glucose, and 0.99 (0.80–1.22) for lactose, after adjustment for known risk factors for type 2 diabetes. Similar findings of no association were obtained in subgroup analyses stratified by BMI.

CONCLUSIONS—Intake of sugars does not appear to play a deleterious role in primary prevention of type 2 diabetes. These prospective data support the recent American Diabetes Association’s guideline that a moderate amount of sugar can be incorporated in a healthy diet.

Potential role of sugar (fructose) in the epidemic of hypertension, obesity and the metabolic syndrome, diabetes, kidney disease, and cardiovascular disease

Richard J Johnson, Mark S Segal, Yuri Sautin, Takahiko Nakagawa, Daniel I Feig, Duk-Hee Kang, Michael S Gersch, Steven Benner, and Laura G Sánchez-Lozada

Currently, we are experiencing an epidemic of cardiorenal disease characterized by increasing rates of obesity, hypertension, the metabolic syndrome, type 2 diabetes, and kidney disease. Whereas excessive caloric intake and physical inactivity are likely important factors driving the obesity epidemic, it is important to consider additional mechanisms. We revisit an old hypothesis that sugar, particularly excessive fructose intake, has a critical role in the epidemic of cardiorenal disease. We also present evidence that the unique ability of fructose to induce an increase in uric acid may be a major mechanism by which fructose can cause cardiorenal disease. Finally, we suggest that high intakes of fructose in African Americans may explain their greater predisposition to develop cardiorenal disease, and we provide a list of testable predictions to evaluate this hypothesis.

Sugar consumption, metabolic disease and obesity: The state of the controversy

KL Stanhope – 2016

The impact of sugar consumption on health continues to be a controversial topic. The objective of this review is to discuss the evidence and lack of evidence that allows the controversy to continue, and why resolution of the controversy is important. There are plausible mechanisms and research evidence that supports the suggestion that consumption of excess sugar promotes the development of cardiovascular disease (CVD) and type 2 diabetes (T2DM) both directly and indirectly. The direct pathway involves the unregulated hepatic uptake and metabolism of fructose, leading to liver lipid accumulation, dyslipidemia, decreased insulin sensitivity and increased uric acid levels. The epidemiological data suggest that these direct effects of fructose are pertinent to the consumption of the fructose-containing sugars, sucrose and high fructose corn syrup (HFCS), which are the predominant added sugars. Consumption of added sugar is associated with development and/or prevalence of fatty liver, dyslipidemia, insulin resistance, hyperuricemia, CVD and T2DM, often independent of body weight gain or total energy intake. There are diet intervention studies in which human subjects exhibited increased circulating lipids and decreased insulin sensitivity when consuming high sugar compared with control diets. Most recently, our group has reported that supplementing the ad libitum diets of young adults with beverages containing 0%, 10%, 17.5% or 25% of daily energy requirement (Ereq) as HFCS increased lipid/lipoprotein risk factors for CVD and uric acid in a dose-response manner. However, un-confounded studies conducted in healthy humans under a controlled, energy-balanced diet protocol that enables determination of the effects of sugar with diets that do not allow for body weight gain are lacking. Furthermore, recent reports conclude that there are no adverse effects of consuming beverages containing up to 30% Ereq sucrose or HFCS, and the conclusions from several meta-analyses suggest that fructose has no specific adverse effects relative to any other carbohydrate. Consumption of excess sugar may also promote the development of CVD and T2DM indirectly by causing increased body weight and fat gain, but this is also a topic of controversy. Mechanistically, it is plausible that fructose consumption causes increased energy intake and reduced energy expenditure due to its failure to stimulate leptin production. Functional magnetic resonance imaging (fMRI) of the brain demonstrates that the brain responds differently to fructose or fructose-containing sugars compared with glucose or aspartame. Some epidemiological studies show that sugar consumption is associated with body weight gain, and there are intervention studies in which consumption of ad libitum high-sugar diets promoted increased body weight gain compared with consumption of ad libitum low- sugar diets. However, there are no studies in which energy intake and weight gain were compared in subjects consuming high or low sugar, blinded, ad libitum diets formulated to ensure both groups consumed a comparable macronutrient distribution and the same amounts of fiber. There is also little data to determine whether the form in which added sugar is consumed, as beverage or as solid food, affects its potential to promote weight gain. It will be very challenging to obtain the funding to conduct the clinical diet studies needed to address these evidence gaps, especially at the levels of added sugar that are commonly consumed. Yet, filling these evidence gaps may be necessary for supporting the policy changes that will help to turn the food environment into one that does not promote the development of obesity and metabolic disease.

