1

Mikä **tun kolesteroli?

Kehotan tarkkaavaisuuteen ja avoimeen mieleen, koska tämä voi järkyttää herkempiä lukijoita. LDL ei ole kolesterolia! Paha kolesteroli on sellainen kummitusjuttu?

Pahamainen LDL on lipoproteiini (Low Density Lipoprotein), eli kuljetusmolekyyli, jota elimistö tarvitsee triglyseridien, kolesterolin ja rasvaliukoisten vitamiinien kuljettamiseen verenkierrossa.

LDL on kuin pizzataksi, joka kuljettaa ravintoa nälkäisille soluille.

Elimistö saa kolesterolia ravinnosta ja syntetisoi sitä itse soluissa tapahtuvasssa kolesterolisynteesissä. Kolesterolisynteesin lopputuotteita ovat mm. ruoansulatusneste, steroidihormonit, kuten testosteroni ja estrogeeni sekä kalsiumin homeostaasia ja immuunijärjestelmää säätelevä D-vitamiini. Elimistö tarvitsee välttämättä kaikkia näitä.

Koska kolesteroli on elämälle välttämätön steroli, elimistö pyrkii pitämään kolesterolin määrän tasaisena. Ravinnosta saatu kolesteroli vähentää soluissa tapahtuvaa kolesterolisynteesiä.

Ei liene sattumaa, että samalla kun miesten kolesteroli laskee, yhä useampi mies huomaa kärsivänsä testosteronin vajauksesta. Mieskunto laskee samaa tahtia kolesterolin kanssa. Voiko se olla sattumaa? Ehkä, mutta epäilen vahvasti?

Nykyisen lääketieteellisen paradigman karikatyyri on seuraava: laske kolesterolia statiineilla, nosta testoja lääkkeillä, sairastu metaboliseen oireyhtymään ja diabetekseen, korjaa korkea verensokeri metformiinilla tai insuliinilla, syö ohjeiden mukaan riittävästi sokeria ja vedä helvetisti verenpaine-, verensokeri- ja muita lääkkeitä. Syö lääkkeitä lääkkeiden aiheuttamiin sivuoireisiin, äläkä missään nimessä hairahdu ketogeeniseen ruokavalioon, koska siitä voit sairastua! Tuo voisi olla tinfoil-tuesdayn big pharma-hupailu, mutta surullista kyllä se on hyvin lähellä arkista totuutta.

Multippeliskleroottisesti suuntautuneena onnen kerjäläisenä pääsin osaksi institutionalisoitua medikalisaatiota. Etenevään multippeliskleroosiin ei tunneta oireita hidastavaa, tai parantavaa hoitoa, mutta minulla oli reseptillä parhaimmillaan kymmenkunta erilaista droppia ja nappia. Ja voi pojat, että rouskin uskollisesti erilaisia pillereitä ja palleroita, kunnes havahduin siihen, että jokainen syömäni lääke loi tarpeen uudelle lääkkeelle: lepovapinaa korjaavat lääkkeet edellyttivät vastapainoksi lihasrelaksantteja jne.

Oloni oli saamaton, tyhjämielinen, ahdistunut ja fyysisesti heikko. Älkää ymmärtäkö väärin: osa lääkkeistä on potilaille elintärkeitä ja välttämättömiä, mutta kaikki lääkkeet eivät ole kaikille välttämättömiä ja elintärkeitä. Siinä on merkittävä ero. Suunta on aivan väärä, jos meidät medikalisoidaan parhaassa iässä.

Syö, juo, liho, liiku, laihdu, mies, nainen!

Jokainen kolmekymppinen tarvitsee pian oman dosetin. Päivittäinen ääkecocktail on uskonnollinen rituaali, joka pitää kehon kasassa ja maailman radallaan. Mutta ei helvetti! Minun mielestäni ei ole tervettä tai normaalia, että jo kolme- ja nelikymppiset syövät päivittäin 5-10 reseptilääkettä statiineista masennuslääkkeisiin ja närästyslääkkeistä verenohennuslääkkeisiin. Jossain on nyt menty pahasti metsään. Ilmiö on globaali.

Suomessa on puoli miljoonaa diabeetikkoa ja saman verran verenpainelääkkeitä syöviä. Masennuslääkkeitä määrätään yhä nuoremmille ja yhä lievemmillä perusteilla. Joka toinen lapsi sairastaa ADHD:tä ja joka toinen ADD:tä. Terveitä lapsia mahtuu kourallinen tiuhun. Lähes kaikki suomalaiset kärsivät närästyksestä, ummetuksta, turvotuksesta, vitutuksesta ja muista ruoansulatus- ja suolistovaivoista.

Pahaa kolesterolia ei oikeastaan ole olemassa sen enempää kuin yksisarvisia, vampyyrejä tai ihmissusia. On olemassa vain kolesterolia ja erilaisia kolesterolia kuljettavia molekyylejä.

Jos muutat kolesterolimolekyylissä yhdenkin atomin paikan, se ei enää ole kolesterolia. LDL ja HDL ovat kuljetusmolekyylejä, jotka sisältävät samaa kolesterolia, mutta toinen on pahaa kolesterolia ja toinen hyvää kolesterolia.

Mitä se kolesteroli on?

Dave Feldman on käyttänyt vuosikymmenen vastatakseen tähän kysymykseen ja selvittääkseen, mitä kolesteroli oikeasti on. Tutustutaan Feldmanin havaintoihin.

Jos noudatat vähähiilihydraattista ja runsaasti rasvaa sisältävää ketogeenistä ruokavaliota, sinun on hyvä ymmärtää muutama asia kolesterolista ja siitä, kuinka kolesteroli liittyy valitsemaasi elämäntapaan.

Kolesterolista liikkuu paljon kummallisia ja kauhistuttavia juttuja. Osa niistä on totta. Hapettuneet lipoproteiinit ovat todellakin terveydelle haitallisia ja voivat ennustaa sydän- ja verisuonitauteja. Kolesterolia voi kumuloitua verisuonten seinämiin, mutta kysymys kuuluu: onko kolesterolin kumuloituminen verisuonten endoteeleihin syy vai seuraus. Tästä, kuten kaikista asioista, on vähintään kaksi keskenään kinastelevaa näkemystä.

Tässä jutussa käsitellään kolesterolia ensiksi hyvin yksinkertaisella ja yleisellä tavalla. Tämä ei ole täydellinen selvitys kolesterolista. Tätä on yksinkertaistettu tarkoituksella, jotta se olisi helpompi lukea ja ymmärtää. Kirjoituksen toisessa osassa siirrytään vaikeammin sulaviin rasva- ja kolesterolijuttuihin ja lopuksi luodaan katsaus todisteisiin, jotka kyseenalaistavat lipidihypoteesin.

Ennen kuin tutustutaan kolesteroliin, hiljennytään rasvaisten juttujen ja rasvasta saadun energian äärelle. Mitä ruoka ylipäätään on? Mitä rasva on? Mieti sitä hetki. Onko ruoka makaroonilaatikkoa, katkarapusalaattia vai sisäfilepihvi pippurikastikkeella? Ehkä maksalaatikkoa ja puolukkahilloa?

Ihan sama, mitä suuhusi lapioit. Ruoka on elimistölle ensisijaisesti energiaa ja rakennusaineita.

Kaikki elävät organismit muodostuvat ahneista soluista, jotka himoitsevat sokeria, rasvaa ja välttämättömiä ravinteita. Sydän koostuu soluista. Aivot koostuvat soluista. Jokainen solu sisältää kolesterolia ja rasvaa. Puolet aivojen kuivapainosta on rasvaa. Neljännes kehon kolesterolista on aivoissa. Äidin rintamaito sisältää runsaasti myrkyllistä tyydyttynyttä rasvaa ja kolesterolia. Yrittääkö luonto myrkyttää imeväiset?

Hyvä Jumala! Miksei äidinmaito voisi olla kuin kolesterolitonta, laktoositonta, ja rasvatonta monityydyttämätöntä sokeripitoista teollista mönjää?

Biljoonien solujen solupilvet muodostavat jalat, kädet, sormet, varpaat jne. Me ihmiset olemme eräänlaisia mutualistisesti toimivia soluparvia, jotka sekoilevat erilaisten mikrobien kanssa. Kaikki kehon solut ja kehon ulkopuoliset mikrobit janoavat energiaa ja rakennusaineita, jotta ne voivat jakautua.

Solut jakautuvat mitoosissa. Ex nihilo nihil fit – mitään ei synny tyhjästä. Solut tarvitsevat erilaisia aineita uusiutuakseen. Yksi solujen uusiutumisen tarvitsema aine on kolesteroli.

Ja joka Jumalan siunaama päivä noin 200 grammaa soluja uusiutuu sinussakin. Se edellyttää rakennuspalikoita (proteiineja, rasvoja ja suojaravinteita, kuten vitamiineja ja mineraaleja) sekä energiaa (hiilihydraatteja ja rasvaa). Solujen jakautumiseen tarvitaan myös kolesterolia.

Entä kuinka ravinnon sisältämä energia pääsee lautaselta elimistön kaikkiin soluihin ja sinne pikkuvarpaan päähän asti?

Valtaosa soluista ottaa energiaa vereen imeytyneistä ravinteista. Solujen yleisin energialähde on hiilihydraattien sisältämä glukoosi (sokeri). Hiilihydraatit pilkotaan ruoansulatuskanavassa yksittäisiksi sokerimolekyyleiksi, jotka imeytyvät ohutsuolesta verenkiertoon. Verenkierrossa glukoosi pääsee kaikkialle kehoon, sinne pikkuvarpaan päähän asti, jolloin nälkäiset solut voivat napata verenkierrosta joitain ravinteita itselleen.

Solujen ruokailu tapahtuu insuliinin avulla. Insuliini ja glukagoni orkestroivat energia-aineenvaihduntaa energiantuotannosta energian varastointiin. Ilman insuliinia solut eivät pysty tehokkaasti ottamaan verenkierrosta ravintoa, mutta jos insuliinia on liikaa, solut kyllästyvät, eivätkä enää reagoi insuliiniin halutulla tavalla.

Elimistö haluaa pitää sokeriaineenvaihdunnan tasapainossa. Nykyinen elämäntapa ei tue sokeri- ja insuliiniaineenvaihdunnan tasapainoa. Jatkuvasti korkea verensokeri ja insuliini vaurioittavat verisuonia ja elimiä altistaen insuliiniresistenssille, metaboliselle oireyhtymälle (mikä itse asiassa on vain toinen nimitys insuliiniresistenssille), diabetekselle, lihomiselle, Alzheimerin taudille ja sydän- ja verisuonitaudeille.

Glukoosin ohella rasva on myös tärkeä energialähde soluille. Esimerkiksi sydänlihaksen solut hapettavat pitkäketjuisia rasvahappoja betaoksidaatiossa.

Solut saavat rasvahappoja verenkierrosta, mutta hieman eri tavalla kuin glukoosia. Glukoosi voi antautua verenkierron vietäväksi, mutta rasvahapot eivät voi. Rasvahapot tarvitsevat kyydin!

Rasvahapot ja veri ovat kuin öljy ja vesi: ne eivät sekoitu keskenään. Rasvahapot ovat siis hydrofobisia

Rasvahappojen kuljetuksesta vastaa lipoproteiinit. Ensiksikin elimistö pakkaa kolme rasvahappoa yhdistelmämolekyyleiksi, joita kutsutaan triglyserideiksi. Triglyseridit ovat nisäkkäiden tärkein rasva. Ne muodostuvat kolmesta rasvahaposta ja glyseroliosasta (tri-glyseridi).

Seuraavaksi keho valmistaa rasvahapoille kuljetusvälineen. Tämä rasvahappoja kuljettava taksi on lipoproteiini. Perinteisissä tulkinnoissa  LDL-lipoproteiineja kutsutaan pahaksi kolesteroliksi. Lipoproteiineja on useita erilaisia. Kullakin on oma tarkoituksensa ja oma reittinsä.

Itse asiassa sellainen lipoproteiini, joka toimittaa kaikkia rasvahappoja, tunnetaan hyvin pienitiheyksisenä lipoproteiinina – tai VLDL:nä (Very Low Density Lipoprotein). Pakettien toimittamisen jälkeen se muuttuu matalatiheyksiseksi lipoproteiiniksi – mutta luultavasti tunnet sen jo lyhenteellä LDL (Low Density Lipoprotein) tai vain pahana kolesterolina.

Kolesteroli on steroideihin kuuluva tyydyttymätön, rengasrakenteinen, veteen liukenematon kiteinen alkoholi, joka ei triglyseridiserkkujensa tapaan sekoitu vereen. Kolesteroli hylkii vettä.

Lääketieteellisessä maailmassa triglyseridi- ja kolesterolimolekyylejä kutsutaan yleisesti lipideiksi. Lipidit hylkivät vettä, joten niitä sanotaan hydrofobisiksi (hydro = vesi, fobinen = hylkivä).

Elimistöllä voi olla syitä kolesterolin saatavuudelle myös verenkierrossa, mutta palataan siihen tuonnempana. On vielä muutama muu vesikammoinen paketti, jotka keho haluaa toimittaa soluihin kyydillä: nimittäin rasvaliukoiset A-, E-, D- ja K-vitamiinit.

Pitäisikö kehon valmistaa erillinen lipoproteiinitaksi kullekin näistä molekyyleistä?

Elimistö pakkaa kaikki munat tehokkaasti samaan koriin: lipoproteiiniin. Ihmiskeho on hämmästyttävän älykkäästi kehittynyt ja joustava. Elämä on kehittänyt eräänlaisen FedEx-kuljetuspalvelun kaikille solujen tarvitsemille vesikammoisille elementeille. Se ei ole ihmisen suuri saavutus, sillä kolesteroli on välttämätöntä kaikelle elämälle.

Suurin osa kolesterolista, jota ei käytetä solujen uusiutumiseen, kierrätetään muihin käyttötarkoituksiin, kuten steroidihormonien tai sappinesteen tuotantoon.

Olet ehkä kuullut sanottavan, että triglyseridit lisääntyvät vähähiilihydraattisella ruokavaliolla. Se ei täsmälleen ottaen ole totta.

Itse asiassa rasvassa rietastelevien LCHF-ketohörhöjen verikokeissa triglyseridipitoisuudet ovat alhaisempia, kuin teveellistä 40-60 prosenttista sokeridieettiä noudattavilla ravitsemusneuvottelukunnan ohjeiden mukaista ruokavaliota suosivilla verrokki-ihmisillä.

Hiljattain ystäväni mittautti veriarvot. Vuoden ketogeenisen ruokavalion jälkeen triglyt olivat optimaaliset, trigly-HDL-suhde optimaalinen, HDL erinomainen ja LDL:n määrässä ei ollut tapahtunut muutosta suhteessa esiketoilevaan aikaan. Sen sijaan hän oli pudottanut painoa 19 kiloa, päässyt verenpainelääkkeistä ja laskenut verensokerin esidiabeettiselta tasolta optimaaliseksi. Lääkäri oli aiheellisen huolestunut,..

Analogia: Verenkierto on kuin liikenneväylä. Tehtaat, eli solut, tarvitsevat ravinteita ja energiaa. Välillä liikenne ruuhkautuu. Erityisesti niin tapahtuu ruokailun jälkeen, jolloin veressä on runsaasti erilaisia ravinteita matkalla soluihin. Verikoe kertoo miten aktiivista työmatkaliikenne on. Se kertoo kuinka paljon glukoosia tai rasvaa on matkalla soluihin. Se ei kuitenkaan suoraan kerro, kuinka paljon ja kuinka tehokkaasti solut käyttävät ko. ravintoaineita.

Tyypin 2 diabeteksen yleinen oire on, että veressä on erittäin paljon glukoosia myös silloin kuin työmatkaliikenne ei ole aktiivista. Tämä kertoo siitä, että glukoosin pääsy soluihin on heikentynyt. Aikuistyypin diabeetikot ovat insuliiniresistenttejä. Insuliiniresistentit solut ovat ikään kuin lakossa. Ne eivät reagoi insuliiniin toivotulla tavalla. Insuliiniresistentit solut päästävät vain vähän ravinteita soluun. Seurauksena on, että solulaitteet ja solut surkastuvat ja kuolevat energianpuutteeseen.

Samalla verenkierron työmatkaliikenne uhkaa kirjaimellisesti puuroutua, sillä glukoosi aiheuttaa veressä glykaatiota, joka tekee verestä siirappia. Se kohottaa verenpainetta, ja on muutenkin rinnastettavissa kymmenen auton ketjukolariin Länsi- tai Itäväylällä.

Diabetesta sairastavat voivat syödä saman määrän ruokaa kuin terveet, mutta diabeetikon verensokeri nousee korkeammaksi ja laskee hitaammin insuliinin heikentyneen vaikutuksen vuoksi.

Insuliiniresistenssit solut eivät saa energiaa yhtä tehokkaasti kuin terveet solut. Se voi lisätä nälkää säätelevien hormonien, kuten greliinin eritystä, jolloin olo on nälkäinen pian syömisen jälkeen.

