1

Insuliini ja terveys: Kolmas luku

Kuvasin kahdessa edellisessä artikkelissa (Insuliini ja terveys: Johdanto & Insuliini ja terveys: Hiilihydraatti-insuliinimalli) insuliinin toimintaperiaatteita ja vaikutuksia yleisellä tasolla. Insuliini on elintärkeä hormoni, joka vaikuttaa moniin aineenvaihduntatapahtumiin.

Insuliiniresistenssi liittyy useimpiin elintapasairauksiin lihavuudesta aikuistyypin diabetekseen. Amerikkalaisista jo lähes puolet sairastaa tietämättään insuliiniresistenssiä.

Insuliiniresistenssi ylläpitää nälkää ja lihomista kahdella tavalla:

  1. Veressä on syömisen jälkeen runsaasti glukoosia, mutta insuliiniresistenttien solujen glukoosinotto on häiriintynyt, jolloin ne eivät pysty hyödyntämään glukoosia energian tuotannossa. Veren sokeripitoisuus pysyy korkeana.

     

  2. Tämän vuoksi insuliini päästää verestä glukoosia rasvasoluihin, joiden insuliiniherkkyys säilyy pidempään kuin lihasten insuliiniherkkyys. Rasvasoluissa glukoosi muutetaan triglyserideiksi, eli läskiksi.

    Insuliiniresistenssi ylläpitää nälkää, koska solut eivät pysty tuottamaan glukoosista riittävästi energiaa ja elimistö reagoi solujen energianpuutteeseen hormonaalisesti.

Verestä glukoosi on siirrettävä johonkin, koska korkea verensokeri kasvattaa glykaation riskiä. Glykaatiossa glukoosi sokeroi aminohappoja ja rasvahappoja, jolloin niistä tulee melkein siirappia. Se ei ole ollenkaan toivottavaa.

Glykaation tuottamat AGE:t (Advanced Glycation End-products), eli glykaation lopputuotteet kasvattavat sairastumisen riskiä.

Myös diabetekseen liittyvä virtsaamistarpeen lisääntyminen liittyy siihen, että elimistö yrittää päästä eroon ylimääräisestä sokerista. Diabetes tunnettiin aluksi makeavirtsaisuutena ja monet lääkärit varmistuivat diabetes-diagnoosista haistamalla tai maistamalla potilaansa virtsaa.

Insuliinia käytetään yhä yleisemmin doping-aineena

Yhä useammat urheilijat ja kuntoilijat käyttävät insuliinia suorituskyvyn parantamiseksi, kertoo New Scientist. Insuliinia on käytännössä melkein mahdotonta havaita verestä dopingtesteillä.

Väärin annosteltuna insuliini voi tappaa

Kehonrakentajat olivat edelläkävijöitä insuliinin doping-käytössä jo vuosia sitten. Näyttöä insuliinin laajemmasta hyväksikäytöstä ei ole aiemmin juuri saatu, mutta näyttö on viime aikoina lisääntynyt erityisesti kuntoilijoille ja kehonrakentajille tarkoitetun neulanvaihtojärjestelmän kokoamien tietojen avulla.

Insuliini auttaa urheilijoita kahdella tavalla:

Kehonrakentajilla insuliini toimii anabolisten steroidien, kuten testosteronin tai ihmisen kasvuhormonin rinnalla lihaskudoksen vahvistajana. Steroidit rakentavat lihaskudosta ja insuliini estää lihasproteiinien hajoamisen.

Insuliini vahvistaa myös mm. keskimatkan juoksijoiden ja muiden urheilijoiden kestävyyttä mahdollistamalla tehokkaamman lihasglykogeenien sokeritankkauksen.

Mitä suuremmat glykogeenivarastot lihaksilla on, sitä kauemmpin lihakset jaksavat puurtaa väsymättä. Kestävyysurheilijoilla tankkaus voi vaikuttaa kilpailun lopputulokseen.

Tankatessa urheilijoiden on infusoitava insuliinia ja glukoosia samanaikaisesti muutaman tunnin ajan vereen. Menetelmä aiheuttaa tarkoituksellisen hyperinsulinemian.

Pitkällä aikavälillä anabolisten steroidien käyttö voi vahingoittaa mm. lisääntymisterveyttä ja mieskuntoa. Insuliinin yliannostus voi myös aiheuttaa kuolemaan johtavan kooman poistamalla verestä niin paljon sokeria, että aivosolut eivät saa riittävästi energiaa ja happea.

Houkutus insuliinin käyttöön on kuitenkin suuri. Sen teho on ilmeinen ja se häviää nopeasti verenkierrosta. Noin puolet insuliinista poistuu verenkierrosta vain neljässä minuutissa. Vaikka insuliinia havaittaisiin, sitä ei voida mitenkään erottaa ihmisen omasta insuliinista.

Hyperinsulinemia voi kasvattaa glukoosimetabolian nopeutta kaksinkertaiseksi

Kansainvälinen olympiakomitea kielsi insuliinin vuonna 1998. Kielto ei kuitenkaan koske diabeetikkoja, joiden terveys riippuu insuliinista. Diabetes UK, joka edustaa maan diabeetikkoja, myöntää, että joillakin diabeetikoilla saattaa olla taloudellinen houkutus myydä insuliinia doping-käyttöön.

Insuliini on anabolinen hormoni

Insuliini on anabolinen hormoni, jolla on metabolisia vaikutuksia koko kehossa. Haiman Langerhansin saarekkeiden beetasolut vastaavat insuliinisynteesistä.

Beetasolut säätelevät insuliinin tuotantoa seuraamalla plasman sisällä kiertävien energiaravinteiden, glukoosin, aminohappojen, ketohappojen ja rasvahappojen tasoja.

Insuliini orkestroi energiansäästöä ja -käyttöä ravinnonsaannin ja paaston aikana.

Insuliiniaineenvaihdunnan käsitteitä

  • Glukoneogeneesi: Glukoosin syntetisoiminen eräistä aminohapoista, glyserolista ja sitruunahappokierron väliaineista
  • Glykolyysi: Glukoosin hajoaminen pyruviinihapoksi* sekä energian tuottaminen glukoosista
  • Glykogeneesi: Glykogeenin synteesi glukoosista
  • Glykogenolyysi: Glykogeenin hajoaminen glukoosiksi
  • Lipogeneesi: Asetyylikoentsyymi-A:n muuttaminen rasvahapoiksi ja sitä seuraava triglyseridisynteesi
  • Lipolyysi: Lipidien ja triglyseridien hajoaminen vapaiksi rasvahapoiksi ja glyseroliksi. Vapaista rasvahappoista valmistetaan ketoaineita (asetoni, asetoasetaatti ja betahydroksibutyraatti). Glyserolia käytetään glukoneogeneesissä glukoosin syntetisoimiseen.

Pyruviinihappo ja pyruvaatti

*Termejä pyruvaaatti (pyruvate) ja pyruviinihappoa (pyruvic acid) käytetään usein rinnakkain. Niiden välillä on selvä ero. Pyruviinihappo on happo, joka voi vapauttaa vetyionin ja sitoutua positiivisesti varautuneeseen natrium- tai kaliumioniin happosuolan muodostamiseksi.

Happosuola tunnetaan nimellä pyruvaatti. Toisin sanoen pyruvaatti on pyruviinihapon suola tai esteri.

Keskeinen ero pyruviinihapon ja pyruvaatin välillä on, että karboksyylihapporyhmän vetyatomi puuttuu tai se on poistettu. Pyruviinihapon heikon happamuusluonteen vuoksi se dissosioituu helposti vedessä ja muodostaa siten pyruvaatin.