Sugar and Cardiovascular Disease

A Statement for Healthcare Professionals From the Committee on Nutrition of the Council on Nutrition, Physical Activity, and Metabolism of the American Heart Association
Barbara V. Howard, Judith Wylie-Roset

As with most other dietary constituents, long-term trial data relating sugar consumption to the development of CVD events are unavailable. Longitudinal cohort studies relating sugar consumption to CVD are equivocal because of the many potential confounders that cannot be adequately controlled in the analyses. Shorter-term studies show consistent adverse effects of sugar consumption on HDL and triglyceride levels, which could accelerate atherosclerosis. High sugar consumption may worsen diabetes control, and the combination of sugar with protein and fats promotes formation of dietary AGEs, which may be especially detrimental to those with diabetes. Although increasing the amount of sugar in an isocaloric diet does not directly lead to changes in energy expenditure or weight gain in controlled feeding studies, high-sugar foods, which are sweet and calorie dense, may increase calorie consumption and lead to weight gain. Furthermore, replacement of whole foods with high-sugar foods compromises attainment of adequate dietary vitamin and mineral intake from whole food sources.

In the absence of definitive evidence, recommendations must rely on professional judgment. No data suggest that sugar intake per se is advantageous, and some data suggest it may be detrimental. The studies above, taken in total, indicate that high sugar intake should be avoided. Sugar has no nutritional value other than to provide calories. To improve the overall nutrient density of the diet and to help reduce the intake of excess calories, individuals should be sure foods high in added sugar are not displacing foods with essential nutrients or increasing calorie intake.

Miksi sokerit lihottavat?

Lipogeneesi eli rasvahapposynteesi on aineenvaihduntaprosessi, jossa hiilihydraatit muuttuvat triglyserideiksi. Käytännössä veren ylimääräinen glukoosi muutetaan varastorasvaksi. Tämä rasvahapposynteesi on aktiivista erityisesti maksan, rasvakudoksen ja toimivan maitorauhasen soluissa.

Lipogeneesin käynnistää insuliini, joka säätelee veren glukoositasoa. Rasvahapposynteesissä yhdestä glukoosimolekyylistä muodostuu ensin kaksi glyserolimolekyyliä, joihin liittyy edelleen glukoosin auenneesta renkaasta muodostunut pelkistynyt rasvahappoketju.

On esitetty arvio, että 45 % syödyistä hiilihydraateista menee suoraan elimistön ravinnoksi ja noin 55 % osallistuu lipogeneesiin.

Rasva-aineenvaihdunta sisältää vielä yhden yllätyksen: osa rasvoista muutetaan glukoneogeneesissä edelleen glukoosiksi ja osa varastoidaan rasvasoluihin.

Insuliini, insuliiniresistenssi ja IGF-1 (Insulin-like Growth Factor-1)

Insuliini on sokeriaineenvaihduntaa säätelevä hormoni, jota tuottaa haiman Langerhansin saarekkeissa sijaitsevat beetasolut. Sen vastavaikuttajia ovat glukagoni ja adrenaliini.

Insuliini ohjaa insuliinireseptoreiden säätelemää glukoosin kulkua rasva- ja lihassolujen solukalvon läpi soluihin, joissa glukoosista vapautetaan soluhengityksen reaktioiden avulla energiaa.