Veren glukoosista on päästävä eroon, koska muuten se tukkii suonet glykatoitumalla muiden ravinteiden kanssa.

Osa glukoosista säilötään rasvasoluihin, joiden insuliinisensitiivisyys säilyy lihassoluja kauemmin. Osan elimistö yrittää pissata pois. Siksi diabetesta sairastavien virtsaneritys lisääntyy.

Hyvin yleinen uniapnea johtuu erään hypoteesin mukaan myös korkeasta verensokerista, joka kuluttaa B1-vitamiinia; tiamiini on välttämätön vitamiini aivojen hengityskeskuksen autonomisen toiminnan säätelyssä. Tiamiinin puute aiheuttaa beriberiä ja SIDS-oireyhtymää (kätkytkuolema). Yksinkertaisin ja halvin tapa helpottaa uniapneaa on laskea verensokeria ja varmistaa B1-vitamiinin riittävä saanti.

Jos olet vähentänyt hiilihydraatteja ja saat energiasi pääasiassa rasvasta, solusi ottavat rasvaa tehokkaasti verenkierrosta. Vaikka ruokavalio sisältäisi enemmän rasvaa ja kolesterolia, niiden määrä verenkierrossa laskee, koska solut ottavat verenkierrosta glukoosin puutteessa rasvaa ja kolesterolia tehokkaammin.

Toinen yleinen oletus ketogeenisestä ruokavaliosta on, että suurin osa energiasta saadaan ketoneista, koska ketogeeninen ruokavalio johtaa ketoosiin. Maksa valmistaa ketogeenisellä ruokavaliolla energiasubstraateiksi kelpaavia ketoaineita vapaista rasvahapoista, mutta vaikka ketoaineiden tuotanto ja käyttö lisääntyy, ne ovat toissijainen energianlähde. Ensisijainen energianlähde ovat vapaat rasvahapot,joita hapetetaan energiaksi betaoksidaatiossa. Toisaalta aivojen soluille ketoaineet, kuten beta-hydroksibutyraatti, ovat optimaalista ravintoa.

Entä kuinka vapaat rasvahapot pääsevät soluihin, jossa niitä hapetetaan energiaksi? Vapaat rasvahapot kuljetetaan soluihin LDL-kuljetusmolekyylien kuljettamina. Siis se paha kolesteroli vie ruokaa soluille. Aika paha, vai mitä luulet?

Hiilihydraatteja rajoittavalla ruokavaliolla elimistön on korvattava glukoosin puute ja liikuteltava enemmän triglyseridejä solujen polttoaineeksi, koska suurin osa energiasta otetaan rasvasta. Ruokavalion vaikutuksesta veren triglyseriditasot laskevat, koska solut ottavat rasvaa vastaan ja hapettavat siitä energiaa.

Veren rasva- ja kolesteroliarvot korjaantuvat jo kolmessa kuukaudessa. Samalla verenpaine ja paino laskevat. Lue tästä!

  1. Solut tarvitsevat energiaa
  2. Rasvaisella ruokavaliolla solujen ensisijainen energialähde on triglyseridit
  3. Triglyseridit kuljetetaan soluihin hyvin pienitiheyksisissä lipoproteiineissa (VLDL), jotka lopulta muuttuvat pienitiheyksisiksi lipoproteiineiksi (LDL)
  4. Kaikki hyvin pienitiheyksiset lipoproteiinit (VLDL) sisältävät sekä triglyseridejä että kolesterolia (mutta enimmäkseen triglyseridejä)

Meidät on ehdollistettu uskomaan, että kolesteroli on tosi paha asia. Niin yksinkertaista se ei suinkaan ole. Kolesteroli voi tietyissä tilanteissa kasvattaa sairastumisen riskiä, mutta laajasti ottaen elimistömme ja itse asiassa elämä itsessään on täysin riippuvainen kolesterolista.

Lipoproteiini on hieman kuin postin pakettiauto. Se kuljettaa triglyserdien lisäksi kolesterolia ja rasvaliukoisia vitamiineja. Kolesterolin osuus lipoproteiinin lastista on hyvin niukka.

Kolesteroli kierrätetään enimmäkseen takaisin maksassa. Kolesterolin olemassaolo itsessään ei ole riski. Riski syntyy lipoproteiinien oksidoituessa ja tulehdustilanteissa.

Tämä on kolesterolista käytävän tulehduskeskustelun ydin. Vahingoittaako kolesteroli verisuonia? Vai onko kolesteroli laastari, joka paikkaa verisuoniin syntyneitä vaurioita? Perinteinen muna-kana-kysymys siis!

Monet arvovaltaiset tutkijat, lääkärit ja laitokset ovat kallistuneet jälkimmäisen hypoteesin kannattajiksi. Kolesterolikeskustelua tärkeämpää olisi varoittaa korkean verensokerin, hyperinsulinemian, insuliiniresistenssin ja diabeteksen aiheuttamista sydän- ja verisuonitautiriskeistä. Ne nimittäin ovat hyvin todellisia riskejä yli puolelle miljoonalle suomalaiselle diabeetikolle.

2. osa: Mitä se kolesteroli siis on?

Tämä on astetta laajempi ja teknisempi selitys kolesterolista. Kolesteroli (tulee antiikin Kreikan sanoista chole– (sappi) ja stereos (kiinteä), jota seuraa alkoholin kemiallinen loppuliite -ol) on orgaaninen molekyyli.

Se on steroli (tai modifioitu steroidi), siis eräänlainen lipidi. Kolesterolia biosyntetisoituu kaikissa eläinsoluissa, ja se on olennainen eläinsolukalvojen rakenteellinen komponentti. Kolesteroli toimii myös esiasteena steroidihormonien, sappihapon ja D-vitamiinin biosynteesissä.

Kolesteroli on tärkein kaikkien eläinten syntetisoima steroli. Selkärankaisilla maksan solut tuottavat tyypillisesti suurimman osan kolesterolista. Sitä ei ole prokaryooteilla (bakteereilla ja arkeilla), vaikka on olemassa joitain poikkeuksia, kuten Mycoplasma, jotka edellyttää kasvua varten kolesterolia.

François Poulletier de la Salle tunnisti kolesterolin kiinteässä muodossa sappikivissä ensimmäisen kerran vuonna 1769. Vasta vuonna 1815 kemisti Michel Eugène Chevreul nimitti yhdisteen ”kolesteriiniksi”.

Kolesteroli on välttämätöntä elämälle, ja jokainen solu kykenee syntetisoimaan sen monimutkaisen 37-vaiheisen prosessin avulla. Tämä alkaa mevalonaatti- tai HMG-CoA-reduktaasireitillä, joka on statiinilääkkeiden kohde, joka käsittää ensimmäiset 18 vaihetta. Tätä seuraa 19 lisävaihetta saadun lanosterolin muuttamiseksi kolesteroliksi.

Mies, joka painaa 68 kg, syntetisoi normaalisti noin 1 gramman (1000 mg) kolesterolia päivässä, ja hänen kehossaan on noin 35 g kolesterolia (lähinnä solukalvoissa). Tyypillinen päivittäinen kolesterolin saanti ravinnosta Yhdysvalloissa on 307 mg.

Suurin osa nautitusta kolesterolista on esteröitynyttä, minkä vuoksi se imeytyy suolesta elimistöön hyvin huonosti. Elimistö kompensoi myös nautittavan kolesterolin meytymistä vähentämällä omaa kolesterolisynteesiään. Näistä syistä ravinnon sisältämällä kolesterolilla on seitsemän – kymmenen tuntia nauttimisen jälkeen vain vähän tai ei lainkaan vaikutusta veren kolesterolipitoisuuksiin.

Mutta kolesterolin saanti ravinnosta nostaa kolesterolipitoisuutta seitsemän ensimmäisen tunnin aikana ruokailun jälkeen. Tämä johtuu siitä, että lipoproteiinit (jotka kuljettavat kaikkia elimistöön imeytyneitä lipidejä solujen ulkopuolella) jakautuvat kehon ympäri solunulkoiseen veteen, Tämän vuoksi pitoisuudet kasvavat.

Kasvit eivät tuota kolesterolia, mutta ne tuottavat fytosteroleja, jotka ovat kemiallisesti samanlaisia aineita. Samankaltaisuutensa vuoksi ne voivat kilpailla kolesterolin kanssa suoliston takaisinimeytymisestä ja siten vähentää kolesterolin reabsorptiota.

Kun suoliston vuoraussolut imevät fytosteroleja kolesterolin sijasta, ne erittävät tavallisesti fytosterolimolekyylit takaisin ruoansulatuskanavaan, mikä on tärkeä suojamekanismi. Luonnossa esiintyvien kasvisterolien ja stanolien sisältämien fytosterolien saanti vaihtelee välillä ~ 200–300 mg päivässä syömistottumuksista riippuen. Kasvisruokavalioissa fytosterolien saanti voi kasvaa 700 mg:n vuorokausisaantiin.

Kolesteroli muodostaa noin 30% kaikista eläinsolujen kalvoista eli membraaneista. Sitä tarvitaan solukalvojen rakentamiseksi ja ylläpitämiseksi. Kolesteroli moduloi kalvojen juoksevuutta fysiologisten lämpötilojen alueella. Kunkin kolesterolimolekyylin hydroksyyliryhmä on vuorovaikutuksessa kalvoa ympäröivien vesimolekyylien kanssa, samoin kuin kalvon fosfolipidien ja sfingolipidien napapäät, kun taas iso steroidi- ja hiilivetyketju on upotettu kalvoon, polaarisen rasvahappoketjun rinnalla.

Muut lipidit

Kolesteroli lisää kalvopakkauksia vuorovaikutuksessa fosfolipidirasvahappoketjujen kanssa, mikä muuttaa kalvon juoksevuutta ja ylläpitää kalvon eheyttä siten, että solujen ei tarvitse rakentaa erillisiä soluseiniä (kuten kasvien ja useimpien bakteerien). Kalvo pysyy vakaana ja kestävänä olematta jäykkä, jolloin solut voivat muuttaa muotoa ja soluelimet liikkua.

Kolesterolin tetrasyklisen renkaan rakenne edistää solukalvon juoksevuutta, koska molekyyli on trans-konformaatiossa, joka tekee kolesterolin sivuketjun paitsi jäykäksi, myös tasomaiseksi. Tässä rakenteellisessa roolissa kolesteroli vähentää neutraalien liuenneiden aineiden, sekä vety- ja tatriumionien plasmakalvon läpäisevyyttä.

Kolesteroli vaikuttaa solunsisäisessä kuljetuksessa, solujen signaloinnissa ja hermoissa kulkevien signaalien johtamisessa. Kolesteroli on välttämätön invasiivisten caveolae- ja klatrriinipäällysteisten kuoppien rakenteelle ja toiminnalle, mukaan lukien caveolasta riippuvainen ja klathriinista riippuvainen endosytoosi.

Kolesterolin roolia tämän tyyppisessä endosytoosissa voidaan tutkia käyttämällä metyylibeta-syklodekstriiniä (MβCD) kolesterolin poistamiseksi plasmamembraanista. Kolesteroli säätelee substraatin esittelyn biologista prosessia ja entsyymejä, jotka käyttävät substraatin esittelyä aktivoitumismekanismina. (PLD2) on hyvin määritelty esimerkki entsyymistä, joka aktivoituu substraatin esittämisen avulla. Entsyymi palmitoyloidaan*, jolloin entsyymi kulkeutuu kolesterolista riippuvaisiin lipididomeeneihin, joita kutsutaan joskus ”lipidilautoiksi”.

*Palmitoylaatio tapahtuu, kun rasvahappoihin sitoutuu kovalenttisesti kalvoproteiini, kuten palmitiinihappo, johon on sitoutunut kysteiini ( S -palmitoylation) ja harvemmin seriini tai treoniini.

Palmitoylaation tarkka toiminta riippuu tarkasteltavasta proteiinista. Palmitoylaatio lisää proteiinien hydrofobisuutta ja myötävaikuttaa niiden kalvoyhdistelmään. Palmitoylaatiolla näyttää myös olevan merkittävä rooli proteiinien solunsisäisessä liikenteessä membraaniosastojen välillä sekä proteiini-proteiini-vuorovaikutuksen moduloinnissa .

Toisin kuin prenylaatio ja myristoylaatio, palmitoylaatio on yleensä palautuva,k koska palmitiinihapon ja proteiinin välinen sidos on usein tioesterisidos. Käänteisen reaktion nisäkkään soluissa katalysoivat asyyli-proteiini tioesteraasit (APT) solujen sytosolissa ja palmitoyyli-proteiinin tioesteraasit lysosomeissa.

Koska palmitoylaatio on dynaaminen, translaation jälkeinen prosessi, solun uskotaan käyttävän sitä muuttavan proteiinin solunsisäistä sijaintia, proteiini-proteiini-vuorovaikutusta tai sitoutumiskapasiteettia.

Esimerkki palmitoylaation läpikäyvästä proteiinista on hemagglutiniini , membraaniglykoproteiini, jota influenssa-virus käyttää isäntäsolureseptoreihin kiinnittymiseen. Lukuisten entsyymien palmitoylaatiojaksot on tunnistettu viime vuosina, mukaan lukien: H-Ras , Gsα , β2-adrenerginen reseptori ja endoteelin typpioksidisyntaasi (eNOS).

Signaalitransduktiossa G-proteiinin kautta a-alayksikön palmitoylaatio, y-alayksikön prenylaatio ja myristoylaatio osallistuvat G-proteiinin sitomiseen plasmakalvon sisäpintaan niin, että G-proteiini voi olla vuorovaikutuksessa reseptorinsa kanssa.

S-palmitoylaation tekevät yleensä proteiinit, joilla on DHHC-domeeni . Ei-entsymaattisissa reaktioissa on poikkeuksia. Asyyliproteiinitioesteraasi (APT) katalysoi käänteisen reaktion. Myös muut asyyliryhmät, kuten stearaatti tai oleaatti, hyväksytään usein kasvien ja virusten proteiineissa, mikä tekee S-asyloinnista käyttökelpoisemman nimen.

Noin 40% synaptisista proteiineista löydettiin palmitoylomeista. Palmitoylaatio välittää proteiinin affiniteetin lipidilauttoihin ja helpottaa proteiinien klusteroitumista. Klusterointi voi lisätä kahden molekyylin läheisyyttä. Vaihtoehtoisesti klusterointi voi sitoa proteiinin pois substraatista.

Esimerkiksi fosfolipaasi D:n (PLD) palmitoylaatio erottaa entsyymin pois substraatistaan fosfatidyylikoliinista. Kun kolesterolitasot laskevat tai PIP2-tasot lisäävät palmitaatin välittämää lokalisoitumista , entsyymi siirtyy PIP2:een, jossa se kohtaa substraatinsa ja on aktiivinen substraatin esittämisen kautta .

Tärkein proteiinin klustereiden välittäjä synapsissa on postsynaptisen tiheyden ( 95 kD) proteiini PSD-95 . Kun tämä proteiini palmitoyloidaan, se rajoittuu kalvoon. Tämän kalvoon kohdistuvan rajoituksen avulla se voi sitoutua postsynaptiseen kalvoon ja klusteroida sen . Presynaptisessa hermosolussa SNAP-25:n palmitoylaatio ohjaa sen jakautumaan solukalvoon ja antaa SNARE- kompleksin hajota vesikkelifuusion aikana. Tämä tarjoaa palmitoylaatiolle roolin välittäjäaineiden vapautumisen säätelyssä . Delta-kateniinin palmitoylaatio näyttää koordinoivan aktiivisuudesta riippuvia muutoksia muistinmuodostukseen osallistuvissa synaptisissa adheesiomolekyyleissä, synapsiorakenteessa ja reseptoripaikannuksissa. Gefyriinin palmitoylaation on raportoitu vaikuttavan GABAergisiin synapseihin.

Palmitoylaatio – https://fi.qaz.wiki/wiki/Palmitoylation


Fosfolipaasi D:n substraatti on fosfatidyylikoliini (PC), joka on tyydyttymätön ja jota on vähän
lipidilautoissa. PC lokalisoituu solun häiriintyneelle alueelle yhdessä monityydyttymättömän lipidifosfatidyyli- inositoli 4,5-bisfosfaatin (PIP2) kanssa. PLD2:lla on PIP2:ta sitova domeeni.

Kun PIP2-pitoisuus membraanissa kasvaa, PLD2 poistuu kolesterolista riippuvaisista domeeneista ja sitoutuu PIP2:een, missä se sitten saa pääsyn substraatti-PC:hen ja aloittaa katalyytin substraatin esityksen perusteella.

Solujen signallointi

Kolesteroli on osallisena myös solujen signalointiprosesseissa, mikä auttaa lipidilautojen muodostumista plasmamembraanissa. Prosessi tuo korkean toisioviestimolekyylikonsentraation reseptoriproteiinit esiin. Kolesteroli ja fosfolipidit (sähköeristimet), voivat monella tavalla helpottaa sähköimpulssien siirtonopeutta hermokudosta pitkin.