Pyruvaatti on tärkeä kemiallinen yhdiste ihmisen aineenvaihdunnassa ja biokemiassa. Pyruvaatti osallistuu glukoosin metaboliaan, eli glykolyysiin, jossa yksi glukoosimolekyyli hajoaa kahdeksi pyruvaattimolekyyliksi. Pyruvaattimolekyylejä käytetään edelleen muissa reaktiosarjoissa (sitruunahappokierrossa) energian tuottamiseksi.

Insuliinin solumetabolia

Lihaskudoksen, verisuonten endoteelin, sydämen ja maksan soluissa tapahtuu insuliinin aktivoima kaskadi.

Biokemiallinen kaskadi tunnetaan myös signalointikaskadina tai signalointireitinä. Kaskadi tarkoittaa yleensä jonkin ärsykkeen laukaisemia soluissa lineaarisesti eteneviä kemiallisia reaktioita. Suurin osa biokemiallisista kaskadeista on tapahtumasarjoja, joissa yksi biokemiallinen tapahtuma laukaisee seuraavan jne.

Insuliinin tuottama vaste näissä soluissa on kudosspesifinen. Rasvakudoksessa, luurankolihaksissa ja sydämessä insuliinin aktivoima kaskadi johtaa glukoosimetaboliaan,josa solut ottavat vastaan glukoosia.

Vasodilataatio ja erektion helppous

Vasodilataatio, eli verisuonten laajeneminen typpioksidin (NO) tuotannon kautta on insuliinisignaloinnin seuraus verisuonten endoteelissa ja sydämessä.

Typpioksidi ja vasodilataatio näyttelevät tärkeää roolia myös makuuhuoneissa vaikuttamalla erektioon.

Insuliiniresistenssi ennakoi aikuistyypin diabetesta, joka tunnetusti aiheuttaa erektiohäiriöitä, mutta insuliiniresistenssi on myös täysin itsenäinen erektiohäiriöiden aiheuttaja jo ennen diabetekseen sairastumista.

Erektiohäiriöt lisääntyvät selvästi 40 ikävuoden jälkeen. Erektiohäiriöiden syy ei ole itsenäinen sairaus, vaan siihen vaikuttavat erityisesti:

  • verenkiertoelinten sairaudet ja niiden hoitoon käytetyt lääkkeet
  • insuliiniresistenssi
  • metabolinen oireyhtymä
  • diabetes
  • lihavuus
  • tupakointi
  • testosteronipitoisuuden lasku
  • kilpirauhasen ali- tai ylitoiminta
  • neurologiset sairaudet

PDE5-estäjät, kuten sildenafiili, tadalafiili, vardenafiili ja avanafiili parantavat erektiota lisäämällä solunsisäistä syksista guanosiinimonofosfaattia, jolloin peniksen paisuvaiskudoksen, virtsarakon, eturauhasen ja virtsaputken sileä lihas rentoutuu.

Lyhyestä virsi kaunis: Seksi on kivaa. Lihominen, insuliiniresistenssi, metabolinen oireyhtymä ja diabetes tekevät seksistä kuitenkin hankalaa tai mahdotonta. Näiden ongelmien esiintyminen on signaali, johon miehen tulee kiinnittää huomiota. Erektiovaikeus voi kertoa sydän- ja verisuonitaudeista, diabeteksesta tai jostakin muusta sairaudesta.

Tämä vaiettu ongelma on hyvin yleinen. Noin 200 000 suomalaismiestä kärsii vaikeasta tai keskivaikeasta erektiohäiriöstä. 300 000 suomalaismiehellä on lievä erektiohäiriö. Pieni elintapojen korjaus voi siis parantaa terveyttä monin tavoin.

Kerrataan: Insuliiniresistenssi ja hyperinsulinemia ovat sydän- ja verisuonitautien itsenäisiä riskitekijöitä. Fokusointi LDL-kolesterolin vähentämiseen on johtanut tilanteeseen, jossa ihmiset sairastuvat ja kuolevat kardiometabolisiin sairauksiin, jotka saataisiin lääkkeettömään remissioon verensokeria ja insuliinia laskevilla pienillä elintapojen korjauksilla.

Aineenvaihdunta

Maksassa insuliinin määrä vaikuttaa glukoneogeneesiin, joka hidastuu ja loppuu. Sen sijaan glukoosin varastoiminen glykogeeneihin glykogeneesissä lisääntyy insuliinin vaikutuksesta.

Insuliinin vaikutus ulottuu myös lipidi- ja proteiinimetaboliaan. Se stimuloi lipogeneesiä ja proteiinisynteesiä ja päinvastoin estää lipolyysiä ja proteiinin hajoamista.

Molekyylinebiologia: tekninen ja huonosti suomennettu osa!

Insuliini on peptidihormoni, joka koostuu 51 aminohaposta, jotka  jakautuvat kahden peptidiketjun, 21 ja 30 aminohappotähteen A- ja B-ketjuiksi.

Kysteiinitähteiden disulfidisidokset yhdistävät nämä kaksi ketjua. Preproinsuliini on insuliinin alkuperäinen esiasteproteiini. Se on yksiketjuinen polypeptidi, joka koostuu proinsuliinista ja signaalipeptidisekvenssistä. Sen siirtyessä endoplasmiseen retikulumiin preproinsuliini pilkkoutuu sen signaalipeptidistä vapauttaen proinsuliinia. Yksiketjuinen proinsuliini sisältää A- ja B-ketjut ja C-peptidin (tai C-domeenin), kuten kuvassa.

C-peptidi muodostuu haiman Langerhansin saarekkeiden β-soluissa syntetisoidusta proinsuliinista sen pilkkoutuessa insuliiniksi ja C-peptidiksi. Sitä erittyy vereen insuliinin kanssa ekvimolaarisina määrinä.

Kaksiemäksiset tähteet reunustavat C-domeenia kummassakin päässä. Jokaisen kaksiemäksisen jäännöksen kohdalla trypsiinin kaltainen entsyymi katkaisee proinsuliinin.

Tämä vapauttaa lopulta insuliinin ja C-peptidin. Insuliinia varastoidaan sinkki-insuliiniheksameereinä glukoosille herkissä eritysrakkuloissa, kunnes sitä tarvitaan metabolisesti.

Muuttumattoman proinsulinin määrä korreloi merkitsevästi insuliiniresistenssin kanssa. Adiponektiiniarvot ovat insuliiniresistenteillä hieman normaalia alhaisemmat, mutta resistiini ei näytä korreloivan insuliiniresistenssin kanssa. Kohonnut proinsuliini kuvastaa pitkälle edennyttä solujen vauriota ja on hyvin spesifinen insuliiniresistenssin indikaattori. – Terve.fi

Insuliinin merkitys glukoosimetaboliassa

Glukoosimetabolian homeostaasia ylläpidetään kahdella signalointikaskadilla. Ne ovat: insuliinin välittämä glukoosinotto (IMGU) ja glukoosistimuloitu insuliinin eritys (GSIS).

IMGU-kaskadi antaa insuliinin lisätä glukoosin imeytymistä luurankolihaksissa ja rasvakudoksessa sekä estää glukoosin muodostumista maksasoluissa.

Insuliinikaskadin alavirran signaloinnin aktivointi alkaa, kun solun ulkopuolinen insuliini on vuorovaikutuksessa insuliinireseptorin alfa-alayksikön kanssa. Tämä vuorovaikutus johtaa konformaatiomuutoksiin insuliinireseptorikompleksissa, mikä edelleen johtaa insuliinireseptorisubstraattien tyrosiinikinaasifosforylaatioon ja sen jälkeiseen fosfatidyyli-inositoli-3-kinaasin aktivoitumiseen.