Haima alkaa erittää insuliinia heti aterian jälkeen. Se kuljettaa glukoosia elimistön kaikkiin soluihin. Terveet insuliinireseptorit reagoivat insuliiniin herkästi ja ruokailua seurannut kohonnut verensokeri laskee insuliinin avulla normaaliksi. Reseptoreiden insuliiniherkkyyden heikentymisen seurauksena glukoosi ei pääse soluihin ja verensokeripitoisuus pysyy korkeana.

Insuliiniresistenssi

Insuliiniresistenssi johtaa solujen mitokondrioiden vaurioitumiseen ja lisää mm. metabolisen oireyhtymän, aikuistyypin diabeteksen ja Alzheimerin taudin riskiä. Nykytiedon mukaan insuliiniresistenssi johtuu endoteelin toimintahäiriöstä ääreisvaltimoiden arerioli- ja kalpillaaritasolla. Endoteelin toimintahäiriö on varhaisin tapahtuma valtimonkovettumataudissa, mutta sitä voidaan ehkäistä ja hoitaa ortoglykeemisellä eli vähähiilihydraattisella ruokavaliolla.

Terveyden suurin vihollinen ei ole kolesteroli eikä ravintorasva, vaan lihavuus. Siinä vallitsee aina hiljainen krooninen tulehdustila, inflammaatio. Rasva ei yksin lihota, vaan myös liika hiilihydrattiien syönti. Lihomisen pääsyitä ovat tietyt geenivirheet sekä ihmisen itsensä erittämät hormonit: insuliini, kortisoli, leptiini, greliini ja oreksiinit – sekä adiponektiinin puute. Ne voidaan saada tasapainoon liikunnan ja oikean – ortoglykeemisen – ruokavalion avulla. Se stimuloi kylläisyyshormonia, kolekystokiniiniä. Lähde: tritolonen

Insuliiniresistenssissä haiman tuottaman insuliinin teho on heikentynyt ja lihaksisto sekä muut elimet ottavat glukoosia vastaan huonosti. Samaan aikaan verenkiertoon vapautuu liikaa glukoosia, jolloin verensokeripitoisuus kasvaa. Elimistö on siis tullut resistentiksi eli vastustuskykyiseksi insuliinille.  Insuliiniresistenssin on osoitettu kasvattavan Alzheimerin taudin riskiä 65%.

Insuliiniresistenssi johtaa suurella todennäköisyydellä glukoosi-intoleranssiin (heikentyneeseen sokerinsietokykyyn). Koholla olevat triglyseridit, insuliiniresistenssi, glukoosi-intoleranssi, matala HDL-kolesteroli, venepainetauti ja tulehdussytokiinit kasvattavat sydän- ja verisuonitautien riskiä.

Ruoansulatus: hiilihydraatteja pilkkovat entsyymit

Suolisto on osa ruoansulatuselimistöä. Se alkaa mahalaukusta ja päättyy peräaukkoon. Suolistoon kuuluvat ohutsuoli, paksusuoli ja peräsuoli. Sen tehtävä on pilkkoa ravintoaineita ja imeä nautitusta ravinnosta kaikki hyödyllinen: energiaravinteet kuten hiilihydraatit, joista imeytyy glukoosia energiaa tuottavan soluhengityksen lähtöaineeksi, suojaravinteet, eli vitamiinit ja hivenaineet sekä kasvulle ja solujen uusiutumiselle välttämättömät rasvat ja proteiinit.

Suoliston ja suolistoflooran terveys on terveyden ja hyvinvoinnin lähtökohta. Kun suolisto voi huonosti, myös ihminen voi huonosti. Se ei ole ihme, sillä suoliston limakalvo on pinta-alaltaan 200-300 neliömetriä ja se joutuu tekemisiin päivittäin 1-2 kg ruokamäärän kanssa. Ihmisen elinaikana suoliston läpi kulkee keskimäärin 60 tonnia ravintoa.