Monissa hermokuiduissa runsaasti kolesterolia sisältävä myeliinivaippa (joka on peräisin tiivistetyistä Schwannin solukalvokerroksista) tarjoaa eristeen sähköisten impulssien tehokkaammalle johtamiselle. Myeliinivaipan vaurioituminen esimerkiksi multippeliskleroosissa hidastaa tai katkaisee hermostossa kulkevia sähköisiä impulsseja, jolloin aivojen lähettämät toimintakäskyt eivät aina saavuta lihaksia.

Demyelinaation (Schwann-solujen surkastuminen) uskotaan olevan osa multippeliskleroosin patogeneesiä. Multippelisklerootikkona minulla on siis oma lehmä ojassa. Minä tunnen kolesterolin hieman eri merkityksessä, kuin monet muut. Minä näen kolesterolin hermovälittäjiä suojaavien myeliinivaippojen välttämättömänä rakennusaineena.

Kolesteroli sitoutuu ja vaikuttaa useiden ionikanavien, kuten nikotiiniasetyylikoliinireseptorin, GABA A-reseptorin ja sisäänpäin suuntautuvan kaliumkanavan välityksellä. Kolesteroli aktivoi myös estrogeeniin liittyvän alfa-reseptorin (ERRα) ja se voi olla reseptorin endogeeninen ligandi.

Reseptorin rakenteeltaan aktiivinen luonne voidaan selittää sillä, että kolesterolia on kaikkialla kehossa. ERRα-signaloinnin estäminen kolesterolin tuotannon vähentämisellä on tunnistettu keskeiseksi välittäjäksi statiinien ja bisfosfonaattien vaikutuksissa luuhun, lihakseen ja makrofageihin. Näiden havaintojen perusteella on ehdotettu, että ERRα tulisi luokitella kolesterolin reseptoriksi.

Kolesteroli on mm. steroidihormonien lähtöaine

Kolesteroli on useiden solunsisäisten biokemiallisten reittien edeltäjämolekyyli. Se on lähtöaine D-vitamiinin synteesissä, kalsiumin aineenvaihdunnassa ja kaikkien steroidihormoneien synteesissä, mukaan lukien lisämunuaishormonit kortisoli ja aldosteroni, sekä sukupuolihormonit progesteroni, estrogeenit, testosteroni ja niiden johdannaiset. Elimistö ei syntetisoi kolesterolia turhaan. Sitä tarvitaan lukemattomiin aineenvaihduntatapahtumiin, solukalvoihin, solusignalointiin ja hermoratoja suojaavien myeliinivaippojen rakenteisiin.

Kolesteroli kierrätetään elimistössä. Maksa erittää kolesterolia sappinesteisiin, jotka sitten varastoidaan sappirakoon, joka edelleen erittää kolesterolin esteröimättömässä muodossa (sapen kautta) ruoansulatuskanavaan. Tyypillisesti noin 50% erittyvästä kolesterolista imeytyy ohutsuolessa takaisin verenkiertoon.

Kaikki eläinsolut tuottavat kolesterolia sekä kalvorakenteeseen että muuhun käyttöön, suhteelliset tuotantonopeudet vaihtelevat solutyypin ja elimen toiminnan mukaan. Noin 80% päivittäisestä kolesterolituotannosta tapahtuu maksassa ja suolistossa; muita korkeampia synteesinopeuspaikkoja ovat aivot, lisämunuaiset ja lisääntymiselimet. Kolesterolin biosynteesiä säätelevät suoraan olemassa olevat kolesterolitasot, vaikka mukana olevat homeostaattiset mekanismit ymmärretään vain osittain. Suurempi ravinnon kolesterolipitoisuus johtaa endogeenisen tuotannon nettovähennykseen, kun taas pienemmällä kolesterolin saannilla on päinvastainen vaikutus.

Tärkein säätelymekanismi on solunsisäisen kolesterolin havaitseminen endoplasman verkkokalvossa SREBP-proteiinin (sterolia säätelevää elementtiä sitova proteiini 1 ja 2) avulla.

Kolesterolin läsnä ollessa SREBP sitoutuu kahteen muuhun proteiiniin: SCAP:iin (SREBP:n pilkkoutumista aktivoivaan proteiiniin) ja INSIG-1:een. Kun kolesterolitaso laskee, INSIG-1 irtoaa SREBP-SCAP-kompleksista, mikä antaa kompleksin siirtyä Golgin laitteisiin. Tässä SREBP katkaistaan S1P: llä ja S2P: llä (site-1-proteaasi ja site-2-proteaasi), kahdella entsyymillä, jotka aktivoituvat SCAP:lla, kun kolesterolitasot ovat alhaiset. Pilkottu SREBP siirtyy sitten solun tumaan ja toimii transkriptiotekijänä sitoutuakseen sterolin säätelyelementtiin (SRE), joka stimuloi monien geenien transkriptiota. Näitä ovat pienitiheyksinen lipoproteiinireseptori (LDL) ja HMG-CoA-reduktaasi. LDL-reseptori imee verenkierrossa kiertävää LDL:ää, kun taas HMG-CoA-reduktaasi johtaa kolesterolin endogeenisen tuotannon lisääntymiseen.

Suuren osan tästä signalointireitistä selvittivät tohtori Michael S. Brown ja tohtori Joseph L. Goldstein 1970-luvulla. Vuonna 1985 he saivat Nobel-palkinnon fysiologisesta ja lääketieteestä työstään. Heidän myöhempi työ osoittaa, kuinka SREBP-reitti säätelee monia lipidien metaboliaa ja muodostumista sekä energiasubstraattien allokointia kontrolloivien geenien ilmentymistä.

Kolesterolisynteesi voidaan myös kytkeä pois päältä, kun kolesterolitaso on korkea. HMG-CoA-reduktaasi sisältää sekä sytosolidomeenin (vastuussa sen katalyyttisestä toiminnasta) että kalvodomeenin. Kalvodomeeni tunnistaa signaalit sen hajoamisesta. Kolesterolin (ja muiden sterolien) lisääntyvät pitoisuudet aiheuttavat muutoksen tämän domeenin oligomerisaatiotilassa, mikä tekee siitä alttiimman proteosomin tuhoamiselle. Tämän entsyymin aktiivisuutta voidaan vähentää myös fosforyloimalla AMP-aktivoidulla proteiinikinaasilla. Koska tämä kinaasi aktivoituu AMP:llä, joka syntyy, kun ATP hydrolysoidaan, seuraa, että kolesterolisynteesi pysähtyy, kun ATP-tasot ovat alhaiset.

Eristettynä molekyylinä kolesteroli liukenee huonosti veteen (se on heikosti hydrofiilinen). Tämän vuoksi kolesterolia liukenee vereen erittäin pieninä pitoisuuksina.

Lipoproteiinit

Tehokkaasta kolesterolin kuljetuksesta vastaavat lipoproteiinit, joihin kolesteroli pakataan. Lipoproteiinit ovat monimutkaisia diskoidisia molekyylejä, joissa on ulkopuolisia amfifiilisiä proteiineja ja lipidejä, joiden ulospäin suuntautuvat pinnat ovat vesiliukoisia ja sisäänpäin osoittavat pinnat rasvaliukoisia.

Rakenteensa ansiosta lipoproteiini voi kulkea veren läpi emulgoinnin avulla. Sitoutumaton kolesteroli, joka on amfipaattinen, kulkeutuu lipoproteiinimolekyylin yksikerroksisella pinnalla fosfolipidien ja proteiinien mukana. Rasvahappoon sitoutuneet kolesteroliesterit kulkeutuvat toisaalta lipoproteiinin rasva-hydrofiilisen ytimen sisällä yhdessä triglyseridin kanssa.

Veressä on useita lipoproteiinityyppejä. Suuren tiheyden järjestyksessä ne ovat kylomikronit, hyvin matalatiheyksinen lipoproteiini (VLDL), keskitiheyksinen lipoproteiini (IDL), matalatiheyksinen lipoproteiini (LDL) ja suuritiheyksinen lipoproteiini (HDL).

Eri lipoproteiinien kuljettma kolesteroli on kemiallisesti on identtistä, vaikka jotkut kolesterolimolekyylit kulkeutuvatkin kolesterolin natiivina ”vapaana” alkoholimuotona (kolesteroli-OH-ryhmä), kun taas toisissa molekyyleissä kolesteroli on rasva-asyyliestereinä, jotka tunnetaan myös kolesteroliesterinä.

Lipoproteiinimolekyylit organisoidaan monimutkaisilla apolipoproteiineilla, tyypillisesti 80-100 erilaista proteiinia partikkelia kohden, jotka voidaan tunnistaa ja sitoa solukalvojen spesifisillä reseptoreilla, ohjaamalla niiden lipidien hyötykuorma spesifisiin soluihin ja kudoksiin, jotka ovat herkistyneitä näille rasvansiirtomolekyyleille.

Nämä pintareseptorit toimivat ainutlaatuisina molekyylirekistereinä, jotka auttavat rasvan jakautumisen koko kehoon. Kylomikronit, eli vähiten tiheät kolesterolia kuljettavat molekyylit, sisältävät kuorissaan apolipoproteiini B-48:n, apolipoproteiini C:n ja apolipoproteiini E:n (tärkein kolesterolin kuljettaja aivoissa). Kylomikronit kuljettavat rasvoja suolesta lihaksiin ja muihin kudoksiin, jotka tarvitsevat rasvahappoja energiaksi tai rasvan tuottamiseksi.

Maksa tuottaa VLDL-molekyylejä triglyserideistä ja kolesterolista, jota ei käytetty sappihappojen synteesissä. Nämä molekyylit sisältävät kuorissaan apolipoproteiini B100:n ja apolipoproteiini E:n, ja valtimon seinämän lipoproteiinilipaasi voi hajottaa ne IDL:ksi. Tämä valtimon seinämän pilkkominen sallii triglyseridin imeytymisen ja lisää kiertävän kolesterolin pitoisuutta. IDL-molekyylejä kulutetaan sitten kahdessa prosessissa: puolet metaboloituu HTGL:n kautta ja LDL-reseptori vie ne maksan solupinnoille, kun taas toinen puoli menettää edelleen triglyseridejä verenkierrossa, kunnes niistä tulee kolesterolipitoisia LDL-molekyylejä.

LDL-molekyylit ovat tärkeimmät veren kolesterolinkuljettajat. Jokainen niistä sisältää noin 1500 kolesteroliesterimolekyyliä. LDL-molekyylikuoret sisältävät vain yhden molekyylin apolipoproteiini B100:n, jonka perifeeristen kudosten LDL-reseptorit tunnistavat. Apolipoproteiini B100:n sitoutuessa monet LDL-reseptorit keskittyvät klatriinilla päällystettyihin kuoppiin. Sekä LDL että sen reseptori muodostavat rakkuloita solussa endosytoosin kautta. Nämä rakkulat sulautuvat sitten lysosomiin, jossa lysosomaalihappo-lipaasientsyymi hydrolysoi kolesteroliesterit.

Kolesterolia voidaan sitten käyttää membraanin biosynteesiin tai esteröidä ja varastoida soluun, jotta se ei häiritse solukalvoja. LDL-reseptorit kuluvat kolesterolin imeytymisen aikana, ja sen synteesiä säätelee SREBP, sama proteiini, joka kontrolloi kolesterolin synteesiä de novo, sen mukaan, onko se solussa. Solun, jossa on runsaasti kolesterolia, LDL-reseptorisynteesi estetään, jotta estetään uuden kolesterolin lisääntyminen LDL-molekyyleissä. Päinvastoin, LDL-reseptorisynteesi etenee, kun solussa on kolesterolipuutetta.

Paha kolesteroli

Kun tämä prosessi muuttuu sääntelemättömäksi, veressä alkaa näkyä LDL-molekyylejä, joissa ei ole reseptoreita. Nämä LDL-molekyylit hapetetaan ja ne imeytyvät makrofageihin, jotka tukkeutuvat ja muodostavat vaahtosoluja. Nämä vaahtosolut jäävät usein kiinni verisuonten seinämiin ja edistävät ateroskleroottisten plakkien muodostumista. Tämä on se paha kolesteroli.

Kolesterolihomeostaasin häiriöt vaikuttavat varhaisen ateroskleroosin (kaulavaltimon intima-väliaineen paksuus) kehittymiseen. Näiden plakkien yhteys sydänkohtauksiin, aivohalvauksiin ja muihin vakaviin lääketieteellisiin ongelmiin on syy, minkä vuoksi kolesterolia kauhistellaan.

HDL-molekyylien uskotaan kuljettavan kolesterolia takaisin maksaan joko erittymiseen tai muihin hormoneja syntetisoiviin kudoksiin prosessissa, joka tunnetaan käänteisenä kolesterolikuljetuksena (RCT). Suuri määrä HDL-molekyylejä korreloi parempaan terveyteen

Kolesteroli on altis hapettumiselle ja muodostaa helposti hapetettuja johdannaisia, joita kutsutaan oksysteroleiksi. Kolme erilaista mekanismia voi muodostaa tällaisia: autoksidaatio, sekundaarinen hapettuminen lipidiperoksidaatioksi ja kolesterolia metaboloiva entsyymihapetus.

Suuri kiinnostus oksysteroleihin syntyi, kun niiden osoitettiin vaikuttavan estävästi kolesterolin biosynteesiin. Tämä havainto tunnettiin nimellä ”oksysterolihypoteesi”. Oksysterolien lisärooleja ihmisen fysiologiassa ovat niiden osallistuminen sappihappojen biosynteesiin, toiminta kolesterolin kuljetuksessa ja geenitranskription säätely.

Kolesteroli hapetetaan maksassa erilaisiksi sappihapoiksi. Nämä puolestaan ovat konjugoituja glysiinin, tauriinin, glukuronihapon tai sulfaatin kanssa. Konjugoitujen ja konjugoimattomien sappihappojen seos yhdessä kolesterolin kanssa erittyy maksasta sappeen. Noin 95% sappihapoista imeytyy takaisin suolistosta ja loput häviävät ulosteiden mukana. Sappihappojen erittyminen ja imeytyminen muodostavat enterohepaattisen verenkierron perustan, mikä on välttämätöntä ravintorasvojen sulatukselle ja imeytymiselle. Tietyissä olosuhteissa kolesteroli voi kiteytyä sappirakossa ja vaikuttaa sappikivien muodostumiseen (myös lesitiinistä ja bilirubiinista muodostuvia sappikiviä esiintyy, mutta harvemmin).

Joka päivä paksusuoleen pääsee jopa 1 g kolesterolia. Tämä kolesteroli on peräisin ruokavaliosta, sapesta ja suolen poistetuista suolistosoluista, ja paksusuolibakteerit voivat metaboloida sen. Kolesteroli muuttuu pääasiassa koprostanoliksi, imeytymättömäksi steroliksi, joka erittyy ulosteisiin.

Vaikka kolesteroli on steroidi, joka yleensä liittyy nisäkkäisiin, ihmisen patogeeni Mycobacterium tuberculosis pystyy hajottamaan tämän molekyylin täysin ja sisältää suuren määrän geenejä, joita sen läsnäolo säätelee.

Monet näistä kolesterolilla säädellyistä geeneistä ovat rasvahappojen β-hapetusgeenien homologeja, mutta ne ovat kehittyneet sitomaan suuria steroidisubstraatteja, kuten kolesterolia. Eläinrasvat ovat monimutkaisia triglyseridiseoksia, joissa on vähäisempiä määriä sekä fosfolipidejä että kolesterolimolekyylejä, joista kaikki eläin- (ja ihmisen) solukalvot rakennetaan.

Koska kaikki eläinsolut tuottavat kolesterolia, kaikki eläinperäiset elintarvikkeet sisältävät kolesterolia vaihtelevissa määrissä. Suurimpia ruokavalion kolesterolilähteitä ovat punainen liha, munankeltuainen ja kokonaiset munat, maksa, munuaiset, pikkulohet, kalaöljy ja voi. Ihmisen äidinmaito sisältää myös merkittäviä määriä kolesterolia. Kasvisolut syntetisoivat kolesterolia muiden yhdisteiden, kuten fytosterolien ja steroidisten glykoalkaloidien, esiasteena, ja kolesterolia on kasviruoissa vain vähän tai ei ollenkaan. Jotkut kasviruoat, kuten avokado, pellavansiemenet ja maapähkinät, sisältävät fytosteroleja, jotka kilpailevat kolesterolin kanssa imeytymisestä suolistossa, vähentävät sekä ruokavalion että sappikolesterolin imeytymistä. Tyypillinen ruokavalio myötävaikuttaa noin 0,2 gramman fytosteroleihin, mikä ei riitä vaikuttamaan merkittävästi kolesterolin imeytymisen estoon.

Fytosterolien saantia voidaan täydentää käyttämällä fytosterolia sisältäviä funktionaalisia elintarvikkeita tai ravintolisiä, joiden tiedetään olevan potentiaalisia alentamaan LDL-kolesterolitasoja. Vuonna 2016 Yhdysvaltain maatalousministeriön ruokavalion ohjeiden neuvoa-antava komitea suositteli amerikkalaisia syömään mahdollisimman vähän kolesterolia. Useimmissa kolesterolipitoisissa elintarvikkeissa on myös runsaasti tyydyttyneitä rasvoja, mikä voi siten lisätä sydän- ja verisuonitautien riskiä. [57] Joissakin täydentävissä ohjeissa suositellaan fytosterolien annoksia 1,6–3,0 grammaa päivässä (Health Canada, EFSA, ATP III, FDA).