Fosfatidyyli-inositoli on fosfolipidi, joka koostuu glyserolista, rasvahaposta ja inositolista. Fosfatidyyli-inositoli ja sen fosforyloidut johdokset ovat solujen toisiolähettejä, jotka osallistuvat solun toiminnan säätelyyn. Fosfatidyyli-inositoli-4,5-bisfosfaatin plasmamebraanipää toimii solutukirangan proteiinien sekä joidenkin eksosytoosissa tarvittavien proteiinien kiinnityskohtana. Lipidi osallistuu myös solun signaalinvälitykseen. Tällöin se vapautuu solun reagoidessa solun ulkoiseen signaaliin tiettyjen reseptorien välityksellä. Signaalinvälitys tapahtuu reaktiosarjassa, joka alkaa lipidin fosfaattipään poistamisella ja päättyy proteiinikinaasi C:n aktivaatioon. – Wikipedia

Nämä alavirran tapahtumat aktivoivat GLUT-4-kuljettusmolekyylin siirtymisen solun plasmakalvolle. Solunsisäisesti GLUT4:ää esiintyy rakkuloissa. Näiden GLUT4-rakkuloiden eksosytoitumisnopeus kasvaa insuliinin toiminnan vuoksi. Lisäämällä GLUT-4-kuljetttimien läsnäoloa plasmakalvossa, insuliini sallii glukoosin pääsyn luurankolihassoluihin, jossa se voi metaboloitua glykolyysissä pyruvaateiksi tai varastoitua glykogeeniksi.

Insuliinin rooli glykogeenimetaboliassa

Maksassa insuliini vaikuttaa glykogeenimetaboliaan stimuloimalla glykogeenisynteesiä. Proteiinifosfataasi I (PPI) on avainmolekyyli glykogeenimetabolian säätelyssä.

Defosforylaation kautta PPI hidastaa glykogenolyysinopeutta inaktivoimalla fosforylaasikinaasin ja fosforylaasi A:n. Sitä vastoin PPI kiihdyttää glykogeneesiä aktivoimalla glykogeenisyntaasi B:n. Insuliini lisää PPI-substraattikohtaista aktiivisuutta glykogeenipartikkeleille puolestaan stimuloimalla glykogeenin synteesiä maksan glukoosista.

Insuliini hallitsee suoraan erilaisia maksan metabolisia entsyymejä geenitranskriptiolla. Tämä vaikuttaa geenien ilmentymiseen aineenvaihduntareiteillä

Glukoneogeneesissä insuliini estää nopeutta rajoittavan fosfoenolipyruvaattikarboksylaasin, samoin kuin fruktoosi-1,6-bisfosfataasin ja glukoosi-6-fosfataasin geeniekspressiota.

Glykolyysissä glukokinaasin ja pyruvaattikinaasin geeniekspressio kasvaa. Lipogeneesissä ilmentyminen lisääntyy rasvahapposyntaasista, pyruvaattidehydrogenaasista ja asetyyli-CoA-karboksylaasista.

Insuliinin rooli lipidien aineenvaihdunnassa

Kuten aiemmin todettiin, insuliini lisää joidenkin lipogeenisten entsyymien ilmentymistä. Tämä johtuu rasvasoluihin eli adiposyytteihin lipidiksi varastoituneesta glukoosista. Rasvasolujen kasvu lisää adiposyyttien glukoosinottoa.

Insuliini säätelee tätä prosessia edelleen defosforyloimalla ja estämällä sen jälkeen hormoniherkän lipaasin (HSL) erittymistä, mikä johtaa lipolyysin estoon. Viime kädessä insuliini vähentää näin seerumin vapaiden rasvahappojen määrää.

Tällä on välitön vaikutus painonhallintaan. Insuliini estää rasvasoluihin varastoidun energian hyödyntämisen estämällä triglyseridejä vapaiksi rasvahapoiksi pilkkovan lipolyysin kannalta välttämättömän hormoniherkän lipaasin vaikutuksen.

Lipolyysi pilkkoo rasvasoluihin varastoituneita triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi. Vapaista rasvahapoista maksa tuottaa ketoaineita. Glyserolia käytetään glukoneogeneesissä, joka tuottaa glukoosia. Ajan mittaan solut oppivat tuottamaan vapaista rasvahapoista energiaa beetaoksidaatiossa. 

Insuliinin rooli proteiinien aineenvaihdunnassa

Insuliini säätelee osittain proteiinien vaihtuvuutta. Lyhytketjuisten aminohappojen, kuten alaniinin, arginiinin ja glutamiinin soluunotto lisääntyy insuliinin vaikutuksesta. Tämä stimuloi proteiinisynteesiä.

Protein turnover rate is regulated in part by insulin. Protein synthesis is stimulated by insulin’s increase in intracellular uptake of alanine, arginine, and glutamine (short chain amino acids), as well as gene expression of albumin and muscle myosin heavy chain alpha.

Regulation of protein breakdown is affected by insulin’s downregulation of hepatic and muscle cell enzymes responsible for protein degradation. The impacted enzymes include ATP-ubiquitin-dependent proteases, and ATP-independent lysosomal proteases and hydrolases.

Insuliinin rooli tulehduksessa ja vasodilataatiossa

Insuliini vaikuttaa verisuonten endoteelisoluissa ja makrofageissa anti-inflammatorisesti, eli tulehdusta ehkäisevästi. Endoteelisoluissa insuliini stimuloi endoteelin typpioksidisyntaasin (eNOS) ilmentymistä. eNOS toimii vapauttamalla typpioksidia (NO), mikä johtaa verisuonten laajenemiseen.

Insuliini vaimentaa endoteelisolujen tumatekijä-kappa-B:tä (NF-kB). Endoteelin NF-KB aktivoi adheesiomolekyylien, E-selektiinin ja ICAM-1:n ilmentymisen, joka vapauttaa liukoisia soluadheesiomolekyylejä verenkiertoon.

Tutkimukset ovat yhdistäneet solujen adheesiomolekyylien esiintymisen verisuonten endoteelissa valtimoiden ateroskleroottisten plakkien muodostumiseen ja sydäntauteihin.

Insuliini estää reaktiivisten happiradikaalien (ROS) muodostumisen. Makrofagissa insuliini estää NADPH-oksidaasin ilmentymistä tukahduttamalla yhtä sen avainkomponenteista, p47phoxia.

NADPH-oksidaasia tarvitaan synnyttämään happiradikaaleja, jotka aktivoivat NF-kB:n estäjää, eli kinaasibeeta-inhibiittoria (IKKB). IKKB fosforyloi IkB:n, mikä johtaa sen hajoamiseen. Tämä hajoaminen vapauttaa NF-kB:n, mikä mahdollistaa sen translokaation makrofagin ytimessä.

Solun tumassa ollessaan NF-kB stimuloi verenkiertoon vapautuvien tulehdusta edistävien proteiinien geenien transkriptiota:

  • indusoituva typpioksidisyntaasi (iNOS)
  • tuumorinekroositekijä-alfa (TNF-alfa)
  • interleukiini-6 (IL -6)
  • interleukiini-8 (IL-8)
  • monosyyttien kemoattraktantiproteiini (MCP-1)
  • matriisimetalloproteinaasi (MMP)

Lääketieteellinen merkitys

Monet metaboliset sairaudet liittyvät krooniseen hyperglykemiaan, hyperinsulinemiaan ja insuliiniresistenssiin.