Joka minuutti suolistossa uusiutuu noin 55 miljoonaa solua ja joka päivä uusiutuu 200 grammaa soluja. Kaikki solut uusiutuvat 3-4 päivän välein. Uusia soluja muodostuu limakalvon pohjaosissa, joista ne työntyvät pintaa kohti korvatakseen vanhat solut, jotka irtoavat ja tuhoutuvat.

Suolistofloora muodostuu 100 000 miljardista mikro-organismista, jotka edustavat 400-500 mikrobilajia. Aikuisilla mikrobimassa painaa n. 1-2 kiloa. Ihmisessä elää mikrobeja noin 10 kertaa enemmän kuin ihmisessä on soluja.

Mikrobit osallistuvat ravintomassan jäännösten sulattamiseen ja tuottavat siinä yhteydessä aineenvaihduntatuotteita, jotka vaikuttavat positiivisesti elimistön ja immuunijärjestelmän toimintaan. Ruoansulatuskanavan hyödylliset bakteerit auttavat pilkkomaan ravinteita ja muodostamaan vitamiineja.

Suoliston terveys ja suolistoflooran mikrobit ovat yhteydessä lukemattomiin sairauksiin, allergioihin ja autoimmuunitauteihin kuten keliakiaan, Crohnin tautiin ja diabetekseen. Vääränlainen ja yksipuolinen ravinto, antibiootit, reseptilääkkeet, ympäristömyrkyt ja runsas alkoholinkäyttö vaikuttavat suolistoflooraan tuhoavasti.

Hiilihydraatteja pilkkovat entsyymit

Hiilihydraatteja pilkkovia entsyymejä on ruoansulatuskanavassa useita. Tärkkelyksen hydrolyysin aloittaa jo suussa amylaasi ja pilkkominen maltoosiksi jatkuu pohjukaissuolessa. Maltoosi pilkotaan kahdeksi glukoosimolekyyliksi maltaasin avulla. Laktaasi pilkkoo laktoosin eli maitosokerin glukoosiksi ja galaktoosiksi. Sakkaraasi pilkkoo sakkaroosin glukoosiksi ja fruktoosiksi. Glugagoni pilkkoo glykogeenin maksassa ja adrenaliini lihaksissa. Hydrolyysin sijaan glykogeeni pilkkoutuu fosforolyyttisesti, eli glukoosiyksiköiden väliin sitoutuu vesimolekyylin sijasta fosforihappo, jolloin saadaan glukoosi- 1-fosfaattia, jota voidaan käyttää glykolyysissä. Poly- ja oligosakkarideja elimistö ei pysty pilkkomaan hyödynnettävään muotoon, mutta ainakin osa niistä on suolistoflooran hyvinvointia parantavia prebiootteja.

Ohutsuoli ja ravinnon imeytyminen

Ohutsuoli on keskimäärin seitsemän metriä pitkä, mutkitteleva ja onteloinen suoliston osa, joka ulottuu mahalaukun mahaportista paksusuoleen. Sen pinnalla on nukkalisäkkeitä, joiden pinnalla on edelleen hermoja, imusuonia ja verisuonia. Ohutsuolen kolme osaa ovat: pohjukaissuoli, tyhjäsuoli ja sykkyräsuoli. Pohjukaissuoli koostuu edelleen neljästä osasta, joista yläosan alkupäässä on happamalta mahanesteeltä suojaavaa limaa erittäviä pohjukaissuolirauhasia. Tyhjäsuoli ja sykkyräsuoli muodostavat ohutsuolen loppuosan. Tyhjäsuolen limakalvo on poimuttuneempi ja siellä ravintoaineita imeytyy aktiivisesti.