Äskettäinen meta-analyysi osoittaa LDL-kolesterolin laskevan 12%:lla fytosterolien 2,1 gramman päiväsaannilla. Fytosteroleilla täydennetyn ruokavalion edut on kuitenkin kyseenalaistettu.

Perinteisen ja institutionalisoidun lipidihypoteesin mukaan kohonnut kolesterolitaso veressä aiheuttaa ateroskleroosia, mikä voi lisätä sydänkohtauksen, aivohalvauksen ja perifeerisen valtimosairauden riskiä. Koska veren korkeammat LDL-pitoisuudet ja pienempi LDL-partikkelikoko – vaikuttavat tähän prosessiin enemmän kuin HDL-hiukkasten kolesterolipitoisuus, LDL-partikkeleita kutsutaan usein ”pahaksi kolesteroliksi”.

Suuret toiminnallisen HDL:n pitoisuudet, jotka voivat poistaa kolesterolin soluista ja ateroomista, tarjoavat suojan ja niitä kutsutaan yleisesti ”hyväksi kolesteroliksi”. Nämä tasapainot määritetään enimmäkseen geneettisesti, mutta niitä voidaan muuttaa kehon koostumuksen, lääkkeiden, ruokavalion ja muiden tekijöiden perusteella. Vuoden 2007 tutkimus osoitti, että veren kokonaiskolesterolitasoilla on eksponentiaalinen vaikutus sydän- ja verisuonitauteihin ja kokonaiskuolleisuuteen, ja yhteys on selvempi nuoremmilla koehenkilöillä.

Koska sydän- ja verisuonitaudit ovat suhteellisen harvinaisia nuoremmalla väestöllä, korkean kolesterolin vaikutus terveyteen on suurempi iäkkäillä ihmisillä. Kohonnut lipoproteiinifraktioiden, LDL-, IDL- ja VLDL-tasojen, sijaan kokonaiskolesterolitaso, korreloivat ateroskleroosin laajuuden ja etenemisen kanssa.

Päinvastoin, kokonaiskolesteroli voi olla normaaleissa rajoissa, mutta se koostuu pääasiassa pienistä LDL- ja pienistä HDL-hiukkasista, joissa aterooman kasvunopeus on korkea. IDEALin ja EPIC:n prospektiivisten tutkimusten post hoc -analyysi havaitsi yhteyden korkeaan HDL-kolesterolitasoon (mukautettu apolipoproteiini AI ja apolipoproteiini B) ja lisääntyneeseen sydän- ja verisuonitautien riskiin, mikä epäili ”hyvän kolesterolin” kardioprotektiivista roolia.

Yhdellä 250 aikuisesta voi olla geneettinen mutaatio LDL-kolesterolireseptorille, mikä aiheuttaa heille familiaalisen hyperkolestrolemian. Peritty korkea kolesteroli voi myös sisältää geneettisiä mutaatioita PCSK9-geenissä ja apolipoproteiini B -geenissä.

Kohonnutta kolesterolitasoa hoidetaan tiukalla ruokavaliolla, joka koostuu vähärasvaisista ruoista, transrasvattomista sejö vähän kolesterolia sisältävistä elintarvikkeista. Usein (lähes poikkeuksetta) kolesterolin laskua tehostetaan hypolipideemisillä aineilla, kuten statiineilla, fibraateilla, kolesterolin imeytymisen estäjillä, nikotiinisillä happojohdannaisilla tai sappihappoa sitovilla lääkkeillä.

Hyperkolesterolemian hoidossa on useita kansainvälisiä ohjeita. Ihmiskokeet, joissa käytettiin HMG-CoA-reduktaasin estäjiä, jotka tunnetaan nimellä statiinit, ovat toistuvasti vahvistaneet, että lipoproteiinien kuljetusmallien muuttaminen epäterveellisistä terveellisempiin kuvioihin alentaa merkittävästi sydän- ja verisuonitautitapahtumien määrää myös ihmisillä, joiden kolesteroliarvot katsotaan tällä hetkellä alhaisiksi aikuisille.

Tutkimukset ovat osoittaneet, että LDL-kolesterolitasojen alentaminen noin 38,7 mg / dl statiinien avulla voi vähentää sydän- ja verisuonitauteja ja aivohalvausriskiä noin 21%. Tutkimukset ovat myös havainneet, että statiinit vähentävät aterooman etenemistä. Tämän seurauksena ihmiset, joilla on ollut sydän- ja verisuonitauteja, voivat hyötyä statiineista riippumatta heidän kolesterolipitoisuudestaan (kokonaiskolesteroli alle 5,0 mmol / L [193 mg / dl]), ja miehillä, joilla ei ole sydän- ja verisuonitauteja, on hyötyä poikkeuksellisen korkean kolesterolitason alentamisesta (”ensisijainen ennaltaehkäisy”).

Ensisijaista ennaltaehkäisyä naisilla harjoitettiin alun perin vain laajentamalla miehillä tehtyjen tutkimusten tuloksia, koska naisilla yksikään ennen vuotta 2007 toteutetuista suurista statiinitutkimuksista ei osoittanut merkittävää kokonaiskuolleisuuden tai kardiovaskulaaristen päätetapahtumien vähenemistä.

Meta-analyysit ovat osoittaneet merkittävän vähenemisen kaikista syistä ja kardiovaskulaarisesta kuolleisuudesta ilman merkittävää heterogeenisyyttä sukupuolen mukaan. Kansallisen kolesterolikoulutusohjelman vuonna 1987 julkaisema raportti, Aikuisten hoitopaneelit, ehdottaa, että veren kokonaiskolesterolitason tulisi olla: <200 mg / dl normaalia veren kolesterolia, 200–239 mg / dl raja-korkea,> 240 mg / dl korkea kolesteroli.

American Heart Association (AHA) tarjoaa samanlaiset ohjeet veren (paasto) kokonaiskolesterolipitoisuuksista ja sydänsairauksien riskistä: Statiinit alentavat tehokkaasti LDL-kolesterolia ja niitä käytetään laajalti ensisijaiseen ennaltaehkäisyyn ihmisillä, joilla on suuri sydän- ja verisuonitautiriski samoin kuin toissijaisessa ennaltaehkäisyssä niille, joille on kehittynyt sydän- ja verisuonitauti. Nykyisemmät testausmenetelmät määrittävät LDL (”huono”) ja HDL (”hyvä”) kolesterolin erikseen, jolloin kolesterolianalyysi on vivahteikkaampi. Halutun LDL-tason katsotaan olevan alle 130 mg / dl (2,6 mmol / L), vaikka uudempaa ylärajaa 70 mg / dl (1,8 mmol / L) voidaan harkita korkeamman riskin omaavilla henkilöillä joitakin edellä mainituista kokeista. Kokonaiskolesterolin suhde HDL: ään – toinen hyödyllinen mitta – on paljon alle 5: 1.

Keskustelu kolesterolista ja erityisesti pahasta LDL-kolesterolista käy kiivaana. Kaikki eivät suhtaudu luottavaisesti lipidihypoteesin paradigmaan. Epidemiologiset tutkimukset, joita kolesterolihypoteesin tukemiseksi laaditaan, ovat todistusvoimaltaan kovin heppoisia. Virallinen lääke- ja ravitsemustieteellinen linja on selvä: vähemmän kolesterolia ja tyydyttyneitä rasvoja sekä enemmän statiineja. Mitä nuorempana aloitat statiinit, sitä parempi (lääkeyhtiöille). On nimittäin kiusallista tutkimusnäyttöä, jonka mukaan kolesterolin laskeminen lisää sydänkuolleisuutta (Minnesota Heart Study, Framingham Heart Study ja Sydney Heart Study, jotka olivat kontrolloituja satunnaistettuja tutkimuksia).

Palataan rasvateoriaan

Kolesteroliteoria on hallinnut vuosikymmeniä lääkäreiden ja maallikoiden käsityksiä sydän- ja verisuonitautien syistä, mutta on tullut aika hylätä tämä käsitys, kirjoittavat ruotsalaiset tiedemiehet, sisätautiopin professori Lars Werkö, kirurgian professori Tore Schrestén ja elinsiirtokirurgian dosentti Ralf SundBerg.

Sydänkohtaukseen sairastuneiden ja kuolleiden ihmisten kolesterolilukemat ovat usein muita pienempiä. Matala seerumin kolesteroli liittyy suurentuneeseen kuoleman riskiin.

Kiista kolesterolin merkityksestä vauhdittui 1990-luvulla, jolloin monet tutkijat (mm. Ruotsissa sisätautiopin dosentti Uffe Ravnskov) kyseenalaistivat syy-yhteyden korkeiden kolesteroliarvojen ja sydäntautien välillä.

Tämä perustui suureksi osaksi 30 vuotta jatkuneeseen Framinghamin tutkimukseen. Se näet osoitti, ettei kohonnut kolesteroli ole sydäntaudin riskitekijä yli 47-vuotiailla ihmisillä. Asia oli pikemminkin niin päin, että kolesterolin aleneminen lisäsi kuolleisuutta verrattuna niihin, joiden kolesterolipitoisuus suureni.

Sachdevan työryhmä julkaisi tammikuussa 2009 jättitutkimuksen Amerikan Sydänliiton aloitteesta, jossa mitattiin veren kolesteroliarvot lähes 137 000 sydänkohtauksen vuoksi sairaalahoitoa saaneelta potilaalta. Kaikki kolesteroliarvot olivat oletettuja pienempiä, jopa huomattavasti alle amerikkalaisten keskiarvon.

Emeriusprofessorit Matti Järvilehto Oulusta ja Pentti Tuohimaa Tampereelta kritisoivat Medical Hypotheses-lehden artikkelissaan kolesterolihoitoja. Medialle lähettämässään tiedotteessa he esittävät näkemyksensä, joka tukee täysin Erkki Antilan, Pentti Raasteen ja Matti Tolosen vuosia esittämiä näkemyksiä: ravinnon rasvat ja kolesteroli eivät ole valtimotautien syy ja kolesterolin alentaminen lääkkein on enimmäkseen turhaa ja jopa terveydelle haitallista.

Statiinien käyttäjillä D-vitamiinin vajauksen yhteydessä lähes kaikilla esiintyy lihas- ja sidekudoskipuja. Statiinit saattavat lisäksi heikentää D-vitamiinin vaikutusta syrjäyttämällä hoitopitoisuuksilla D-vitamiinin reseptoristaan.

Etusivun uutiseksi päätynyt Oxfordin yliopiston professori Rory Collins myöntää salanneensa tutkimuksissaan statiinien sivuvaikutuksia. Statiineista voi olla vakavaa haittaa sydänlihakselle kirjoittavat japanilaiset sydänlääkärit yhdessä amerikkalaisen kardiologin Peter Langsjoenin kanssa julkaisemassaan artikkelissa.

Vääristeltyjen tutkimusten perusteella miljoonat britit syövät statiineja turhaan. Collins johtaa vuonna 1994 perustettua Cholesterol Treatment Trialists (CTT) Collaborationia, jonka tutkimuksiin mm. Suomen Sydänliiton ylilääkäri Mikko Syvänne on vedonnut statiineja puolustaessaan.

Yli 20 tutkimusta osoittaa, että pisimpään elävät ne ihmiset, joiden veressä on riittävästi kolesterolia. Siis enemmän kuin 5 mmol/l, jota lääkärit pitävät lääkehoidon rajana.

Päivi Tirkkalan väitöskirjassa (2011)osoitettiin, että matalat kolesteroliarvot ovat yhteydessä kuolleisuuteen. Sen sijaan korkeat kolesterolitasot yli 74-vuotiailla eivät lisänneet sairastumisen tai kuoleman riskiä. Lisäksi kolesterolit ovat yhteydessä kognitiivisiin kykyihin. Matalat kolesterolitasot heikentävät muistia ja voivat aiheuttaa dementiaa.

Norjan HUNT2-tutkimuksessa seurattiin yli 50 000 20-74 vuotiasta henkilöä. 1,0 mmol/l kokonaiskolesterolin nousu naisilla vähensi kuolleisuutta 6 %, kun alle 5 mmol/l tasot lisäsivät kuoleman riskiä. Miehillä kuolleisuus oli pienintä, kun kolesteroli oli 5,0-5,9 mmol/l. Naisten kuoleman riski on 28 % pienempi, kun kokonaiskolesteroli on yli 7,0 mmol/l verrattuna arvoon alle 4,9 mmol/l.

Myös Pietarissa ja Honolulussa tehdyissä tutkimuksissa toistuu sama ilmiö: matala kolesteroli korreloi suurentuneen kuolemanriskin kanssa (Shestov ym. 1993, Schatz ym 2001). Kelan autoklinikkatutkimus tukee näitä tutkimuksia: sen mukaan miesten optimaalinen kolesterolitaso on 5-7 mmol/l ja naisilla vastaava suositus on 6-9 mmol/l.

Statiinit nostavat verensokeria ja lisäävät aikuistyypin diabeteksen riskiä keskimäärin 9-13 %, mutta naisilla riski kasvaa lähes 50 %. Suomalaiseen tutkimukseen osallistui 10 149 henkilöä, joilla oli suurentunut diabeteksen riski.

Amit Sachdeva ym. havaitsivat 136 905 potilaan tutkimusaineisossa, että akuutin sydänkohtauksen saaneiden potilaiden kolesteroli oli merkittävästi matalampi kuin samanikäisten terveiden verrokkien (American Heart Journal 2009).

Al-Mallah ym. totesivat, että ”pahan” LDL-kolesterolin pioisuudet olivat tavallista pienempiä ja kuolleisuus kaksin verroin yleisempää matalien LDL-lukemien potilailla (Cardiology Journal 2009). Nämä tutkimukset osoittavat, että seerumin kohonneen kolesterolipitoisuuden ja sydänkuoleman välillä ei vallitse kausaalisuhdetta.


Pohjoismaiden tunnetuin ja vaikutuvaltaisin ravitsemustieteilijä, tanskalainen professori Arne Astrup on muuttanut täysin mielipiteensä rasvoista ja kolesteroliteoriasta. Aikaisemmin hyvin kriittisesti tyydyttyneisiin rasvoihin suhtautunut Astrup kirjoitti vastattain maailman johtavan ravitsemuslääketieteen lehden pääkirjoituksessa, ettei tyydyttyneillä rasvoilla ole syy-yhteyttä sydän- ja verisuonitauteihin.

Astrupin kanssa samoilla linjoilla on myös professori Heikki Karppanen, joka sai melkoisesti kuraa niskaansa puhuessaan kolesteroliteoriaa vastaan.

Arne Astrup oli vannoutunut tyydyttyneiden rasvojen vastustaja ja hiilihydraattien puolestapuhuja. Vuonna 2013 Astrup siirtyi näkemykissään lähelle vähähiilihydraattisen ruokavalion periaatteita.

Hän myönsi julkisesti, ettei rasva ole vaarallista, kuten vuosikymmeniä on opetettu. Samaa sanoi myös professori Jussi Huttunen Suomessa. Nykyisin tiedetään, että elintasosairauksien taustalla ei ole välttämätön rasva, vaan hiilihydraattien liiallinen painottaminen ruokavaliossa.

Ryhmä tutkijoita Oaklandin lasten sairaalasta Kaliforniassa ja Harvardin kansanterveyslaitoksen ravitsemus- ja epidemiologian osastolta Bostonissa, Massachusettsissa, tekivät meta-analyysin prospektiivisista epidemiologisista tutkimuksista tyydyttyneiden rasvahappojen saannin ja sepelvaltimotauti-, aivohalvaus- tai sydän- ja verisuonitauti-riskin assosiaatiosta yleensä.

Prospektiivisissä epidemiologisissa tutkimuksissa seurataan ajan mittaan ryhmää alun perin terveitä ihmisiä, kohorttia, ja koetetaan selvittää, liittyykö taudin esiintyminen tiettyjen tunnistettavien tekijöiden toteutumiseen esim. ruokavalio- ja muut elämäntapatekijät. Meta-analyysissä kerätään ja analysoidaan yhdessä tiettyä aihetta koskevien eri tutkimusten tuloksia yleisen johtopäätöksen tekemiseksi kertyneen tieteellisen tiedon perusteella.

Kaksikymmentäyksi tutkimusta vastasi nykyisen meta-analyysin sisällyttämisperusteita. Yhdessä nämä käsittivät 347 747 henkilöä, joista noin 11 000 sairastui sydän- ja verisuonitauteihin.