Tyypin 1 insuliinista riippuvainen diabetes mellitus (DM1) on tauti, jossa haiman insuliinin tuotanto on vähäistä tai kokonaan loppunut. Koska insuliinia tarvitaan solujen glukoosinottoon, diabeteksessa solujen kyky tuottaa glukoosista energiaa romahtaa. Tämän seurauksena hoitamaton tyypin 1 diabetes johtaa nälkiintymiseen ja kuolemaan.

Tyypin 2 insuliinista riippumaton diabetes mellitus (DM2) on metabolinen sairaus, jossa keho tuottaa yhä insuliinia, mutta jatkuvan hyperglykemian (korkean verensokerin) vuoksi solujen glukoosinotto vuosien mittaan heikentyy. Tämä tarjonnan ja kysynnän epäsuhta johtaa insuliiniresistenssiin ja epänormaaliin glukoosimetaboliaan.

Molemmat diabetekset ovat sokeriaineenvaihdunnan häiriöitä. Ruokailun jälkeen verensokeri pysyy koholla, koska haima ei tuota insuliinia (DM1) tai solujen insuliiniherkkyys on vaurioitunut (DM2). Kohollaan oleva verensokeri ja korkeat veren insuliinipitoisuudet vahingoittavat verisuonia ja elimiä. Tyypin 2 diabetes lisää erektiovaikeuksia, lihomista ja komplikaatioita, joihin kuuluvat mm. neuropatia, munuaisten vajaatoiminta, retinopatia, sydän- ja verisuonitaudit sekä perifeeriset verisuonisairaudet.

Tyypin 2 diabeteksen alkuvaiheessa haiman beetasolut tuottavat riittävästi insuliinia energia-aineenvaihdunnan ylläpitämiseksi, mutta insuliinin tuotanto muuttuu tehottomaksi, kun osa insuliinin välittämästä glukoosinottokaskadista ei enää toimi.

Erityisesti glukoosin kulkeutuminen plasmamembraanin läpi GLUT-4-kuljettimien kautta heikentyy, mikä kertoo solujen insuliiniresistenssista. Insuliiniresistenssi vaikuttaa ensin lihassoluihin. Rasvasolujen insuliinisensitiivisyys pysyy yleensä hyvänä varsin pitkään, minkä vuoksi glukoosia päätyy rasvasoluihin lihasten sijaan.

Pahoittelen, jos tekstiin jäi käännös- ja/tai asiavirheitä.


https://www.ncbi.nlm.nih.gov/books/NBK525983/




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Salaperäiset sirtuiinit

Salaperäiset sirtuiinit tehostavat solujen aineenvaihduntaa, hidastavat ikääntymistä, säätelevät geenien aktiivisuutta ja suojaavat aivoja. Mutta mitä sirtuiinit ovat ja miten ne vaikuttavat aineenvaihduntaan?

”Jo 1930-luvulta asti on tiedetty, että energiarajoitus pidentää jyrsijöiden elinikää. Nimenomaan energiamäärä (noin 60-70 % normaalista) eikä energian lähde näyttää tässä suhteessa olevan ratkaiseva tekijä. Energiamäärän vähentäminen saa aikaan kehon lämpötilan laskun sekä glukoosi- ja insuliinipitoisuuden, painon ja rasvamäärän vähenemisen (Guarente ja Picard 2005). Vähäinen energiansaanti tekee eläimet resistentiksi ulkoisille stressitekijöille, kuten oksidatiiviselle stressille. Tämä on tärkeä sopeutumismekanismi, sillä ikääntymisen uskotaan liittyvän ROS:n (reactive oxygen species) muodostukseen.”- Professori Markku Laakso / Duodecim


Johdanto

Nyt syntyviä sukupolvia odottavat ilmastonmuutoksen, hallitsemattoman väestönkasvun ja taloudellisesti yhä selvemmin jakaantuneen maailman asettamat haasteet.

Toisaalta lääketieteellinen kehitys ja ymmärrys geenien toiminnasta lupaa tuleville sukupolville pitkää ja tervettä elämää. Eräs mullistavimmista lääketieteellisistä keksinnöistä viime vuosina on ollut CRISPR-Cas-9 geenisakset, joilla DNA:sta voidaan leikata viallisia jaksoja ja korvata ne terveillä jaksoilla. Samaan aikaan ymmärrys ikääntymisestä ja siihen vaikuttavista aineenvaihduntamekanismeista on täsmentynyt.

Salaperäiset sirtuiinit ohjaavat ja tehostavat solujen rasva-aineenvaihduntaa silloin kun glukoosin saanti on vähäistä. Niukka energiansaanti käynnistää aineenvaihdunnan luonnollisen sopeutumismekanismin, johon osallistuu SIRT1-geeni. Sirtuiinit ovat NAD+ -riippuvaisia solujen apoptoosia, tulehdusvastetta, solujen elämänkaarta, geenitranskriptiota ja aineenvaihduntaa sääteleviä proteiiniasetylaaseja.



NAD+ eli nikotiiniamidiadeniinidinukleotidi ja proteiiniasetylaasit

Molekyylibiologiaan harjaannuttamattoman silmissä nämä sanat ovat silkkaa hepreaa. Mitä ne tarkoittavat ja mitä helvettiä ne meille tekevät? Vaikeilla sanoilla on miltei maagisia tarkoituksia. Mitä koentsyymit, kofaktorit ja entsyymit ovat?

NAD+ on kaikissa elävissä soluissa esiintyvä koentsyymi. Koentsyymit (tai kofaktorit) ovat orgaanisia molekyylejä tai epäorgaanisia metalli-ioneja, joka entsyymin on sidottava itseensä toimiakseen kemiallisia reaktioita katalysoivana entsyyminä.

Monet koentsyymeistä ovat vitamiineja, osa metalleja, kuten kofaktori-ionit Mn2+, Mg2+ ja Zn2+. Entsyymi, johon ei ole sitoutunut sen luontaista kofaktoria tai kofaktoreita on toimimaton apoentsyymi. Koentsyymi muodostaa entsyymin proteiiniosan eli apoentsyymin kanssa toimivan entsyymin.

Epäorgaanisia kofaktoreita ovat mm. ravinnosta saatavat metalli-ionit Cu2+, Fe2+ tai Fe3+, K+, Mg2+. Arvaatte varmaan, että näitä on paljon enemmän, mutta eiköhän pointti selvinnyt.

Nämä epäorgaaniset kofaktorit muodostavat apoentsyymien kanssa entsyymejä, kuten: sytokromi-c-oksidaasin, katalaasin, peroksidaasin, pyryvaattikinaasin, heksokinaasin ja glukoosi-6-fosfataasin.

Monet orgaanisista koentsyymeistä ovat vitamiineja tai niiden johdannaisia, kuten biosytiini, koentsyymi A, 5’-deoksiadenosyylikobolamiini, flaviiniadeniinidinukleotidi, lipoaatti, NADH/NAD+, pyriokdaalifosfaatti jne. Näiden koentsyymien esiasteet ovat vitamiineja, kuten biotiini (B7), pantoteenihappo(B5), B12, riboflaviini (B2), niasiini (B3), B6, folaatti (B9) ja tiamiini (B1).

Entsyymit ovat kemiallisia aineenvaihduntareaktioita nopeuttavia biologisia katalyytteja. Ne ovat yleensä proteiineja, mutta myös RNA-molekyylit eli ribotsyymit voivat olla entsyymejä. Entsyymien vaikutus perustuu niiden kykyyn alentaa substraattiin kohdistuvan reaktion aktivaatioenergiaa. Ilman entsyymejä kemialliset reaktiot tapahtuisivat soluissa liian hitaasti, eikä elämä olisi mahdollista. Nopeimmat entsyymit muuttavat jopa 40 miljoonaa molekyyliä reaktiotuotteiksi sekunnissa.


NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa biologisissa hapetus-pelkistysreaktioissa.

Nikotiiniamidiadeniinidinukeotidi muistuttaa kemialliselta rakenteeltaan toista tärkeää koentsyymiä, nikotiiniamidiadeniinidinukleodifosfaattia (NADP+). NAD+ osallistuu katabolisiin aineenvaihduntareaktioihin ja NADP+ on tärkeä koentsyymi anabolisissa reaktioissa.

Kataboliset aineenvaihduntareaktiot pilkkovat monimutkaisia molekyylejä yksinkertaisemmiksi ja anaboliset aineenvaihduntareaktiot rakentavat yksinkertaisemmista molekyyleistä suurempia ja monimutkaisempia molekyylirakenteita.

Eliöt tuottavat NAD+:a kahdella tavalla:

1. Geenien säätelemässä de novo-synteesissä tryptofaanista (aminohappo) syntetisoidaan ensin kinoliinihappoa, joka muutetaan nikotiinihappomononukleotidiksi ja edelleen nikotinaattinukleotidiadenyylitransferaasientsyymin avulla desamino- NAD+:ksi.
NAD+ syntaasientsyymi muuttaa desamino- NAD+:n nikotiiniamidiadeniinidinukleotidiksi.

2. NAD+-biosynteesiä tapahtuu myös nikotiiniamidista, joka prosessoidaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

Proteiiniasetylaasit ovat asetyyliryhmään kiinnittyviä proteiineja. Deasetylaasit poistavat osia asetyyliryhmästä. Nisäkkäillä tunnetaan seitsemän erilaista ja erilaisiin reaktioihin osallistuvaa sirtuiinia. Esimerkiksi SIRT1-3 ja SIRT5 ovat deasetylaaseja. Solun tumassa on SIRT1:tä, SIRT6:ta ja SIRT7:ää. Mitokondrioissa on puolestaan SIRT3-5:tä ja solulimassa SIRT2:ta.

Mitä ne sirtuiinit siellä soluissa tekevät?

SIRT1 säätelee aineenvaihduntaa ja solujen elinkaarta
SIRT2 ja SIRT6 saattavat vaikuttaa kasvaimien kehittymiseen ja syöpään
SIRT3 ja SIRT4 osallistuvan aineenvaihdunnan säätelyyn
SIRT4 liittyy aminohappovälitteiseen insuliinin eritykseen

SIRT1 vaikuttaa erityisesti energia-aineenvaihdunnan kannalta keskeisissä kudoksissa, kuten haimassa, maksassa ja rasvakudoksessa. SIRT1:n aktivoituminen lisää insuliiniherkkyyttä ja laskee glukoosi- ja insuliinipitoisuuksia.

Koska SIRT1 on PPAR*-estäjä (*peroxisome proliferator-activated receptor), se kiihdyttää rasvakudoksen lipolyysiä vapauttamalla rasvakudoksiin varastoituja rasvahappoja verenkiertoon.


Lipolyysi vs. lipogeneesi

Lipolyysi pilkkoo rasvasoluihin varastoituja triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu verenkierron mukana maksaan, ja rasvahapot energialähteiksi luurankolihaksille, maksalle ja sydämelle.

Lipolyysi aktivoituu paaston ja vähän hiilihydraatteja sisältävän ruokavalion yhteydessä hormonaalisesti lipolyyttisten hormonien: glukagonin, kortikotropiinin, adrenaliinin ja noradrenaliinin vaikutuksesta.

Lipolyysin tarkoitus on säästää glukoosia punasoluille ja hermosoluille, jotka eivät pysty käyttämään rasvahappoja energiantuotannossa. Lipolyysille vastakkainen aineenvaihduntareaktio on lipogeneesi, joka prosessoi ja varastoi ylimääräisiä sokereita rasvahapoiksi.

Insuliini osallistuu ravinnon soluun pääsyyn sekä ravinteiden varastoimiseen lihas-, maksa- ja rasvasoluihin. Glukagoni ja muut lipolyyttiset hormonit purkavat solujen sokeri- ja rasvavarastoja verenkiertoon, jolloin niitä voidaan käyttää solujen energiantuotannossa.

Lipolyysiä ohjaa lipaasi. Kun haima erittää vereen insuliinia, lipolyysi estyy. Rasvakudos on herkkä insuliinin säätelylle. Kun veren insuliinipitoisuus laskee, lipolyyttiset hormonit ohjaavat lipaasin toimintaa. Tämä käynnistää lipolyysin ja rasvahappoja vapautuu rasvasoluista vereen.

Veren mukana soluihin kulkeutuneista rasvahapoista tuotetaan beetaoksidaatiossa asetyylikoentsyymi-A:ta, joka on kaikille energiaravinteille yhteinen väliaine sitruunahappokierrossa. Asetyylikoentsyymi-A voi jatkaa solujen energiantuotantoa mitokondrioissa tapahtuvassa sitruunahappokierrossa, jos glukoneogeneesi ei ole käynnissä.

Kun SIRT1 aktivoituu, insuliinin eritys haimasta lisääntyy. SIRT1myös suojaa haiman beetasoluja oksidatiiviselta stressiltä.

PCG-1:n*-aktivoituminen (*peroxisome proliferator-activated receptor gamma coactivator-1) lisää glukoosin syntetisoimista maksassa osana SIRT1-aktivaatiota. PCG-1 kasvattaa mitokondrioiden määrää ja kokoa sekä kiihdyttää rasvahappojen hapettumista beetaoksidaatiossa. Nämä tekijät yhdessä vaikuttavat suotuisasti glukoosin aineenvaihduntaan.

SIRT1 suojaa keskushermoston soluja neurodegeneratiivisilta prosesseilta. Punaviinin, mustikoiden, viinimarjojen ja karpaloiden sisältämä fenoliyhdiste resveratroli on SIRT1-aktivaattori, joka lisää PCG-1-aktivaatiota. Tämä on tutkimuksissa tehostanut mitokondrioiden toimintaa, energiankulutusta ja hapenottokykyä. Se voi lisätä myös solujen insuliiniherkkyyttä ja laskea rasvamaksaan sairastumisen riskiä.

Resveratroli on eläinkokeissa suojannut runsaasti energiaa ravinnosta saavia hiiriä lihomiselta estämällä PPAR:n* (*peroxisome proliferator-activated receptor) aktivaation. SIRT1 voi vaikuttaa suotuisasti aikuistyypin diabetekseen, sillä se lisää solujen insuliiniherkkyyttä ja haiman insuliinin eritystä, sekä laskee painoa ja kehoon varastoituneen rasvan määrää.

Yhteenveto

SIRT1 (Silent Information Regulator 1) osallistuu useisiin aineenvaihduntaprosesseihin ja energia-aineenvaihdunnan säätelyyn. SIRT1 vaikuttaa lihavuuteen ja aikuistyypin diabetekseen säätelemällä rasvojen aineenvaihduntaa ja mitokondrioiden biogeneesiä.

Sirtuiinien hermoja ja aivosoluja suojaava vaikutus perustuu toisaalta SIRT1:n oksidatiivista stressiä vähentävään vaikutukseen ja toisaalta SIRT1:n kykyyn vähentää tulehdusvastetta sitoutumalla NF-kB*:en (Nuclear Factor-kappaB) ja siten ehkäistä hermosoluissa tapahtuvaa neurodegeneraatiota ja atrofiaa.