Ohutsuolessa entsyymit pilkkovat ravintoa, eli hiilihydraatteja, proteiineja sekä rasvoja imeytyvään muotoon kemiallisesti ns. kemiallisessa pilkkoutumisessa. Pilkkoutuneet ravintoaineet imeytyvät ohutsuolen seinämän läpi verenkiertoon ja kulkeutuvat sitä kautta kaikkiin elimistön soluihin. Ravintoaineiden kuljettaminen tapahtuu verisuoniston ja imuteiden välityksellä. Ravintoaineet, joita ohutsuoli ei voi hyödyntää, kuten kuidut, kulkeutuvat paksusuoleen, jossa ne fermentoituvat ja tuottavat lyhytketjuisia rasvahappoja, joilla on terveydelle suotuisia ominaisuuksia.

Ohutsuolen seinämässä on monta kerrosta. Uloin kerros koostuu lihassyistä. Niiden sisäpuolella on hermoja, verisuonia, rasvaa ja löyhää sidekudosta sisältävä kerros. Sisempänä on ohut limakalvon lihaskerros ja loput limakalvot. Limakalvo on poimuttunut, mikä lisää suolen sisäpinta-alaa. Se on tarpeen, jotta mahdollisimman paljon suolen läpi kulkevista ravintoaineista voidaan hyödyntää. Limakalvoissa on miljoonia pieniä ulokkeita, eli nukkalisäkkeitä (villus). Nukkalisäkkeiden kautta ravintoaineet imeytyvät elimistöön. Ohutsuolen epiteelisolujen pinnassa on mikrovilluksia, joiden korkeus on 1µm. Solua kohden niitä on 1000-2000. Rengaspoimut laajentavat suolen imeytymispinnan kolminkertaiseksi, villukset kymmenkertaiseksi ja mikrovillukset 20-30 kertaiseksi, joten ohutsuolen koko imeytymispinta-ala on 200-300 neliömetriä.

Suolen limakalvossa on runsaasti imukudosta, joka poistaa suolesta bakteereita ja muita haitallisia aineita. Imukudosta on erityisen paljon sykkyräsuolen loppupäässä. Limakalvossa on myös muita soluja, jotka erittävät limaa, hormoneja ja muita suolen toimintaan vaikuttavia aineita.

Ruoka on ohutsuoleen tullessaan käynyt läpi mekaanisen muokkauksen ja alkanut mahalaukussa pilkkoutua pienempiin osiin. Ohutsuolessa entsyymit jatkavat ravintoaineiden pilkkomista pienemmiksi, imeytyviksi osiksi. Entsyymeitä syntyy ruoansulatuselimissä, kuten haimassa, josta ne kulkeutuvat ohutsuoleen tiehyitä pitkin. Myös ohutsuolen limakalvossa syntyy useita eri entsyymejä.

Melkein kaikki pilkkoutuneet aineet imeytyvät limakalvon nukkalisäkkeisiin. Monet aineet kulkeutuvat nukkalisäkkeiden solujen solukalvon läpi itsestään. Jotkut aineet tarvitsevat imeytymisprosessiin natriumia. Soluista kulkeutuu solukalvon läpi niitä ympäröivään kudosnesteeseen natriumioneja, jolloin soluihin syntyy natriumvajaus. Kun natriumionit palaavat soluihin, niiden mukana kulkeutuu tärkeitä ravintoaineita. Nukkalisäkkeeseen imeytyvät rasvat kulkeutuvat imusuoniston mukana lopulta verenkiertoon. Suuri osa ravintoaineista kulkeutuu maksaan. Sykkyräsuolessa imeytyy suuri osa sapesta ja B12 vitamiinista.

Sulamaton massa kulkeutuu edelleen paksusuoleen, jossa se liikkuu suolenseinämän lihasten supistellessa. Ohutsuoli pystyy käsittelemään noin 10 litraa ruokaa päivässä. Tavallisesti ruoka kulkee ohutsuolen läpi kuudessa tunnissa.