Analyysin tulokset eivät osoittaneet merkittävää yhteyttä tyydyttyneiden rasvahappojen suuren saannin ja sepelvaltimotaudin, aivohalvauksen tai sydän- ja verisuonitautien lisääntyneen riskin välillä. Ikä, sukupuoli ja tutkimuksen laatu olivat tekijöitä, jotka otettiin huomioon analyysissä, mutta ne eivät vaikuttaneet tulokseen. Linkki

Prospektiivisten kohorttitutkimusten ja satunnaistettujen kontrolloitujen tutkimusten meta-analyysi tutki rasvahappojen ja sepelvaltimotaudin välistä yhteyttä. Tähän analyysiin tunnistettiin yhteensä 32 prospektiivista kohorttitutkimusta, jotka sisälsivät tietoja ruokavalion rasvahappojen saannista.

Analyysissä tutkittiin 530 525 osallistujaa. Tutkimus käsitti 15 907 sepelvaltimotautitapausta. Tutkimusten kesto oli 5–23 vuotta. Kirjoittajat tutkivat myös 17 havainnointitutkimusta, joissa oli tietoja kiertävästä rasvahappokoostumuksesta (ts. Rasvahapot veressä). Näihin tutkimuksiin osallistui 25721 osallistujaa, joista 5 519 johti sepelvaltimotautiin. Näissä tutkimuksissa seuranta oli 1,3-30,7 vuotta.

Tyydyttyneiden rasvahappojen kokonaissaantiin ei liittynyt sepelvaltimotaudin riskiä (yhdistetty suhteellinen riski 1,02, 95%:n luottamusväli: 0,97-1,07).

Kiertävien tyydyttyneiden rasvahappojen kokonaismäärään ei liittynyt sepelvaltimotaudin riskiä (yhdistetty suhteellinen riski 1,06, 95%: n luottamusväli: 0,86-1,30)

Yksittäisiin kiertäviin rasvahappoihin, kuten palmitiini- ja steariinihappoihin, ei myöskään liittynyt sepelvaltimotaudin riskiä.

Margariinihappoon (maitotuotteissa esiintyvä tyydyttynyt rasvahappo) liittyi merkittävästi pienempi sepelvaltimotaudin riski

Kirjoittajat päättelivät, että olemassaolevat todisteet eivät tue selvästi sydän- ja verisuonitautien suuntaviivoja, jotka suosivat tyydyttyneiden rasvojen korvaamista monityydyttämättömillä rasvoilla.

Toinen 26 kohorttitutkimuksen ameta-analyysi rvioi runsaasti tyydyttyneitä rasvoja sisältävien elintarvikkeiden ja kuolleisuuden riskin välistä yhteyttä. Runsas maidon, juuston, jogurtin ja voin saanti ei lisännyt sydän- ja verisuonitautiekuolleisuuden tai kaikkien syiden aiheuttaman kuolleisuuden riskiä matalaan saantiin verrattuna.

Runsaan maitotuotteiden, maidon ja juuston kokonaissaanti ei liittynyt sydän- ja verisuonikuolleisuuteen.

Vuoden 2010 meta-analyysi kohorttitutkimuksista, joka seurasivat 347747 ihmistä 5-23 vuoden aikana, toimitti seuraavat todisteet tyydyttyneen rasvan ja sepelvaltimotaudin, aivohalvauksen ja sydän- ja verisuonitautien välisestä yhteydestä:

Tyydyttyneiden rasvojen saanti ei liittynyt sepelvaltimotaudin, aivohalvauksen tai sydän- ja verisuonitautien lisääntyneeseen riskiin

Yhdistetyt suhteelliset riskit olivat 1,07 (95%: n luottamusväli: 0,96–1,19, p = 0,22) sepelvaltimotaudissa, 0,81 (95%: n luottamusväli: 0,62–1,05, p = 0,11) aivohalvauksessa ja 1,00 (95%: n luottamusväli: 0,89- 1,11, p = 0,95) sydän- ja verisuonitaudeissa.

Kovarianttien, kuten ikä, sukupuoli ja tutkimuksen laatu, mukauttamisen jälkeen tulokset eivät muuttuneet eikä merkittävää yhteyttä tyydyttyneiden rasvojen ja sydän- ja verisuonitautitapahtumien välillä havaittu.

Ruokavalion tyydyttyneiden rasvojen ja sairauksien esiintyvyyden välillä ei havaittu yhteyttä muiden ravintoaineiden ja kokonaisenergian mukauttamisen jälkeen.

Vuoden 2009 järjestelmällisessä katsauksessa toimitettiin seuraava yhteenveto mahdollisista kohorttitutkimuksista ja satunnaistetuista kontrolloiduista tutkimuksista:

Tyydyttyneiden rasvojen ja sepelvaltimotaudin kohorttitutkimusten meta-analyysin perusteella tyydyttyneiden rasvahappojen saanti ei liittynyt merkittävästi sepelvaltimotauditapahtumiin.

Suhteelliset riskit korkeimmalle verrattuna pienimpään tyydyttyneiden rasvojen saantiluokkaan olivat sepelvaltimotautikuolleisuuden osalta 1,14 (95%: n luottamusväli: 0,82–1,60, p = 0,431) ja 0,93 (95%: n luottamusväli: 0,83–1,05, p = 0,269). sepelvaltimotautitapahtumiin.

Tyydyttyneiden rasvojen ja kuoleman tai sydän- ja verisuonitautitapahtumien välillä ei ollut merkittävää yhteyttä tyydyttyneiden rasvahappojen saannin 5 prosentin kokonaisenergian lisäyksellä.

Ruokavalion rasvan ja sepelvaltimotaudin satunnaistettujen kontrolloitujen tutkimusten meta-analyysin perusteella kuolemaan johtavan sepelvaltimotaudin suhteellista riskiä ei vähennetty rasvamodifioiduilla ruokavalioilla.

Ruotsissa julkaistu väestötutkimus käsitti lähes kaksi miljoonaa miestä ja kaksi miljoonaa naista. Vuosina 1998–2002 määrätyt statiinit eivät olleet yhtään vähentäneet sydänkohtauksia eikä sydänkuolemia.

Tulos on yhdenmukainen Ray et. al. meta-analyysin kanssa (2010): Statiinien käyttö ei lisännyt elinikää satunnaistetuissa primaaripreventiotutkimuksissa, joihin oli osallistunut 65 229 ”suuren riskin” henkilöä. Analyysi käsitti 244 000 henkilövuotta ja 2793 kuolemantapausta.

Kelan ja Tilastokeskuksen tilastot kertovat samaa Suomesta: Statiinien jyrkästi lisääntynyt käyttö ei ole vähentänyt sydänkuolemia.

Amerikkalaiset lääkärit Hayward ja Krumholz kritisoivat LDL-kolesterolin saamaa liaallista huomiota hoidossa. Heidän mielestään pitäisi hoitaa todellisia risikitekijöitä, ei LDL:ää. ”On aika jättää hyvästit tälle vanhalle, perusteettomalle ja harhaanjohtavalle rasvateorialle”, kirjoittivat ruotsalaislääkärit.

Mitään kovin kummoista konsensusta kolesterolin ja tyydyttyneiden rasvojen yhteydestä sydän- ja verisuonitauteihin ei ole. Nykyisestä käytännöstä hyötyvät lääketeollisuus ja siihen sijoittaneet enemmän kuin kolesterolilääkkeitä ahmivat statinistit. Oma kantani on, että ihminen tarvitsee välttämättä kolesterolia ja sen laskeminen johtaa terveyden heikkenemiseen. Uskon, että sydän- ja verisuonitautien todellinen syypää on hyperglykemia ja hyperinsulinemia. Jokainen tehköön omat johtopäätöksensä.

Täydentävää materiaalia

https://cholesterolcode.com/a-simple-guide-to-cholesterol-on-low-carb-part-i/https://cholesterolcode.com/a-simple-guide-to-cholesterol-on-low-carb-part-ii/

https://ruokasota.fi/2020/11/27/90-paivan-ketohaaste-sokeri-ja-rasva-arvot-paranevat-90-paivan-ketogeenisella-dieetilla/

https://ruokasota.fi/2020/11/23/ketogeeninen-ruokavalio-neuromuskulaarisiset-ja-neurodegeneratiiviset-taudit/

https://ruokasota.fi/2020/11/20/ketogeeninen-ruokavalio-ja-epilepsia/

https://ruokasota.fi/2020/11/12/%ce%b2-hydroksibutyraatin-oksidaatio-edistaa-immunometaboliittien-kertymista-aktivoituneisiin-mikroglia-soluihin/

https://ruokasota.fi/2020/11/03/insuliini-ja-terveys-neljas-luku/

https://ruokasota.fi/2020/10/27/insuliini-ja-terveys-kolmas-luku/

https://ruokasota.fi/2020/10/20/insuliini-ja-terveys-hiilihydraatti-insuliinimalli/

https://ruokasota.fi/2020/09/01/ruokasotaa-ja-anarkiaa-osa-3/

https://ruokasota.fi/2020/08/23/mozaffarianin-meta-analyysin-kritiikki/

https://ruokasota.fi/2020/08/12/hammentavia-ruokajuttuja-osa-1/

https://ruokasota.fi/2020/10/11/insuliini-ja-terveys-johdanto/

https://ruokasota.fi/2015/03/26/rasvateoria/

https://en.wikipedia.org/wiki/Cholesterol




Satumainen matka ketogeneesiin

Maailmalta tihkuu päivittäin surullisia uutisia, mutta multippeliskleroottisessa ketokuplassani elämä on mitä se on. Matkustelen vain mieleni miellyttävissä maisemissa ja teen hurjan jännittäviä tutkimusmatkoja ihmisen aineenvaihduntaan. Huhut 2019-nCoV-koronaviruksen ympärillä ovat synkkiä, mutta ei heittäydytä hysteerisiksi ihan vielä. Kompastutaan ketogeeniseen kaninkoloon ja katsotaan mitä toiselta puolelta löytyy. Satumainen matka ketogeneesiin on puolivallaton hyppy vaikean läpi tuntemattomaan.

Ketogeneesi on ihan oma maailmansa, jossa on paljon salaisuuksia ja jänniä juttuja. Lähdetään purkamaan ketogeneesiin liittyviä myyttejä ja ilmiöitä amatöörin innolla, biologin pieteetillä ja rasvalla rietastelevan ketoilijan raivolla.

On turhaa palata eiliseen, koska olin silloin täysin eri ihminen. — Lewis Carroll, Liisa Ihmemaassa

Parin syrjähypyn ja lipsahduksen jälkeen vaaka nauratti minua tuossa eräänä aamuna lukemalla 84,0 kg. Voi vaaka! Joulukuun alusta olen tuon siunatun saksalaisen laitteen mukaan laihtunut kahdeksan kiloa ketogeenisellä ruokavaliolla.

Paino kylläkin sahaa päivän mittaan kilon tuonne ja toisen tänne, se on myönnettävä. Voiko suunta olla tämä, ja jos on, onko suunta oikea ja terveellinen?

Hullua. Maailman murheista huolimatta motivaationi on hyvä. Tunnen yleisen vointini energisemmäksi kuin aiemmin ja ajatukseni toimivat tavallista kirkkaammin. Tämä voi olla merkki aivosolujen degeneraation kiihtymisestä. tai ehkä se kertoo siitä, että olen oikeilla jäljillä.

Kirjoitan tämän, koska uskon rehellisesti, että mainettaan parempi LCHF voi laihduttamisen lisäksi tehdä hyvää terveydelle.

Ehkä tällainen kartta ketogeneesiin voi olla kaikille hyödyksi. Pyydän heti alkuun anteeksi, jos kirjoitus loukkaa jonkun ammattiylpeyttä; me olemme samalla kartalla ja etsimme kaikki vastauksia elämän suuriin kysymyksiin.

Mutta miksi?

Olen puutarhatontun kokoinen keskivartalolihava keski-ikäinen multippeliskleroottisesti suuntautunut elämän utelias vapaamatkustaja.

Takaraivossani kolkuttelee pelko aikuistyypin diabetekseen sairastumisesta. Omaan kaikki diabetekselle altistavat riskitekijät.

Diabeteksen, jos sellaisen sattuisin kiusakseni saamaan, ei kuitenkaan pitäisi olla kroonisesti etenevä loppuelämän sairaus. Voisin ehkä ehkäistä taudin tai vaikuttaa sen etenemiseen elämäntapamuutoksilla. Ketogeeninen ruokavalio on sellainen elämäntapamuutos, joka voi kääntää jo alkaneen diabeteksen suunnan.

Ketogeenisestä ruokavaliosta elää kuitenkin yhä sitkeä myytti, jonka mukaan jumalaton karppaus tarkoittaa lihalla ja rasvalla rietastelua. Karppaajalla on tämän olkiukon mukaan vain yksi suunta: sairaalan letkuihin ja sieltä nopeasti hautausmaan multiin.

Vääräoppiset – kurjat!

Ravintohereetikkoina ketoilijat ovat yhtä turmeltuneita kuin ateistit. Jotkut ovat ateisteja turmeltuneempia, koska pahimmat kaikista vastustavat Jumalan lisäksi yleisiä ravitsemussuosituksia. ”Päät poikki,” huutaisi Punainen Kuningatar.

Kirotun hyvän näköinen burgeri!

”Sinulla on aivot päässäsi ja jalat kengissäsi. Voit ohjata itsesi mihin suuntaan vain haluat. Olet omillasi ja tiedät mitä tiedät. Sinä olet se, joka päättää mihin suuntaan lähdet.” — Dr. Seuss, Oh the Places You’ll Go

Elämä on kuin rikkoutuneella lasilla tanssisi, mutta entä ne rumat tosiasiat?

Ketogeenisessä ruokavaliossa hiilihydraattien lähteet korvataan hyvillä rasvoilla ja vain vähän hiilihydraatteja sisältävillä kasviksilla. Lihan ja muiden proteiinien määrä pidetään 20-25 prosentissa päivittäisestä energiansaannista.

Rasva on tärkein energianlähde ja sen määrä voi olla 65-70 prosenttia päivittäisestä energiansaannista. Hiilihydraattien määrä pidetään matalana: 5-10 prosentissa päivittäisestä energiansaannista.

Kasvisten saanti yleensä lisääntyy merkittävästi. Kuitujen saanti voi ketogeenisellä ruokavaliolla laskea ja siihen kannattaa kiinnittää huomiota.

Voiko vegetaristi tai vegaani ketoilla?

Voi, mutta vegaani ketoilu edellyttää suunnittelua ja vahvan motivaation. LCHF-dieettiä voi noudattaa myös kasvispainotteisena, koska energianlähteenä on pääasiassa hyvät rasvat ja proteiinien saanti pidetään maltillisena.

Vegaanisella LCHF-ruokavaliolla on kuitenkin eräitä sudenkuoppia, joiden kanssa pitää olla tarkkana. Eräs sudenkuoppa on B12-vitamiinin saanti.

Kuitujen saantia voi lisätä jänönratamon kuivatuista siemenistä jauhetulla psylliumilla (ispaghul) ja chia-siemenillä. Kuidut, antioksidantit ja polyfenolit ovat sen verran tärkeitä, että siementen ja täysjyväviljojen maltillinen syöminen silloin tällöin voi ketogeenisellä ruokavaliolla olla perusteltua.

Kuidut hidastavat insuliinivastetta, joten hedelmät tai marjat ovat mehuja parempi vaihtoehto ja yleensäkin ihan hyvä lähde sokereille. Leivät, pasta, riisi ja perunat sisältävät valtavasti energiaa, mutta vain vähän elimistön tarvitsemia ravinteita.

Perunat, pastat, jauhot, leivät, lisätyn sokerin ja riisin voi korvata muiden muassa lantulla, kaalilla, kesäkurpitsalla, vihreillä pavuilla, pinaatilla, kukkakaalilla, parsakaalilla, tomaateilla, paprikoilla jne. Marjoja ja hedelmiä on ehkä suositeltavaa syödä joskus, mutta hyvin rajoitettuja määriä. Jos makeutta kaipaa, silloin stevia-pohjaiset makeutusaineet voivat korvata sokerin ja keinotekoiset makeutusaineet.

Jos tavoitteena on noudattaa kasvispainotteisempaa lähestymistapaa, silloin voin ja muut tyydyttyneet eläinperäiset rasvat voi korvata esimerkiksi oliivi-, pellava- hamppu- tai kookosöljyllä. Vaikeuksia voi tulla riittävän rasvapitoisen ruokavalion laatimisessa, jos juustot ja muut meijerituotteet korvaa muilla tuotteilla.

Joidenkin tutkimusten mukaan kasvispainotteinen vähän hiilihydraatteja ja runsaasti hyviä rasvoja sisältävä ruokavalio on terveyden kannalta ylivoimainen muihin dieetteihin nähden. Näin on tietenkin sanottu lähes jokaisesta ruokavaliosta perinteisestä lautasmallista Itämeren ruokavalioon. Oikein ja väärin voi syödä niin monella tavalla.

Tyydyttyneitä vai tyydyttämättömiä?