NF-kB


Hiirikokeissa sekä akuutit, että pitemmän ajan kuluessa syntyvät hermosoluvauriot johtavat lähes aina aivojen mikrogliasolujen aktivaatioon. M1-tyypin mikrogliat erittävät tulehdusta edistäviä sytokiineja, jotka lisäävät osaltaan hermosolujen atrofiaa, kun taas M2-tyypin solut poistavat kuolleita soluja ja erittävät vaurioituneisiin hermoston osiin erilaisia kasvutekijöitä.

Keskeisenä tulehdusreaktioiden välittäjänä toimii transkriptiotekijä, tumatekijä kappaB (NF-kB) ja erityisesti sen p50/105-alayksikkö. Hiirikokeissa havaittiin, että NF-kB p50/105-alayksiköllä on merkittävä rooli aivojen tulehdusreaktioiden välittäjänä ja sitä kautta aivojen uusien hermosolujen muodostumisessa. NF-kB p50/105-alayksikön puuttumisen vaikutus vaihtelee eri tautimalleissa ja eri ikäisillä hiirillä.  (Taisia Rõlova)

”Tulehdus on immuunijärjestelmän aikaansaama reaktio, jonka avulla elimistö pyrkii vastaamaan infektioon tai kudosvaurioon ja korjaamaan sen. Matala-asteinen krooninen tulehdus on häiriötila, joka voi ylläpitää tulehdusvasteita kudoksissa aineenvaihdunnan muutosten kautta ja johtaa edelleen kudosvaurioihin sekä altistaa monille sairauksille, kuten astmalle, Alzheimerin taudille, sydän- ja verisuonitaudeille ja erilaisille syöville.”- Anu Wiklund

VIDEO


OSA 1: Energia-aineenvaihdunnan perusteet


Evoluution seurauksena ihmiselle on kehittynyt tehokkaita selviytymismekanismeja toisaalta adaptiivisen immuunijärjestelmän kautta erilaisia taudinaiheuttajia vastaan, ja toisaalta turvaamaan välttämättömät elintoiminnot silloinkin, kun ravintoa ei ole riittävästi saatavilla.

Terve nuori aikuinen selviää pelkällä vedellä kolmisenkymmentä vuorokautta. Aineenvaihdunta käyttää energianlähteenä ensimmäiseksi elimistön sokeri- ja rasvavarastot, mutta ravinnonpuutteen jatkuessa myös lihasten proteiineja käytetään energian lähteenä välttämättömien elintoimintojen turvaamiseksi.

Nykyinen yltäkylläisyys ja ravinnon helppo saatavuus on uusi ilmiö. Meille ruoka ja sen vaivaton saatavuus on itsestäänselvyys, mutta kaukaiset esivanhempamme joutuivat elämään pitkiäkin aikoja hyvin niukalla ravinnolla tai kokonaan ilman ruokaa.

Varhaiset ihmiset söivät silloin, kun ravintoa oli tarjolla ja paastosivat, kun ruokaa ei ollut. Ravinnosta saatu ylimääräinen energia varastoitiin rasva- ja lihassoluihin. Lihominen auttoi ihmisiä selviämään niukoista ajoista.

Toisaalta ravinnon saatavuuden epävarmuus on ilmeisesti vaikuttanut erilaisten biologisten selviytymismekanismien kehittymisen lisäksi eräänlaisen psykologisen selviytymismoodin syntymiseen. Nälkäinen ihminen valpastuu, aistit tarkentuvat, keskittymiskyky paranee, ympäristön hahmottaminen tehostuu, päätöksenteko nopeutuu jne. Tälle on biokemialliset ja hormonaaliset syyt. Väitän, että hieman nälkäinen ihminen on älyllisesti ja fyysisesti parhaimmillaan. Se on asia, josta toki voi kiistellä.

Sokeria vai rasvaa? Kuinka solut saavat energiaa?

Kaikki solut voivat käyttää glukoosia energianlähteenä. Solujen sytoplasmassa tapahtuva glykolyysi pilkkoo glukoosimolekyylin kahdeksi pyruvaatiksi, mikä tuottaa kaksi runsasenergistä ATP-molekyyliä. Kummastakin pyruvaatista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Aminohapot, hiilihydraatit ja rasvahapot on muutettava asetyyliryhmiksi ja liitettävä koentsyymi-A:han, jotta ne pääsevät mitokondriossa tapahtuvaan sitruunahappokiertoon. Sitruunahappokierrossa pyruvaateista saadaan vielä kolmisenkymmentä ATP-molekyyliä. Tämän soluhengityksen lopputuotteena on vettä ja hiilidioksidia.

Myös rasvaa (ja proteiineja) voidaan käyttää energian tuottamiseen. Aineenvaihdunta osaa käyttää esimerkiksi eräitä proteiineista saatavia ja vapaita aminohappoja glukoosia tuottavassa glukoneogeneesissä.

Rasvojen energia-aineenvaihdunnan perusta on beetaoksidaatio, ketoosi ja ketogeneesi. Solujen kannalta hiilihydraateista saatava glukoosi on kaikkein helpoin ja nopein energianlähde. Siihen aineenvaihduntamme on totutettu lapsesta alkaen. Rasvan ja proteiinien muuttaminen energiaksi kelpaavaan muotoon edellyttää useita aineenvaihduntareaktioita.

Lähtökohtaisesti keho suosii siis hiilihydraatteja energianlähteenä. Hiilihydraatit pilkotaan sokereiksi, jotka imeytyvät ohutsuolen epiteelin läpi verenkiertoon. Glukoosi kohottaa verensokeria ja haima reagoi glukoosipitoisuuden kasvuun erittämällä vereen insuliinia. Insuliinimolekyyli kiinnittyy solun pinnassa olevaan insuliinireseptoriin ja toimii kuin avain, joka avaa solun glukoosimolekyyleille.

Fruktoosi prosessoidaan maksassa ensisijaisesti glykogeeneiksi eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi. Nämä ovat nopeita varastosokereita. Osa fruktoosista muutetaan glukoosiksi, joka vapautuu verenkiertoon ja 1-2 % fruktoosista muutetaan triglyserideiksi.

Myös veressä oleva ylimääräinen glukoosi muutetaan mahdollisuuksien mukaan lihasten glykogeeneiksi. Glykogeenivarastojen rajallisen koon vuoksi osa glukoosista varastoidaan rasvasoluihin ja muutetaan rasvasolussa tapahtuvassa lipogeneesissä triglyserideiksi.

Veren glukoosipitoisuuden laskiessa haiman alfasolut erittävät vereen glukagonia, joka vapauttaa maksan glykogeenivarastoista glukoosia vereen ja lihasten glykogeeneistä glukoosia lihasten käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.



Entä sitten kun sokerivarastot loppuvat?


Maksan ja lihasten sokerivarastot voivat loppua paastotessa, hyvin niukkaenergisellä ruokavaliolla tai hiilihydraattien saantia rajoitettaessa. Tällöin elimistön on turvauduttava varastoimaansa energiaan eli läskiin.

Veren glukoosipitoisuuden laskun seurauksena vereen erittyy lipolyyttisiä hormoneja: glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia. Näiden vaikutuksesta elimistön rasva-aineenvaihdunta tehostuu.

Ketoaineiden tuotanto

Lipolyysi purkaa rasvasolujen triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu maksaan, jossa sitä voidaan hyödyntää mm. glukoosia syntetisoivassa glukoneogeneesissä.