Ohutsuolen tyypillisiä sairauksia ovat pohjukaissuolen haavaumat sekä tulehdukselliset suoistosairaudet kuten ärtyvän suolen oireyhtymä, keliakia ja Crohnin tauti.

 Paksusuoli

Paksusuoli on ohutsuolen jatke, joka alkaa vatsaontelossa oikealta alhaalta. Sen alkuosa on säkin muotoinen ja sitä kutsutaan umpisuoleksi. Umpisuolen kärjessä on ohut lisäke – umpilisäke, siis se osa joka poistetaan umpilisäkkeen leikkauksessa. Heti umpisuolen yläpuolella ohutsuoli liittyy paksusuoleen. Ohutsuolen ja paksusuolen liittymäkohdassa on läppä, joka estää takaisinvirtauksen eräänlaisen venttiilin avulla. Paksusuolen ulkopintaa verhoaa vatsakalvo. Sen sisäpuolella on sidekudosta ja lihaksia. Näitä seuraa kudos, joka tukee koko suolta ja sisimpänä on poimuttunut suolen limakalvo.

Paksusuoli on 1-2 metrin mittainen ja viiden sentin paksuinen suoliston osa, jossa elävät mikrobit myös huolehtivat suoleen tulevan materiaalin käsittelystä yhdessä suolen mekaanisten toimien kanssa. Paksusuolen eräs tärkeimmistä tehtävistä on ottaa suolessa olevasta ravinnosta nestettä ja suoloja. Ruokaa työstetään suussa, mahalaukussa ja ohutsuolessa, joissa imeytyvät tärkeimmät ravintoaineet. Kun työstetty ravintomassa tulee paksusuoleen, siinä on runsaasti vettä, joka poistuu kehosta ulosteen mukana. Paksusuoli imee osan nesteestä.

Paksusuoli voi bakteerien avulla muuttaa tietyt ruoassa olevat aineet siten, että elimistö voi käyttää niitä hyväkseen. Paksusuolessa elää bakteereita, jotka muodostavat suuren osan ulosteen määrästä ja kiinteydestä. Vesi suolat ja mikrobien valmistamat vitamiinit, K-vitamiini ja jotkut B-vitamiinit, imeytyvät paksusuolessa verenkiertoon. Myös selluloosaa (kuitua) pilkkoutuu paksusuolessa jonkin verran. Massa, jota suolisto ei voi hyödyntää, kulkeutuu peräsuoleen, josta se poistuu ulosteena.

Paksusuolella on suuri pinta-ala, jotta se voi ottaa talteen nestettä. Suolen sisäpinnan limakalvo on poimuttunut ja nestettä läpäisevien solujen peittämä. Näiden solujen kautta neste, rasva ja ravintoaineet kulkeutuvat elimistön käyttöön.

Paksusuolella on myös imusuonijärjestelmä, joka kerää solujen ulkopuolista nestettä ja kuljettaa sen takaisin kehon eri osiin. Imusuonissa kuljetetaan suuri osa ravinnosta saatavista rasvoista ja niillä on vasta-aineen muodostuksessa tärkeä rooli.

Soluhengitys ja energia

Hiilihydraatit pilkotaan ruoansulatuskanavassa ensin mekaanisesti ja sitten kemiallisesti entsyymien avulla ohutsuolessa imeytyvään muotoon sokereiksi, vitamiineiksi, kivennäisaineiksi, aminohapoiksi ja rasvoiksi, joilla kullakin on omat tarkoituksensa aineenvaihdunnassa.