Mainettaan paljon huonompia soija-, rypsi- ja auringonkukkaöljyjä tai margariineja ei kuitenkaan suositella, vaikka niiden rasvaprofiili vaikuttaa ravitsemussuositusten perusteella sinänsä hyvältä. Paistettaessa rypsiöljy tuottaa voihin nähden moninkertaisen määrän karsinogeeneiksi luokiteltavia aldehydejä. Margariinit ovat pitkälle prosessoituja rasvoja, joissa rasvojen molekyylirakenne on prosessoitu luonnottomaksi, eikä sellaisten rasvojen pitkäaikaisia terveysvaikutuksia tunne kukaan.

Aldehydit altistavat syövälle ja kasviöljyt ylläpitävät inflammaatiota, joka on useimpien sairauksien riskitekijä. Käytän itse rypsiöljyä majoneesissa, koska se on sopivan neutraali ja mauton öljy, mutta paistamisessa suosin voita.

Oheisella luennolla Nina Teicholz kertoo kaiken oleellisen kasviöljyistä ja margariineista.

Kasvispainotteisella ketogeenisellä ruokavaliolla proteiinien saannistakaan ei tarvitse tinkiä, mutta se edellyttää hieman tarkkaavaisuutta, koska useimmat runsasproteiiniset kasvit sisältävät paljon hiilihydraatteja.

Kardiometaboliset riskitekijät

Kardiovaskulaaristen sairauksien, kuten sydän- ja verisuonitautien, metabolisen oireyhtymän ja tyypin 2 diabeteksen riskitekijöitä ovat muun muassa ikä, sukupuoli, sukuhistoria, korkea verenpaine, sokeriaineenvaihdunnan häiriöt, dyslipidemia, keskivartalolihavuus, insuliiniresistenssi ja elimistön hiljainen tulehdus eli inflammaatio. Tulehdus voidaan selvittää verestä mittaamalla herkän CRP:n pitoisuus.

Riskit assosioituvat vahvasti ylipainoon. Premenopausaalisilla naisilla estrogeeni suojaa kardiovaskulaarisairauksilta mm. pitämällä lipidiprofiilin suotuisana. Estrogeeni vaikuttanee myös endoteelifunktioon ja glukoosiaineenvaihduntaan positiivisesti. Iän myötä miesten ja naisten kardiometabolisten sairauksien riski kasvaa.

Mutta, kuten professori Tim Noakes kertoo, kardiometaboliset sairaudet ovat vain jäävuoren huippu. Todellinen ongelma on se, joka piileskelee pinnan alla ja johon kiinnitetään paljon vähemmän huomiota. Tim Noakes puhuu tietenkin insuliiniresistenssistä, johon kaikki kardiometaboliset sairaudet assosioituvat. Ja todellakin, Yhdysvalloissa on jo yli 30 miljoonaa aikuistyypin diabetesta sairastavaa ja 80 miljoonaa esidiabetesta sairastavaa. Noakesin mukaan amerikkalaisista 40 prosentille kehittyy aikuistyypin diabetes ennen kuolemaa.

Sukurasite, ylipaino, vyötärönympärys ja kehon korkea rasvapitoisuus kasvattavat kardiometabolisten sairauksien riskiä.

Ylipainon lisäksi rasvan jakautuminen ennustaa kardiometabolisten tautien kehittymistä. Keskivartalolle keskittyvä sisäelimiä ympäröivä viskeraalinen läski on huonointa mahdollista rasvaa, sillä se vaikuttaa sisäelinten toimintaan. Hoikankin ihmisen rasvatasapaino voi olla ulkoisesta habituksesta huolimatta aivan päin persettä. Ihmisen ei tarvitse näyttää lihavalta sairastuakseen tyypin 2 diabetekseen.

Tyypin 2 diabetes lisää merkittävästi sepelvaltimotaudin, aivohalvauksen ja perifeerisen valtimotaudin riskiä. Tyypin 2 diabeteksessa veren glukoosipitoisuus on pitkäaikaisesti kohonnut. Lue tarkemmin tästä.

Insuliini

Verensokerin säätely perustuu palautejärjestelmään haiman beetasolujen ja insuliinille herkkien kudosten välillä.

Haiman beetasolujen stimulaatio saa solut vapauttamaan insuliinia, joka lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa.

Heikentynyt insuliiniherkkyys, eli insuliiniresistenssi, aiheuttaa sen, että haiman on eritettävä enemmän insuliinia pitääkseen verensokerin normaalilla tasolla. Kun beetasolut eivät pysty kompensoimaan lisääntynyttä insuliinitarvetta, verensokeri nousee.

Insuliini on anabolinen steroidi. Sen avulla ihminen voi rakentaa lihasmassaa tai läskiä. Insuliini vaikuttaa seuraavasti:

1.

Insuliini tehostaa lipoproteiinilipaasin (LPL) vaikutusta. Lipoproteiinilipaasi on entsyymi, joka hydrolysoimalla hajottaa triglyseridejä, jotta ne voidaan kuljettaa adiposyyttien solukalvon läpi. Triglyseridit ovat molekyylirakenteeltaan niin suuria, että ne on hydrolysoitava vapaiksi rasvahapoiksi ja glyseroliksi, että ne pääsevät kulkemaan rasvasolun läpi. Vapaat rasvahapot voidaan uudelleen esteröidä triglyserideiksi.

Lipoproteiinilipaasi on rasva-aineenvaihduntaan osallistuva erittäin tärkeä entsyymi. Se on kahdesta alayksiköstä muodostuva homodimeeri, johon kuuluu myös glykoproteiiniosa. Lipoproteiinilipaasia esiintyy endoteelisoluissa mm. verisuonten seinämissä. Sen aktivaatio edellyttää koentsyymiksi apolipoproteiini C2:n ja sen lisäksi myös apolipoproteiiniA4 aktivoi entsyymiä. Apolipoproteiinit C1 ja C3 ovat lipoproteiinilipaasin inhibiittoreita.

2.

Solun insuliinireseptoriin kiinnittynyt insuliinimolekyyli tuo GLUT4 -kuljetusproteiinit solukalvolle solun endosomeista. Näiden avulla glukoosi pääsee soluun. Solulimassa glukoosi hajotetaan glykolyysissä kahdeksi pyruvaatiksi. Tämä tuottaa kaksi ATP-molekyyliä energiaa. Pyruvaatit siirtyvät edelleen mitokondrioissa tapahtuvaan sitruunahappokiertoon, jossa niistä saadaan vielä noin30 ATP-molekyylin verran energiaa sekä elektroneja elektroninsiirtoketjuun

3.

Insuliini osallistuu lipogeneesiin, jossa glukoosi syntetisoidaan asetyylikoentsyymi-A:ksi. Se kootaan glyserolin avulla triglyserideiksi. Lipogeneesi on rasvasynteesi, jossa sokereista syntetisoidaan rasvaa ja sen vastareaktio on lipolyysi, jossa rasvat hajotetaan jälleen solujen energiaksi kelpaavaan muotoon.

4.

Insuliini on hormoniherkän lipaasin (HSL) ja rasva-triglyseridilipaasin (ATGL) estäjä (inhibiittori). Nämä ovat kaksi tärkeää triglyseridien hajottamiseen osallistuvaa entsyymiä. Siten insuliini estää varastorasvojen hajottamisen energiaksi kelpaavaan muotoon.

Lipolyysissä triglyseridit hajotetaan vapaiksi rasvahapoiksi (NEFA – Non-Esterified-Fatty-Acid) ja glyseroliksi. Kun rasvahapot on pilkottu, ne pääsevät solukalvon läpi verenkiertoon. Glyseroli kulkeutuu maksaan. Albumiiniin sitoutumalla vapaat rasvahapot pääsevät kulkemaan muualle elimistöön, sydämeen ja luurankolihaksiin. Maksassa vapaista rasvahapoista tuotetaan ketoaineita. Sydänlihas, aivot ja luurankolihakset voivat hyödyntää ketoaineita energian tuotannossa.

Vain veren punasolut tarvitsevat välttämättä glukoosia, koska niiltä puuttuvat mitokondriot. Veren punasolujen tarvitseman glukoosin keho tuottaa muista aineista glukoneogeneesissä. Toisin kuin pitkään on uskoteltu, aivosolut eivät ole glukoosiriippuvaisia; päinvastoin beeta-hydroksibutyraatti on glukoosia parempi energianlähde aivojen soluille.

Insuliini vaikuttaa epäsuorasti malonyyli-koentsyymi-A:han, joka on CPT I:n estäjä. CPT I eli karnitiinipalmityylitransferaasi I on yksi tärkeimmistä mitokondrioentsyymeistä. Sitä tarvitaan rasvahappojen oksidaatioon. Tämän entsyymin puutos aiheuttaa vakavan rasvahappojen oksidaatiohäiriön.

CPT I osallistuu rasvahappojen kuljettamiseen mitokondrioihin, joissa rasvahappojen energia voidaan vapauttaa hapettamalla ja elektroninsiirtoketjussa. karnitiinipalmityylitransferaasi I osallistuu pitkien rasvahappojen beeta-oksidaatioon, jossa rasvahappojen karboksyyliryhmät pilkotaan asetyylikoentsyymi-A:ksi, eli kaikkien energiaravinteiden yhteiseksi välimuodoksi.

Hyvät, pahat lipoproteiinit

Lipoproteiinit ovat partikkeleja, jotka toimivat kuljetusproteiineina kehossa. Ne kuljettavat muun muassa ravinnon rasvoja ruoansulatuskanavasta maksaan sekä kolesterolipartikkeleita kudoksiin steroidihormonisynteesiä varten.

Lipoproteiinipartikkelit luokitellaan koon ja tiheyden mukaan kylomikroneihin, kylomikronijäänteisiin, VLDL-, LDL- ja HDL-partikkeleihin. LDL-partikkelit kuljettavat kolesterolia perifeerisiin kudoksiin.

LDL-kolesterolin kertyminen verisuonten seinämiin ja sen hapettuminen (oksidaatio) vaikuttavat ateroskleroosin kehittymiseen. Tämä on kolesteroliteorian keskeinen ydin.

LDL lisää monosyyttien ja lymfosyyttien kertymistä intimaan. Myös useiden kasvutekijöiden ja sytokiinien tuotanto lisääntyvät. Monosyytit muuttavat intimassa makrofageiksi ja fagosytoivat hapettuneita LDL-partikkeleita, jolloin syntyy vaahtosoluja. Sytokiinit ja kasvutekijät lisäävät edelleen makrofagien siirtymistä intimaan ja aktivoitumista.

Inflammaatiota edistävät proinflammatoriset sytokiinit IL-1 ja TNF-alfa stimuloivat paikallisesti PDGF:n ja FGF:n tuotantoa. PDGF vaikuttaa sileälihassolujen migraatioon verisuonten mediakerroksesta intima-kerrokseen. Myös matriksin metalloproteinaasit osallistuvat sileälihassolujen migraatioon.

Useiden entsyymien ja sytokiinien aktivaatio ja muutokset verisuonen seinämässä johtavat ateroskleroottisen plakin kehittymiseen.

Entä jos kolesteroli on matkustaja, eikä kuljettaja

Kalvolipidit, triglyseridit ja kolesteroli ovat hydrofobisia, joten niiden kuljettaminen verenkierrossa edellyttää erityisiä kuljetusproteiineja, eli lipoproteiineja.

Ruokailun jälkeen rasvat pilkotaan ja pakataan solujen sytosoleissa kylomikroneiksi. Pilkottuja lipidejä kuljettavat kylomikronit ovat lipoproteiinien yksi alaryhmä.

Tutkimusten valossa kuolleisuus kasvaa merkittävästi hyvin korkeilla ja matalilla lipoproteiinitasoilla (U-käyrä). Tämä on aihe, joka on vahvasti dokumentoitu, mutta josta ei paljon puhuta.

Hyvin matalat  kolesteroli- eli lipoproteiinitasot lisäävät kuolleisuutta. Se ei ole ihme, sillä kolesterolin ja rasvan kuljettamiseen osallistuvat lipoproteiinit ovat välttämätön osa elimistön rasva-aineenvaihduntaa. Kolesteroli on useimpien hormonien ja ruoansulatusnesteiden lähtöaine ja mm. hermoratoja suojaavien myeliinikalvojen osa. Neljännes kehon kolesterolista on aivoissa.

Oksidaatiivista stressiä ylläpitää runsaasti hiilihydraatteja sisältävä ravinto. Voisiko oksidatiivinen stressi ja vapaat happiradikaalit vaikuttaa LDL-lipoproteiinien hapettumiseen?

Lipoproteiinien ensisijainen tehtävä on kuljettaa triglyseridejä soluihin, jotka voivat muuttaa triglyseridit energiaksi. Toissijaisesti lipoproteiinit kuljettavat kolesterolia, jota solut tarvitsevat mm. solujen uusiutumisessa ja steroidihormonien synteesissä.

Lipoproteiinit vaihtelevat tiheydeltään sen mukaan millaisia rasvoja tai mitä ne verenkierrossa kuljettavat. Esimerkiksi erittäin matalan tiheyden VLDL-lipoproteiinit kuljettavat elimistön syntetisoimia triglyseridejä. Matalan tiheyden lipoproteiinit (LDL) kuljettavat rasvaa ja kolesterolia kehon perifeerisiin soluihin. Maksa syntetisoi monia lipoproteiineja.
Kun kylomikronit (tai muut lipoproteiinit) kulkevat kudosten läpi, kapillaarien endoteelisolujen luminaalipinnalla lipoproteiinilipaasi hajottaa nämä hiukkaset tryglyseridien vapauttamiseksi.

Tryglyseridit hajoavat rasvahapoiksi ja glyseroliksi ennen soluihin pääsyä ja jäljelle jäävä kolesteroli kulkee jälleen veren kautta maksaan.

Rasvahappojen hajoaminen beetahapetuksella

Solun sytosolissa glyseroli muutetaan glyseraldehydi-3-fosfaatiksi, joka on glykolyysin välituote. Rasvahappojen katabolisen aineenvaihdunnan päävaiheet tapahtuvat mitokondrioissa. Pitkäketjuiset rasvahapot (yli 14 hiiltä) on muutettava rasva-asyyli-CoA:ksi, jotta ne pääsevät kulkemaan mitokondriokalvon läpi.

Rasvahappokatabolismi alkaa solujen sytoplasmassa, kun asyyli-CoA-syntaasi käyttää ATP:n pilkkomisesta saatua energiaa katalysoimaan koentsyymi A:n lisäämistä rasvahappoon. Tuloksena saatu asyyli-CoA läpäisee mitokondriokalvon ja siirtyy beetahapetusprosessiin.

Beetahapettumisreitin päätuotteet ovat asetyyli-CoA (josta sitruunahapposyklissä ”poltetaan” energiaa), NADH ja FADH. Asetyylikoentsyymi-A on kaikille energiaravinteille yhteinen väliaine.

Beetahapetusprosessi tarvitsee seuraavia entsyymejä: asyyli-CoA-dehydrogenaasi, enoyyli-CoA-hydrataasi, 3-hydroksiasyyli-CoA-dehydrogenaasi ja 3-ketoasyyli-CoA-tiolaasi. Kaavio näyttää kuinka rasvahapot muuttuvat asetyyli-CoA: ksi.

Kuvan lähde: Wikipedia

Ravinnosta saadut tai adiposyytteihin varastoidut triglyseridit eivät suoraan ole kardiovaskulaarisairauksien riskitekijä, mutta niiden assosioituminen mm. kylomikronien ja VLDL-jäännöspartikkeleihin voi ennakoida sairastumisen riskiä.    

LCHF ja DB2

LCHF-ruokavalio on mainettaan parempi ja paljon väitettyä terveellisempi. Esimerkiksi monet lääkärit, kuten Jason Fung, Tim Noakes, Stephen Finney, Sten Ekberg, David Unwin, Paul Mason, Sarah Hallberg ja Ted Naiman ovat menestyksellisesti hoitaneet aikuistyypin diabetekseen sairastuneita ketogeenisella ruokavaliolla. Laihtuminen, sokeriaineenvaihdunnan tervehtyminen ja aikuistyypin diabeteksen ehkäiseminen ravintomuutoksilla laskee sydän- ja verisuonitautien riskiä.

Ketogeeninen ruokavalio on ainoa tunnettu hoitokeino eräiden lapsuusajan epilepsioiden oireisiin. Tulokset ketogeenisen dieetin soveltamisesta diabeteksen hoidossa ovat hyvin rohkaisevia ja osoittavat, että tyypin 2 diabeteksen suunta voidaan ruokavalio- ja elämäntapamuutoksella kääntää.

On näyttöä siitä, että ketogeeninen ruokavalio parantaa multippelisklerootikkojen terveydentilaa mm. inflammaatiota vähentämällä. Myös neurodegeneratiivisia sairauksia, kuten Alzheimerin ja Parkinsonin tautia sairastavat saattavat tutkimusten perusteella hyötyä ketogeenisestä ruokavaliosta.

Terveyttä edistäviä vaikutuksia selittävät mm. se, että ketoaineiden vaikutuksesta glutamaatin synteesi GABA:ksi kiihtyy, stressihormoni kortisolin tuotanto vähenee ja vapaiden happiradikaalien ylläpitämä inflammaatio helpottaa. Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia (ketoni).