Soluihin kulkeutuvat vapaat rasvahapot pilkotaan beetaoksidaatiossa asetyylikoentsyymi-A:ksi. Glukoneogeneesin yhteydessä asetyylikoentsyymi-A:ta ei voida hapettaa normaalisti mitokondrioissa, vaan ylimääräisestä asetyylikoentsyymi-A:sta muodostetaan 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-syntaasin katalysoimana 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A:ta (HMG-KoA) ja edelleen mitokondrioissa 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-lyaasin (HMG-KoA-lyaasi) katalysoimassa reaktiossa ketoaineita: asetoasetaattia ja siitä edelleen betahydroksibutyraattia ja asetonia.

Asetyylikoentsyymi-A on kaikille ravintoaineille yhteinen väliaine solun valmistaessa energiaa. Sen asetyyliryhmän hiilet hapettuvat hiilidioksidiksi sitruunahappokierrossa (Krebsin sykli) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio

Oksidatiivinen fosforylaatio on elektroninsiirtoketjusta ja ATP-syntaasista koostuva aineenvaihduntareitti. Happea käyttävien solujen ATP-energiasta noin 90 % syntyy oksidatiivisessa fosforylaatiossa eli kun ravintoaineet hapettuvat ja energia sitoutuu suurienergisiin fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio, glykolyysi ja sitruunahappokierto päättävät solun katabolisen energiantuotannon. Glykolyysissä, rasvahappojen oksidaatiossa ja trikarboksyylihappokierrossa muodostuneiden pelkistyneiden koentsyymien (NADH ja FADH2) elektronit siirtyvät oksidatiivisen fosforylaation elektroninsiirtoketjuun. Nämä elektronit pelkistävät happimolekyylit vedeksi, jolloin vapautuva energia sitoutuu ATP:nä.

Yhdestä glukoosimolekyylistä saadaan noin 30 suurienergistä ATP-molekyyliä.

Katabolisessa aineenvaihdunnassa pienimolekyyliset yhdisteet (aminohapot, monosakkaridit, rasvahapot) pilkotaan ja ”poltetaan” solujen energiaksi. Kaikkien energiaravinteiden yhteinen väliaine on asetyylikoentsyymi-A.

Asetyylikoentsyymi-A voidaan pilkkoa sitruunahappokierrossa, jossa sen hiiliatomit hapettuvat hiilidioksidiksi ja vetyatomit siirtyvät hapetus-pelkistysreaktioissa keoentsyymeille (NADH ja FADH2) Nämä siirtävät vetyä sitruunahappokierron ja elektroninsiirtoketjun välillä. Koentsyymit menettävät elektronit ja hapettuvat NAD+:ksi ja FAD:ksi, jotka jatkavat kiertoa.

Osa 2: Ketoosi ja sirtuiinit

Ketoosi kiihdyttää sirtuiinien aktivaatiota soluissa. Sirtuiinit kuuluvat histonideasetylaaseihin (HDAC). Ne ovat proteiineja, jotka poistavat asetyyliryhmän geenin histonista ja näin ”sammuttavat” geenin ilmentymisen eli ekspression.

Jokainen solu sisältää yksilön jokaisen geenin, mutta geeni ilmentyy vain tietyissä soluissa, ja joskus vain tiettyyn aikaan. Sammutettua geeniä ei lueta proteiinin valmistuksessa.

Ketoosi lisää sirtuiini1:en (SIRT1) määrää hippokampuksen eli aivoturson alueella ohimolohkojen sisäosissa korvien lähellä. Kummankin ohimolohkon hippokampus on yhteydessä toiseen ja hypotalamukseen aivokaaren välityksellä.

Nyt liikutaan kiistanalaisilla vesillä. Vuosittain arviolta 2,8 miljoonaa ihmistä kuolee lihavuuden aiheuttamiin komplikaatioihin. Tutkimuksissa on havaittu, että väestöjen keskimääräinen älykkyys laskee. Voisiko olla niin, että runsasenerginen ravinto ei tuhoa vain terveyttämme, vaan myös kognitiiviset kykymme? Voisimmeko elää nälässä terveempinä ja älykkäämpinä. Siinä on provokatiivinen keskustelunaihe kahvipöytään.


Hippokampus ja deklaratiivinen muisti



Hippokampus osallistuu muistitoimintoihin. Erityisen tärkeä hippokampus on deklaratiivisen muistin eli säilömuistin toiminnassa. Deklaratiivinen muisti jakautuu semanttiseen ja episodiseen muistiin. Semanttiseen muistiin tallentuvat asiat, joiden merkitys ymmärretään. Episodimuistiin tallentuu välähdyksenomaisia muistoja tapahtumista. SIRT1-puutos aiheuttaa kognition, muistin ja suunnitelmallisuuden häiriötilan.

”Li-Huei Tsai’s group found that Sirt1 regulates memory by forming a complex that downregulates microRNA miR-134.  This microRNA targets mRNA transcripts for the key learning and memory genes CREB and BDNF, so by keeping miR-134 low, Sirt1 promotes memory formation by keeping CREB and BDNF levels high.”

2016 tehdyssä tutkimuksessa (Heyward et al.) havaittiin, että jatkuvasti liikaravittujen hiirien muistitoiminnot heikkenivät ja hippokampuksen sirt1-pitoisuudet laskivat. Muistia ja oppimista säätelevien geenien ekspression heikkeneminen assosioitui DNA:n lisääntyneeseen metylaatioon.

Tutkijat raportoivat myös SIRT1-geeniin liittyvän DNA:n hydroksimetylaation vähenemisestä. Runsaasti energiaa sisältävän ravinnon aiheuttama DNA:n metylaatio hiirillä alleviivaa ympäristövälitteisten epigeneettisten muutosten vaikutuksia geenin ilmentymiseen.

Hydroksimetylaation merkitys aivojen toiminnalle on yhä arvailujen varassa, mutta tutkijat uskovat, että hydroksimetyloitunut DNA estää eräiden repressiivisten kompleksien sitoutumisen DNA:han.

Kolmas ruokavalioon liittyvä havaittu epigeneettinen mekanismi on, että yksi kolmesta ketoainetyypistä, betahydroksibutyraatti on itsessään endogeeninen HDAC-estäjä. Vaikka sirtuiinit estävät muistin repressoreita (torjujat?), toiset HDAC-luokan histonideasetylaasit voivat estää muistia parantavien geenien toimintaa. Tällaisten histonideasetylaasien estäjät parantavat muistin toimintaa ja niillä on suuri terapeuttinen potentiaali.

Moses Chaon tutkijaryhmä havaitsi, että betahydroksibutyraatti lisää hippokampuksen BDNF-expressiota estämällä HDAC2:ta ja HDAC3-5:tä. Käänsin edellisen kappaleen niin sekavasti, että täsmennetään: betahydroksibutyraatti parantaa muistiin vaikuttavien geenien ilmentymistä estämällä eräitä histonideasetylaaseja.

Eläinkokeiden perusteella ravinnosta saadun energian rajoittaminen ja ketogeeninen ruokavalio suojaavat aivojen soluja, tehostavat muistia ja parantavat kognitiivisia toimintoja. Vastaavasti runsasenerginen ja hiilihydraattipainotteinen ravinto ylläpitää oksidatiivista stressiä ja kasvattaa neurodegeneratiivisten muutosten riskiä.  Eräässä lievistä muistivaikeuksista kärsivillä vanhuksilla toteutetussa tutkimuksessa kuuden viikon vähähiilihydraattinen ruokavalio paransi koehenkilöiden verbaalista muistia. Toisessa kokeessa terveille nuorille aikuisille annettiin annos glukoosia. Kognitiivisia kykyjä mitattiin ennen glukoosia ja sen jälkeen. Tässä tutkimuksessa nuorten kognitiiviset kyvyt heikkenivät 20 minuuttia glukoosiannoksen jälkeen.