Hiilihydraateista saatava glukoosi kulkeutuu veri- ja imusuonien välityksellä ja insuliinin ohjaamana soluihin, jossa se yhdessä hapen kanssa vapauttaa soluhengityksessä energiaa. Soluhengityksen tärkeimmät vaiheet ovat:

Glykolyysi:

Yksinkertaisesti soluhengityksen lähtöaineina ovat glukoosi ja happi ja lopputuotteena syntyy hiilidioksidia ja vettä. Reaktiossa vapautuu energiaa ATP-molekyylien sidoksien purkautuessa. Glykolyysi on solulimassa tapahtuva reaktioiden sarja, jossa glukoosi hajotetaan pyruvaatiksi: reaktiosta saadaan kaksi ATP-molekyyliä ja kaksi NADH-molekyyliä. Pyruvaateista saadaan mitokondrioissa tiettyjen entsyymien avulla edelleen oksidatiivisessa dekarboksylaatiossa asetyylikoentsyymi-A:ta, jos happea on riittävästi. Punasoluissa pyruvaatti pelkistyy mitokondrion ja hapen puutteen seurauksena maitohapoksi. Maitohappoon päättyvää glykolyysiä kutsutaan anaerobiseksi glykolyysiksi ja asetyylikoentsyymi-A:han päättyvää glykolyysiä aerobiseksi glykolyysiksi.

Sitruunahappokierto:

– eli Krebsin sykli (TCA-kierto): on solujen mitokondrioissa tapahtuva monivaiheinen prosessi, jossa ravintoaineista saadut hiiliatomit hapettuvat hiilidioksidiksi ja samojen molekyylien sisältämät vedyt siirtyvät elektroninsiirtäjäkoentsyymeille. Prosessissa vapautuu energiaa ja se on solujen pääasiallinen energianlähde. Ennen kuin hiilihydraatit ja rasvat päätyvät sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon – asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi. Kierron eri vaiheissa sitoutuu vesimolekyylejä ja siinä vapautuu hiilidioksidia sekä vetyioneja ja elektroneja. Nämä siirtyvät hapetus-pelkistysreaktioissa elektroninsiirtäjäkoentsyymeille, joita ovat NAD+ ja FAD. Koentsyymeiltä vedyt siirtyvät edelleen elektroninsiirtoketjuun, jonka päätteeksi ne yhtyvät hengitysilmasta tulleen hapen kanssa vesimolekyyleiksi. Syklisessä reaktiossa sitoutuu myös yksi fosforihappomolekyyli, jolloin muodostuu yksi korkeanenerginen ATP-molekyyli GTP-välivaiheen kautta, ja neljä pelkistynyttä elektroninsiirtäjäkoentsyymiä (kolme NADH:ta ja yksi FADH2) kutakin pilkkoutunutta ja hapettunutta asetyylikoentsyymi-A:ta kohti. Sitruunahappokierto tapahtuu pääasiassa mitokondrion matriksissa, kun elektroninsiirtoketju tapahtuu puolestaan mitokondrion sisäkalvolla. Kiertoon kuuluu kymmenen vaihetta, joista jokaisessa jokinkrboksyylihappo joko sitoo jonkin molekyylin tai siitä irtoaa jotain niin, että se muuttuu toiseksi karboksyylihapoksi.

Elektroninsiirtoketju:

– on mitokondrion sisäkalvolla tai solukalvon kalvoproteiineissa tapahtuva energiaa tuottava reaktiosarja, jossa sitruunahappokierrossa ja sitä edeltäneissä reaktioissa koentsyymeille NADH ja FADH2 siirtyneitä elektroneja siirrellään elektroninsiirtoketjun entsyymiltä toiselle, jolloin elektronin menettävät potentiaalienergiaansa vähitellen vapauttaen samalla energiaa. Vapautuvan energian avulla mitokondrion matriksista pumpataan protoneja mitokondrion kalvojen välitilaan, mikä aiheuttaa elektrokemiallisen gradientin eli potentiaali- ja protonikonsentraatioeron matriksin ja välitilan välille. Muodostunut gradientti purkautuu ATP-syntaasientsyymin kautta, jolloin muodostuu suurenergiaista fosfaattiyhdistettä, ATP:tä. Tätä reaktiota kutsutaan oksidatiiviseksi fosforylaatioksi. Pelkistys elektroninsiirtoketjussa päättyy, kun vety siirtyy molekulaariselle hapelle, joka pelkistyy vedeksi. Hapen pelkistymistä vedeksi katalysoi elektroninsiirtoketjun viimeinen entsyymi – sytokromi-c-oksidaasi.