Ketogeeninen dieetti ei ole uusi ilmiö

Ketogeeninen ruokavalio ei ole muotioikku tai uusi dieetti, vaikka yhä useammat ihmiset laihduttavat ketoilemalla. Ketogeenisen ruokavalion vaikutukset painonhallintaan ja diabetekseen on tunnettu jo pari tuhatta vuotta sitten.

Tohtori Richard Thomas Williamson kirjoitti vuonna 1898 diabeetikoille suunnatusta ruokavaliosta seuraavasti:

”Perunoista tulee luopua ensimmäisenä, sen jälkeen leivästä ja vähitellen kaikista hiilihydraateista.”Diabetes Mellitus and Its Treatment – Richard Thomas Williamson

Jo vuonna 1797 armeijan kirurgi John Rollo julkaisi kirjan, jossa hän kuvasi kuinka diabetesta hoidetaan hiilihydraattien saantia rajoittamalla. Rollon kirjaan viitaten tohtori Williamson kirjoitti:

”Siitä lähtien, kun Rollo julkaisi kirjansa diabeteksen hoidosta 1797 ja painotti kirjassaan hiilihydraattien rajoittamista diabeteksen hoidossa, on ollut selvää, että kaikista diabeteksen hoitoon käytetyistä menetelmistä ruokavalio on tärkein.”

Hiilihydraattien rajoittaminen hoitomuotona on tunnettu paljon kauemmin. Viljojen välttäminen – ​bìgǔ, tunnettiin jo Han-dynastian aikaan yli 2000 vuotta sitten.

Jin-dynastian aikana elänyt oppinut – Ge Hong väitti, että viljoja välttävien (bìgǔ​-ihmisten) keskuudessa ei ole ainuttakaan lihavaa ihmistä.

600-luvulla eräs toinen kiinalainen oppinut kirjoitti, että ennen maanviljelyn kehittymistä eläneet ihmiset olivat terveitä ja pitkäikäisiä, koska he eivät syöneet viljoja ja muita viljeltyjä kasveja.

Mitä ketoosi ketogeenisessä ruokavaliossa tarkoittaa?

Ketoosi arveluttaa monia ja se on helppo sekoittaa myrkylliseen ketoasidoosiin. Joskus täytyy haastaa luutuneet uskomukset, rimpuilla kuplasta ulos ja heittäytyä satumaiselle tutkimusmatkalle. Vain niin voi oppia.

Olemme viimeisen vuosisadan aikana ehdollistaneet itsemme hiilihydraattien orjiksi ja ravinnon sisältävien rasvojen vihollisiksi. Monet elävät vain syödäkseen 3-4 tunnin välein. Ruokaa napostellaan koko ajan ja sitä mietitään paljon enemmän kuin olisi tarpeen.

Hiilihydraattipainotteisella ruokavaliolla verensokerin jatkuvan sahaamisen seurauksena ravintoa on saatava säännöllisesti. Se pitää verensokerin tasaisena. Monille lounaan tai aamiaisen väliin jättäminen voi aiheuttaa itkupotkuraivareita ja vakavia keskittymisvaikeuksia. Insuliinin heittelehtiminen vaikuttaa kortisolin eritykseen ja sitä kautta mielialaan.

Rasvapainotteisella ruokavaliolla solut kuluttavat aterioiden välillä tehokkaasti kehon omia rasvavarastoja. Se pitää energiansaannin koko ajan tasaisena. Yhdellä tai kahdella aterialla ihminen pärjää hyvin, eikä keskittymiskyky laske tai nälkä piinaa muutaman tunnin välein.

Ohjeet, joiden mukaan ihmisen tulisi syödä 3-5 kertaa päivässä ovat vahvasti liioiteltuja maailmassa, jossa lihavien, aikuistyypin diabetesta- ja suolistosairauksia sairastavien jne. määrä kääntyi 1970-luvun lopulla jyrkkään kasvuun. Sydän- ja verisuonitaudit ovat yhä merkittävin ennenaikaisen kuoleman aiheuttaja. Niiden osuus kuolemantapauksista on laskenut, mutta tämä lasku voidaan selittää tupakoinnin vähenemisellä ja lääketieteen kehityksellä.

Monet lihovat ja sairastuvat, vaikka he noudattavat kirjaimellisesti ravitsemus- ja liikuntasuosituksia. On murheellista, että syy lihomisesta, sairastumisesta ja ennenaikaisesta kuolemasta tuomitaan täysin ihmisten omaksi syyksi, eikä myönnetä, että ihmiset myrkyttävät elimistöään nykyisten ravitsemussuositusten vaikutuksesta liiallisella sokerin saannilla ja epäterveellisillä, prosessoiduilla ja epävakailla rasvoilla. Tämä tiedettiin jo 1970-luvulla.

On totta, että ihmiset syövät liikaa ja napostelevat koko ajan, mutta se on seuraus sokeriaineenvaihdunnasta ja mm. greliinin ja leptiinin vaikutuksista nälkään. Tämän ongelman voi korjata ketogeenisellä ruokavaliolla.

Kertaus: Miten ravinto vaikuttaa elimistössä?

Hiilihydraatit, kuten tärkkelykset pilkotaan sokereiksi, proteiinit aminohapoiksi ja ravinnosta saatavat rasvat vapaiksi rasvahapoiksi ja glyseroliksi.

Sokereista glukoosi on rasvan ohella elimistön tärkein polttoaine. Hiilihydraateista saatavat sokerit ovat ravintoaineita, joiden saamiseen kehittyy orjuuttava mielialoihin vaikuttava riippuvuus. Sokeria on saatava tasaisesti läpi vuorokauden, koska sen saannin väheneminen vaikuttaa kortisolin tuotannon kautta stressitasoihin ja mielialaan. Glykogeeneistä virtaava sokeri pitää kehon tyydyttyneenä illasta aamuun.

Glukoosi

Glukoosi imeytyy glut-kuljetusmolekyylien avulla ohutsuolesta verenkiertoon. Veressä haima reagoi verensokerin kohoamiseen ja erittää vereen insuliinia Langerhansin saarekkeiden beetasoluista.

Veressä insuliinimolekyylit etsiytyvät ja kiinnittyvät solujen insuliinireseptoreihin. Se signaloi solulle, että solukalvolle pitää saada solukalvon läpäisevä kanava, että glukoosi pääsee soluun.  Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan kahdeksi pyruvaatiksi, jolloin solu saa kahden ATP-molekyylin verran energiaa.

Tämä ei riitä useimmille soluille, mutta veren punasolut, joilla ei ole mitokondrioita, tyydyttyvät tästä ja glykolyysissä tuotetut pyruvaatit pelkistyvät laktaatiksi. Tämä on anaerobista energiantuotantoa.

Useimmissa soluissa energiantuotanto jatkuu aerobisena energiantuotantona eli soluhengityksenä sitruunahappokierrossa ja elektroninsiirtoketjussa. Pyruvaatit kuljetetaan solun mitokondrioihin, jossa niistä ravistellaan viimeisetkin energianrippeet ulos. Solu saa yhdestä glukoosimolekyylistä kolmisenkymmentä ATP-molekyyliä energiaa ja elektroneja elektroninsiirtoketjuun.

Tämän hitaan oksidaation (palamisen) lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat elimistöstä ihon ja hengityksen kautta.

Fruktoosi

Fruktoosin aineenvaihdunta tapahtuu maksassa. Suurin osa fruktoosista muutetaan glykogeneesissä glykogeeneiksi, eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi.  Glykogeenit muodostavat 20-40 glykogeenin ryppäitä, eli alfaruusukkeita. Maksa voi varastoida arviolta 70 grammaa tai 7 % painostaan sokeria.

Osa maksaan kuljetetusta fruktoosista syntetisoidaan glukoosiksi, joka vapautuu verenkiertoon. Jos veressä on liikaa glukoosia solujen energiantuotantoon ja glykogeeneihin, ylimääräinen glukoosi on pakko varastoida rasvasoluihin, jossa se de novo lipogeneesissä muutetaan triglyserideiksi. Muutama prosentti fruktoosista syntetisoidaan maksassa suoraan rasvaksi. Mitä rasva tekee maksassa. Se rakentaa rasvamaksaa.

Myös lihakset varastoivat sokeria glykogeeneinä. Lihasmassan määrästä riippuen luurankolihasten glykogeeneihin mahtuu 200-500 grammaa sokeria.

Glykogeenien turvin ihminen pärjää 1-2 vuorokautta. Kun verensokeri laskee aterioiden välillä, haima erittää vereen glukagonia. Glukagoni aktivoi glykogeenien purkamisen glukoosimolekyyleiksi, joita vapautuu verenkiertoon ja jälleen insuliinipitoisuus kasvaa. Näin verensokeri pysyy tasaisena myös aterioiden välillä ja yön aikana.  En keskity muiden sokereiden aineenvaihduntaan. Ravintoaineilla on erilaisia tehtäviä, tarkoituksia ja aineenvaihduntapolkuja.

Proteiinejakaan en käy sen tarkemmin läpi. Proteiinit pilkotaan ruoansulatuskanavassa aminohapoiksi, joita elimistö voi käyttää energianlähteenä, mutta tekee niin vain pakotettuna, koska aminohapot ovat arvokkaampia rakennusaineita kuin energiana.

1-2 päivän päästä glykogeenit tyhjenevät ja elimistö jää tyhjän päälle. Vai jääkö?

Kerroin jo, että glukoosi stimuloi insuliinin eritystä. Myös proteiinit ja rasva vaikuttavat insuliinin eritykseen, mutta niiden vaikutus on pieni glukoosiin verrattuna.  Kun vereen ei erity glukoosia glykogeeneistä, veren insuliinipitoisuus laskee ja elimistön on turvauduttava vararavintoon. Ilman insuliinia keho ei varastoi sokereita tai läskiä. Kun veren insuliinipitoisuus laskee, kehon energiavarastojen purkaminen voi alkaa.

Sokeriaineenvaihdunta

Kaloreiden rajoittaminen

Kaloreita rajoittamalla ja hiilihydraatteja sisältävällä ravinnolla solut saattavat turvautua lihasten purkamiseen energian saamiseksi. Kun insuliini estää varastorasvojen purkamisen, kehon on turvauduttava vapaisiin aminohappoihin ja viime kädessä lihasten proteiineihin energiansaannin turvaamiseksi.

Tämä on kiistelty aihe, mutta on tutkimuksia, joiden mukaan kaloreita rajoittavalla ruokavaliolla lihasmassa vähenee suhteessa enemmän ja nopeammin kuin kehon rasvapitoisuus. Vähän kaloreita sisältävällä ruokavaliolla lihaskuntoa on ylläpidettävä kuntoilemalla. Koska kuntoilu kuluttaa enemmän energiaa, se kasvattaa nälkää. Insuliini estää kehoa turvautumasta varastoituun rasvaan energianlähteenä, joten energia on saatava ravinnosta. Seurauksena on fysiologisesti mahdoton tilanne.

Jatkuva nälkä johtuu sokeriaineenvaihdunnan tekohengittämisestä, mikä estää runsaan insuliinipitoisuuden vuoksi rasvavarastojen purkamisen. Se tekee kaloreiden rajoittamisesta hyvin vaikean laihdutusruokavalion.

Laihduttaminen epäonnistuu usein jatkuvan nälän ja energiavajeen aiheuttaman heikotuksen vuoksi. Syy laihduttamisen epäonnistumiseen ei kuitenkaan ole laihduttajan heikkoudessa, vaan liittyy ihmisen aineenvaihduntaan, biologiaan ja kemiaan.

Kaloreiden ja rasvan rajoittaminen ei suojaa insuliiniresistenssilta ja  aikuistyypin diabetekselta.

Kun sokerit loppuvat

Glykogeenien loppuminen aloittaa hormonien ilotulituksen ja varastorasvan vapauttamisen adiposyyteistä. Vereen erittyy lipolyyttisiä hormoneja, kuten glukagonia, adrenaliinia, noradrenaliinia ja kortikotropiinia.  Nämä hormonit käynnistävät lipolyysin, jossa rasvasoluihin triglyserideinä varastoitu energia pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi, joita solut voivat käyttää muutaman aineenvaihduntareaktion jälkeen energiantuotannossa. Selitän tätä prosessia tarkemmin tuonnempana.

Ravinnosta saadut rasvat hajotetaan vapaiksi rasvahapoiksi ja glyseroliksi, jotka kootaan ohutsuolen epiteelisolujen sytosolien miselleissä kylomikroneiksi. Ihania sanoja.

Rasvojen matka ruoansulatuskanavasta elimistöön

Ruoansulatus pilkkoo ravinnon triglyseridit monoglyseridiyksiköiksi lipaasientsyymien avulla. Rasvojen sulattaminen alkaa suussa, jossa lipaasi vaikuttaa niihin. Lipaasit eivät kuitenkaan vaikuta kolesteroliin, joka pysyy ehjänä aina ohutsuoleen ja epiteelisoluihin asti. Mahalaukussa lipaasientsyymit jatkavat lipidien kemiallista hajottamista. Myös ravinnon mekaaninen hajottaminen alkaa vatsalaukussa.

Lipidien imeytyminen tapahtuu ohutsuolessa. Haima erittää ohutsuoleen rasvoja pilkkovia entsyymeitä. Lipaasi aktivoi triglyseridien hydrolyysin, jossa triglyseridit pilkotaan vapaiksi rasvahapoiksi ja glyseroliyksiköiksi. Näin rasvahapot pääsevät kulkemaan ohutsuolesta epiteelisoluihin.

Katabolinen aineenvaihdunta hajottaa suuremmat molekyylit ja anabolinen aineenvaihdunta kokoaa pienemmistä molekyyleistä suurempia rakenteita. Insuliini on anabolinen hormoni.

Rasvojen imeytyminen

Kun triglyseridit on hajotettu yksittäisiksi rasvahapoiksi ja glyseroleiksi, ne aggregoituvat sytosolin rakenteisiin, joita kutsutaan miselleiksi. Rasvahapot ja monoglyseridit poistuvat miselleistä ja diffundoituvat kalvon läpi päästäkseen suoliston epiteelisoluihin.

Ohutsuolen epiteelisolujen sytosolissa rasvahapot ja monoglyseridit kootaan uudestaan triglyserideiksi, jotka pakataan kolesterolin kanssa epiteelisolujen sytosolissa kylomikroneiksi. Ne ovat amfipaattisia, lipidejä verenkierrossa kuljettavia rakenteita. Kylomikronit kulkevat verenkierrosta rasvakudoksiin ja muihin kehon kudoksiin.

Entä stressi, kortisolitasot ja pakene-/taistele-reaktio!

Kun kyse on elämästä ja kuolemasta, keho ei jätä meitä pulaan. Se valmistautuu taistelemaan evoluution varustamin keinoin. Pakene tai taistele -reaktio käynnistyy tarvittaessa hyvin nopeasti.”

Ulkoinen uhka laukaisee stressireaktion, joka tunnetaan pakene-/taistele-reaktiona. Siinä sympaattinen hermosto aktivoituu kohtaamaan ulkoisen uhan. Nykyään sellaisia uhkia on vähemmän, mutta nykyinen kiireinen elämäntapa voi aiheuttaa vastaavan stressireaktion.
Hiilihydraattipainotteisella ruokavaliolla insuliinitasojen runsas vaihtelu lisää stressihormoni kortisolin eritystä ja tämä vaikuttaa mm. mielialaan. Paasto ja ketogeeninen ruokavalio hillitsevät stressiä mm. lisäämällä gamma-aminovoihapon synteesiä.

GABA

Aivojen ja sydänlihaksen solut rakastavat rasvasta saatavaa betahydroksibutyraattia. Eräissä viimeaikaisissa tutkimuksissa tämän on todettu suojaavan aivoja ja sydänterveyttä. Ketoosilla on niin monia suotuisia vaikutuksia, että Yhdysvaltojen armeija tutkii menetelmiä, joilla sotilaat saadaan nopeasti ketoosiin, koska se lisää mm. valppautta ja keskittymiskykyä.

GABA, eli gamma-aminovoihappo, jota keho syntetisoi glutamaatista, on tärkein keskushermoston hermosolujen toimintaa jarruttava inhibiittori ja glutamaatin vastavaikuttaja.

Ketoosissa GABA:n tuotanto kiihtyy.

GABA lisää kasvuhormonin ja prolaktiinin synteesiä. Se parantaa unen laatua, auttaa nukahtamisvaikeuksissa ja vähentää stressiä, ärtyneisyyttä, jännitystä, surullisuutta ja hermostuneisuutta.

Monet rauhoittavat lääkkeet, kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta. Bentsodiatsepiinit ja eräät epilepsialääkkeet voimistavat aivojen ja sisäelinten gamma-aminovoihapon vaikutusta sitoutumalla gamma-aminovoihapporeseptoreihin, mikä saa aikaan keskushermoston toiminnan hidastumisen.

Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön.

Ideaalissa tilanteessa glutamaatin ja GABA:n välillä vallitsee homeostaasi, eli luonnollinen tasapaino. Hektisessä nykymaailmassa elimistön glutamaattipitoisuudet kohoavat herkästi ravinnon ja elintapojen seurauksena, mikä aiheuttaa ahdistusta, jännittyneisyyttä, stressiä, univaikeuksia, masennusta jne.