Ketogeeninen ruokavalio säätelee NAD+-riippuvaisia entsyymejä ja vähentää DNA:n vaurioita hippokampuksen alueella

Ketogeenisen ruokavalion (KD) epileptisia kohtauksia vähentävät vaikutukset on hyvin dokumentoitu. Ketogeeninen ruokavalio on joillain lapsilla ainoa tehokas keino vähentää epilepsiaan liittyviä kohtauksia.

Hiljattain on havaittu ketogeenisen ruokavalion terapeuttinen potentiaali useiden neurodegeneratiivisten sairauksien hoidossa. Kokeellinen todistusaineisto ketoruokavalion hyödyistä on kuitenkin edelleen puutteellista.

Rotilla tehdyssä tutkimuksessa on osoitettu, että ketogeenistä ravintoa saavien rottien hippokampuksen alueen solujen nikotiiniamidiadeniinidinukleotidi+ (NAD+) -tasot kasvavat.

NAD+ on soluaineenvaihdunnan toiminnalle välttämätön koentsyymi, signalointimolekyyli, soluterveyden markkeri sekä pitkäikäisyyteen ja DNA:n vaurioiden korjaamiseen osallistuvien entsyymien, kuten sirtuiinien ja poly-ADP riboosi polymeraasi-1:n (PARP-1) substraatti.

NAD+-riippuvaisten entsyymien aktivaatio voi selittää laajemminkin ketogeenisen ruokavalion hyödyllisiä vaikutuksia. En mene tarkemmin tuon rottakokeen arviointiin, mutta sen tulokset olivat hyvin rohkaisevia aivojen terveyden osalta.

Miten ketogeeninen ruokavalio suojaisi aivoja?

Ketogeeninen (KD) eli LCHF-ruokavalio sisältää hyvin niukasti hiilihydraatteja, runsaasti rasvoja ja kohtuullisesti proteiineja. Hiilihydraattien määrä rajoitetaan noin 10 prosenttiin päivittäisestä energiansaannista. Suurin osa päivittäisestä energiasta saadaan rasvasta, jonka määrä voi olla 60-70 % päivittäisestä energiansaannista. Proteiinien saanti pidetään 20-30 prosentin tasolla päivittäisestä energiansaannista.

KD ohjaa energia-aineenvaihdunnan helpoista ja nopeista hiilihydraateista (glukoosista) enemmän energiaa kuluttavaan rasva-aineenvaihduntaan, jossa vapaista rasvahapoista valmistettuja ketoaineita käytetään solujen ATP:n lähteenä.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio on ainoa tehokas hoitomuoto lasten lääkeresistentin epilepsian epileptisten kohtausten hillitsemiseen. (Neal et al., 2009; Sharma et al., 2013; Cervenka et al., 2017)

Jatkuvasti kasvava tutkimusnäyttö osoittaa, että ketogeenisella ruokavaliolla on suotuisia vaikutuksia terveyteen (Yang and Cheng, 2010; Winter et al., 2017; Augustin et al., 2018) sekä pitkäikäisyyteen (Newman et al., 2017; Roberts et al., 2017).

Tuoreissa tutkimuspapereissa ketogeenisen ruokavalion terveysvaikutukset assosioituvat vahvasti NAD -koentsyymiin (Elamin et al., 2017), joka on välttämätön ATP:n prosessoinnille ja hapetus-pelkistys-reaktiolle. Ketoaine-perusteisessa aivosolujen energia-aineenvaihdunnassa pelkistyy vähemmän NAD-molekyylejä, kuin glukoosiin perustuvassa energia-aineenvaihdunnassa. Tämän seurauksena aivosoluihin jää korkeampia pitoisuuksia hapettuneita NAD+ -molekyylejä.

Ketogeeninen ruokavalio voi havaintojen perusteella indusoida nopeita ja pysyviä muutoksia NAD+ / NADH -suhteissa aivojen runsaasti energiaa kuluttavalla hippokampuksen alueella. Tämä aivojen osa tunnetaan leikkimielisellä nimellä – kohtausportti (seizure gate). Vastaavia havaintoja on tehty ikääntyneillä hiirillä. Sen sijaan ketoaineisiin nojaavan energia-aineenvaihdunnan ei havaittu vaikuttavan aivokuoren alueella.

Korkeammat NAD+ -tasot rajoittavat epileptisia kohtauksia ja kasvattavat koe-eläinten elinajan odotetta (Lin and Guarente, 2003; Mills et al., 2016; Liu et al., 2017). Kokeellisesti kohotetut NAD+ -arvot tehostavat mitokondrioiden toimintaa, suojaavat oksidatiivisen stressin aiheuttamilta vaurioilta ja vähentävät solujen kuolemaa (Kussmaul and Hirst, 2006). Nämä vaikutukset palautuvat alemman tason aineenvaihduntareitteihin.

NAD+ on kahden entsyymiryhmän, sirtuiinien ja poly-(ADP-riboosi) polymeraasien eli PARP:ien substraatti. Nämä entsyymiryhmät vaikuttavat solujen toimintaan geenien ilmentymisestä DNA:n vaurioiden korjaamiseen (Belenky et al., 2007).

NAD+-riippuvaiset sirtuiini-entsyymit ovat tärkeitä aineenvaihdunnan, tulehdusvasteiden ja DNA:n vaurioiden korjaamisen säätelijöinä. Sirt1 osallistuu transkriptiotekijöiden, kasvutekijöiden, anti-apoptisten (ohjattua solukuolemaa estävien) ja anti-inflammatoristen proteiinien deasetylaatioon, eli asetyyliryhmien purkuun.

Sirt1 on välttämätön kognitiivisten toimintojen, muistin ja neuroplastisuuden normaalille toiminnalle (Michan et al., 2010) ja sillä on havaittu epileptisia kohtauksia ehkäiseviä vaikutuksia. Ravinnosta saatavan energian (kaloreiden) rajoittaminen ja ketogeeninen ruokavalio assosioituvat solujen parempaan terveyteen ja ainakin eläinkokeissa odotettavissa olevan elinajan pidentymiseen. Sirt6 ja Sirt7 osallistuvat suoraan DNA:n emäsjaksojen korjaamiseen, mikä vähentää ikääntymisen aiheuttamia DNA-vaurioita.

Lopuksi

On kiinnostavaa seurata sirtuiinien ja ketogeenisen ruokavalion tutkimuksia. Väitteet karppauksen, rasvojen ja ketogeenisen ruokavalion haitallisuudesta ovat vähintäänkin liioiteltuja ja todennäköisesti jopa haitallisia. Tutkimusaineisto sirtuiinien molekyylibiologisesta roolista ja ketogeenisen ruokavalion terveysvaikutuksista karttuu vauhdilla. Minä palaan tähän aiheeseen Ruokasodassa varmasti vieläkin täsmällisempien tutkimusten kautta. Omalla kohdallani olen havainnut, että vähäisempi ravinnonsaanti kasvattaa motivaatiota, muistia ja aktiivisuutta. Nämä tutkimukset näyttävät vahvistavan omia huomioitani.

PS. Iloista ja rauhallista joulua!

Lähteinä olen käyttänyt erikseen ilmoitettujen lähteiden lisäksi mm. Duodecimia ja Wikipdiaa yleisimpien aineenvaihduntareaktioiden osalta. Kuvien lähde: Pixabay

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2928875/

https://www.jneurosci.org/content/36/4/1324.long

https://elifesciences.org/articles/15092

https://www.frontiersin.org/articles/10.3389/fncel.2018.00263/full

https://www.duodecimlehti.fi/lehti/2007/19/duo96781