ATP, eli adenosiinitrifosfaatti on runsasenerginen yhdiste, jota mitokondriot tuottavat soluhengityksellä solulimassa tapahtuvassa glykolyysissä. ATP:ta käytetään energian siirtoon ja lyhytaikaiseen varastointiin. Elimistön solujen tarvitessa ATP-molekyyleihin sitoutunutta energiaa ATPaasi-niminen entsyymi pilkkoo runsasenergiaisia sidoksia fosfaattiryhmien väliltä. ATP muodostuu adeniinista, riboosista ja kolmesta fosfaattiosasta. Kun ATP:stä irtoaa yksi fosfaattiosa, siitä tulee adenosiinidifosfaattia (ADP) ja kahden osan irrotessa adenosiinimonofosfaattia (AMP).

Ihminen käyttää arviolta painonsa verran ATP-molekyylejä vuorokaudessa; ts. yksi ATP-molekyyli kierrätetään vuorokaudessa  1000-1500 kertaa. ATP on lihassoluissa lihassupistuksen ainoa energianlähde.

Ketogeneesi ja glukoneogeneesi

Veren insuliinipitoisuuden laskiessa ja glukagonipitoisuuden noustessa elimistö siirtyy ravintoaineiden varastoinnista varastojen purkuun. Käynnistyy glukoneogeneesi, jossa elimistö alkaa muodostaa glukoosia vapaista aminohapoista sekä rasvojen glyserolista että maitohaposta.

Glukoneogeneesin rinnalla käynnistyy tarvittaessa ketogeneesi, joka vähentää glukoosin valmistustarvetta ja näin ollen säästää aminohappoja, mikä on erityisen tärkeää pitkittyneessä ravinnottomuudessa. Pääasiassa maksa (mutta vähäisessä määrin myös muut kudokset kuten munuaisen kuorikerros) alkaa muodostaa vapaista rasvahapoista ketoaineita, joita mm. aivot ja sydänlihas sekä muu lihaksisto kykenevät käyttämään energianlähteenä palauttaen ketoaineet (asetoasetaatti, beeta-hydroksibutyraatti) asetyylikoentsyymi-A:ksi, joka on suoraan käytettävissä oksidatiiviseen energiantuotantoon Krebsin syklin kautta mitokondrioissa aivan samalla tavalla kuin tapahtuu glukoosinpoltonkin aerobinen osuus.

Aivojen koko glukoosintarvetta ei voi kuitenkaan korvata ketoaineilla, ja maksa tuottaakin sekä ravinnon että omien varastorasvojensa glyserolista sekä ravinnon aminohapoista glukoosia glukoneogeneesillä. Maksan glukoneogeneesin tuotantokyky riittää kaikkiin elämälle välttämättömiin aina pakollisiin glukoosin tarpeisiin. Mm. punasolut tarvitsevat aina yksinomaan glukoosia energiantarpeisiinsa, koska punasoluissa ei ole mitokondrioita. Glukoosista ne käyttävät yksinomaan anaerobisen osuuden ja palauttavat jäljelle jääneen osan maitohappona edelleen muualla käytettäväksi. Aivot tarvitsevat aina täydellisen ketoaineadaptaationkin jälkeen yleensä vähintään 20–30 % energiantarpeestaan glukoosina. Niillä on yleensä aina valmius käyttää ketoaineita noin 30–40 % energiantarpeestaan. Wikipedia

 

Katso sokeria käsitteleviä videoita

Fed Up

The Truth About Sugar

 

Sugar: The Kiss of Death