Glutamaatin ja GABA:n välisen homeostaasin häiriöt assosioituvat moniin sairauksiin ja poikkeamiin, kuten autismi, kaksisuuntainen mielialahäiriö, masennus, skitsofrenia, epilepsia, fibromyalgia, dementia, Lewyn-kappale-tauti, Alzheimerin tauti, tardiivinen dyskinesia (hitaasti kehittyvä liikehäiriö), Huntingtonin tauti, Parkinsonin tauti jne.

Baklofeeni on GABABagonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat.” – Wikipedia

Paniikkihäiriötä sairastavilla GABA:n pitoisuus on terveitä verrokkeja selvästi vähäisempi ja vastaavasti glutamaatin määrä korkeampi. Keskushermoston toimintaan vaikuttavissa sairauksissa ruokavalio, joka lisää GABA:n synteesiä, voi vähentää oireita.

GABA vaikuttaa rentoutumiseen ja rauhoittumiseen. Glutamaatin vaikutuksesta keskushermosto stimuloituu yliaktiiviseen tilaan, mikä selittää sen vastavaikuttajan roolia rauhoittavana välittäjäaineena. Yksi oire hermovälittäjäaine GABA:n puutteesta tai häiriintyneestä toiminnasta on lepovapina.

Paaston ja ketogeenisen ruokavalion vaikutus vireystilaan

Paasto ja ketogeeninen ruokavalio vaikuttavat kortikotropiinin välityksellä sympaattisen hermoston vireystilaan, sillä ketoosissa elimistöön erittyy joitain samoja hormoneja kuin pakene-/taistele-reaktiossa”, jossa ihmisen sympaattinen hermosto vilkastuu ja valmistautuu pakenemaan tai puolustautumaan ulkoista stressitekijää vastaan.

Epilepsiapotilailla tehdyn tutkimuksen mukaan epileptikoiden kognitiiviset kyvyt, keskittyminen ja valppaus parani ketogeenisellä ruokavaliolla. Lue tästä.

Ketoosi johtaa vireystilan paranemiseen hieman samaan tapaan kuin pakene-/taistele-reaktio. Sympaattisen hermoston toiminta vilkastuu kortikotropiinin ja sen indusoimien hormonien vaikutuksesta. Seurauksena on kuitenkin tyyni, hieman euforinen, valveutunut, vahva ja energinen olo. Erona pakene-/taistele-reaktioon on ainakin se, että paasto ja ketogeeninen ruokavalio lisäävät stressihormoni kortisolin ja glutamaatin vaikutuksia hillitsevän GABA:n synteesiä. Tämä laskee stressiä ja rauhoittaa. Lue tästä!

Olen ketoosissa, mutta en laihdu. Miksi?

Jos ketoosin näyttävät mittatikut osoittavat, että olet selvästi ketoosissa, mutta laihtuminen on hidasta tai olematonta, mistä tämä voi johtua?

Tämä johtuu siitä, että keho ei tuhlaa ketoneita virtsaan. Solut polttavat ketonit ja jäänteenä on hiilidioksidia ja vettä.

Mutta, jos ravinto sisältää riittävästi rasvaa tai proteiineja elimistön energiantarpeen tyydyttämiseksi, elimistö käyttää ensin ravinnosta saatavan rasvan/proteiinit ja turvautuu vasta toissijaisesti varastorasvaan. Tällaisessa tilanteessa varastorasvan polttaminen on tehotonta ja ketoneita erittyy enemmän virtsaan. Nyt ketoosi näyttää vahvalta, mutta laihtumisen kannalta se on tehoton.

Ketogeenisen ruokavalion selkein hyöty on siinä, että se poistaa esteen rasvavarastojen hyödyntämiseltä ja toisaalta pitää nälän tehokkaasti loitolla. Elimistön kokonaisenergia tavallisesti laskee ketogeenisellä ruokavaliolla ja siksi keho turvautuu rasvavarastoihin.

Jos ihminen ei herää keskellä yötä syömään pekonia ja voita, rasvavarastoja poltetaan, mutta ajallinen rasvanpolttoikkuna on kaventunut suhteellisen lyhyeksi ja siksi läskin polttaminen on hidasta.  Ketoosissa ihminen ei liho kovin herkästi, koska rasvaa ja sokereita varastoivan insuliinin pitoisuus pysyy jatkuvasti matalampana kuin hiilihydraatteja sisältävällä ravinnolla, mutta, jos rasvaa syö enemmän kuin tarvitsee, laihtuminen ei oikein pääse käynnistymään.

Vastaavasti, kun energia saadaan hiilihydraateista, solut käyttävät ensin ravinnosta saadun glukoosin ja turvautuvat vasta toissijaisesti maksan ja lihasten glykogeeneihin varastoituihin sokereihin. Energiavajeessa turvaudutaan glykogeenien tyhjentymisen jälkeen rasvaan.

The great tragedy of science – the slaying of a beautiful hypothesis by an ugly fact. – Thomas Huxley

Tieteen suurin tragedia on kauniin hypoteesin kumoaminen rumilla tosiasioilla.

Olemme ehdollistuneet makeaan ja herkulliseen hypoteesiin, joka laadittiin 1970-luvun loppupuolella sokeriteollisuuden rahoittamana.  Hypoteesin mukaan ravinnon rasvat ja erityisesti tyydyttyneet rasvat ja kolesteroli ovat syypäitä melkein kaikkiin tunnettuihin sairauksiin.

Koska sokerit ovat elimistön tarvitsemaa hyvää energiaa, niiden välttäminen on suorastaan hullua. Näin me olemme oppineet ja näin useimmat uskovat yhä.

Ruma tosiasia on, että erityisesti nopeat hiilihydraatit altistavat aikuistyypin diabetekselle, sydän- ja verisuonitaudeille, suolistosairauksille ja syöville. Rasvoista on valehdeltu viisi vuosikymmentä ja koko ravitsemusohjeiden perusta on rakennettu sokeri- ja kasviöljyteollisuuden vääristeltyjen tutkimusten varaan. Lue tästä.

Sokeri- ja kasviöljyteollisuuden valheiden seurauksena on aikaansaatu maailmanlaajuinen diabetesepidemia, lihavuusepidemia ja yleisemmin kardiometabolisten sairauksien epidemiat.

Tähän vaikuttaa erityisesti se, että monityydyttämättömät kasvirasvat ovat hyvin epävakaita ja hapettuvat siksi helposti. Ne myös muodostavat kuumennettaessa aldehydejä ja polymeerejä.

Taistelu tyydyttyneitä rasvoja (voi, kookosöljy, tali, laardi, palmuöljy) vastaan alkoi vuonna 1977. Sen seurauksena ylipainon, tyypin 2 diabeteksen ja syöpien esiintyminen kääntyi jyrkkään kasvuun. Sydän- ja veritautikuolemien määrä lisääntyi myös, mutta tupakoinnin väheneminen ja lääketieteen yleinen kehitys on kääntänyt sydän- ja verisuonitaudit lievään laskuun.

Tilastollisesti sydän- ja verisuonitaudit olivat hyvin harvinaisia vielä 1800-luvulla, mutta niiden suunta lähti kasvuun 1910-luvun jälkeen, kun ensimmäisen kasviöljyt tulivat markkinoille ja kasvu kiihtyi sitä mukaa kuin monityydyttämättömillä kasvirasvoilla korvattiin luonnollisia rasvoja.
Statiineja käytetään nykyään valtavasti ja kynnys niiden määräämiseen madaltuu koko ajan. Kysymys on: Miksi haluaisimme laskea kolesterolia statiineilla? Kolesteroli on tärkeässä roolissa useimpien hormonien ja ruoansulatusnesteiden tuotannossa. Ihmiset tarvitsevat kolesterolia. Se ei ole mikään mörkö, vaikka niin uskotellaan.

Paha LDL-kolesteroli nousee laihduttamisen ja liikunnan seurauksena, mutta laskee, kun ihminen syö muutaman päivän hyvin rasvapainotteisesti. Mitä helvetin järkeä siinä on?

Kun syömme runsaasti rasvaa kolmen vuorokauden ajan ennen kolesterolimittausta, LDL laskee. Se kuulostaa järjettömältä, mutta niin kuitenkin kuulemma tapahtuu, koska lipoproteiinit, kuten LDL, ovat varastorasvasta purettujen vapaiden rasvahappojen kuljetusmolekyylejä ja kylomikronit ravinnosta saatujen rasvojen kuljetusmolekyylejä. Logiikka on siinä, että kun keho saa riittävästi rasvaa, veren kylomikronien määrä kasvaa ja vastaavasti muiden lipoproteiinien määrä laskee. En tiedä kuinka totta tällainen väite on.

Sinänsä elimistö syntetisoi itsenäisesti kolesterolia ja LDL kuljettaa kolesterolia soluihin, koska sitä tarvitaan osana steroidihormonien synteesiä. Myös D-vitamiini on osa tätä samaa kolesterolisynteesiin liittyvää aineenvaihduntaketjua. Lipoproteiinien tärkein tehtävä on kuljettaa rasvaa solujen energiantuotantoon ja toissijaisesti viedä kolesterolia soluille, jotka tarvitsevat kolesterolia mm. steroidihormonien synteesiin ja solujen uusiutumiseen.

Rasvojen metaboliaan vaikuttavat useat entsyymit. Hydrolyysin jälkeen rasvahapot imeytyvät ohutsuolen seinämän epiteelisoluihin, jossa rasvahapot pakataan kylomikroneiksi.


Ted Naimanin, Jason Fungin ja Ivor Cumminsin hypoteesi on olennaisilta osiltaan seuraava:


Rasvasolujen täyttyessä ihminen lihoo. Kun rasvasolut ovat täynnä, ne jakautuvat. Kerran syntyneet rasvasolut eivät yleensä häviä eli adiposyyttien määrä ei laihtumisesta huolimatta yleensä laske. Sen sijaan rasvasolujen sisältämä massa kasvaa herkästi insuliinin vaikutuksesta. Rasvasolujen tyhjentäminen varastoenergiasta ja käyttäminen solujen tarvitsemaksi energiaksi ei kuitenkaan ole helppoa.

Jokin estää rasvasolujen tyhjentämisen. Aineenvaihdunta ei turvaudu varastoituun energiaan, jos elimistö saa muuta ravintoa. Eikö tämä ole itsestään selvä asia ja täysin yhdenmukainen perinteisen kaloriteorian kanssa? Periaatteessa joo, kyllä, ehkä ja ehkä ei.

Aineenvaihdunta ei käytä rasvasoluihin varastoituja rasvoja, koska insuliini estää rasvasolujen purkamisen, eli lipolyysin käynnistymisen.

Insuliinia tarvitaan energia-aineenvaihdunnassa glukoosin hyödyntämiseen sekä ylimääräisen energian varastoimiseen maksan ja lihasten glykogeeneihin sekä rasvakudoksen soluihin.

Insuliini säätelee glukoosin ja rasvan aineenvaihduntaa

Mitä enemmän verenkierrossa kiertää insuliinia, sitä vaikeampaa on tyhjentää rasvasoluihin varastoitunutta energiaa.

Ted Naiman: ”You filled up your fat cells, because you suck at burning fat because you eat too much glucose… you’re eating carbs and glucose, you’r not burning fat, it accumulates, you fill up your adipose.”

Glukoosi kohottaa veren insuliinipitoisuutta enemmän kuin proteiinit ja valtavasti enemmän kuin ravinnosta saadut rasvat. Ted Naiman nostaa keskusteluun tärkeän ilmiön, joka tunnetaan nimellä Randle-sykli.

Insuliinista riippumatta glukoosi estää varastoidun rasvan käyttämisen energianlähteenä

Ted Naiman: ”Glucose and fat are oxidized reciprocally, so anytime you’re burning more glucose you’re burning less fat, and more fat you’re burning, less glucose, right?”

Olemme ehdollistaneet itsemme sokeripolttoisiksi biologisiksi koneiksi, mutta se ei tarkoita sitä, etteikö elimistömme osaisi käyttää rasvaa energian lähteenä.

Jos glykogeenejä ei tyhjennä ankaralla liikunnalla, paastolla tai vähän hiilihydraatteja sisältävällä ravinnolla, ne pysyvät niin täysinä, että ravinnosta saaduille ylimääräisille sokereille ei ole muuta paikkaa kuin rasvakudos.

Aineenvaihdunnan kannalta tilanne on ongelmallisempi. Elimistön käyttäessä hiilihydraatteja, se ei käytä rasvoja. Niinpä insuliini varastoi myös ravinnon sisältämiä rasvoja ja estää rasvavarastojen käytön energiaksi.

Elimistö suosii nopeinta ja helpointa energianlähdettä, mikä estää tehokkaan rasvojen polttamisen. Liikunta tehostaa aineenvaihduntaa ja ylläpitää terveyttä, mutta laihduttamisen kannalta liikunta on paljon ruokavaliota merkityksettömämpi tekijä.

Haima vaikuttaisi olevan viimeinen paikka, johon rasvaa kumuloituu. Mutta samalla, kun haima rasvoittuu, haiman insuliinia tuottavien beetasolujen toiminta häiriintyy.

Ongelma on, että insuliinin tuotannon loppumisen seurauksena elimistö tarvitsee lääkeinsuliinia. Se hidastaa entisestään rasvasolujen purkamista ja polttamista energiaksi. Insuliini lihottaa; tämä kerrotaan eräässä käytetyimmistä lääketieteen oppikirjoista, johon useimmat lääketieteen opiskelijat tutustuvat opintojensa yhteydessä.

On monia epäterveellisiä elämäntapoja, jotka pahentavat insuliiniresistenssiä. Näitä ovat mm. tupakointi, riittämätön uni ja huono omega3-omega6 -rasvojen saantisuhde.

Ivor Cumminsin mukaan merkittävin insuliiniresistenssiä pahentava tekijä on fruktoosi, jota saadaan esimerkiksi pöytäsokerista.

Virvoitusjuomat ovat tutkimusten mukaan edelleen ainoa suoraan liikalihavuuteen assosioituva elintarvike. Coca-Cola kieltää tällaiset tutkimukset, koska tietenkään ne eivät voi olla totta. Margo Wootan saattaisi väittää, että lihomisen aiheuttavat virvoitusjuomien kalorit.  Robert Lustig painottaisi, että lihomisen taustalla on fruktoosi ja fruktoosin aineenvaihdunta, jotka myös osallistuvat insuliiniresistenssin kehittymiseen yhdessä seriini-fosforyloivan insuliinireseptori IRS-1 kanssa.  Tuosta voi jokainen sitten valita oman henkilökohtaisen Jeesuksensa.

“​High carbohydrate intake was associated with higher risk of total mortality, whereas total fat and individual types of fat were related to lower total mortality. Total fat and types of fat were not associated with cardiovascular disease, myocardial infarction, or cardiovascular disease mortality, whereas saturated fat had an inverse association with stroke. Global dietary guidelines should be reconsidered in light of these findings.​” – Lancet

Ketogeeninen ruokavalio on tutkimusten valossa järkevin tapa ehkäistä ja hoitaa aikuistyypin diabetesta, kuten seuraavat tutkimukset osoittavat.

Päätän satumaisen tutkimusmatkani tähän. Ohessa on murto-osa tutkimuspapereista, jotka tukevat ketogeenistä ruokavaliota. Ne voivat olla oikeassa tai väärässä tai jotain siltä väliltä.

Tosiasia on kuitenkin, että insuliiniresistenssi ja kardiometaboliset sairaudet ovat lisääntyneet järkyttävän nopeasti ja jokin selitys sille on. Luultavin selitys on, että tavassamme syödä on jotain perustavalla tavalla väärin. En puhu vain suomalaisista tai eurooppalaisista, sillä metabolinen oireyhtymä, ylipaino ja aikuistyypin diabetes ovat maailmanlaajuisia ongelmia.

Pyydän nöyrimmästi anteeksi, jos kirjoitukseen eksyi huolimattomuus- ja/tai asiavirheitä.

Luettavaa tähän artikkeliin liittyen:

The effects of the ketogenic diet on behavior and cognition [Neuroprotective]

Novel ketone diet enhances physical and cognitive performance

Diet-Induced Ketosis Improves Cognitive Performance in Aged Rats

Dietary ketosis enhances memory in mild cognitive impairment

In addition, due to its neuroprotective capacity

Ketogenic diet improves the spatial memory impairment…

A ketogenic amino acid rich diet benefits mitochondrial homeostasis…

The antidepressant properties of the ketogenic diet

The adult KD offspring exhibit reduced susceptibility to anxiety and depression

ketogenic diets reduce hunger and lower food intake

Improvement in age-related cognitive functions and life expectancy by ketogenic diets

Effects of Ketogenic Diets on Cardiovascular Risk Factors: Evidence from Animal and Human Studies

Efficacy of ketogenic diet on body composition during resistance training in trained men: a randomized controlled trial

Beneficial effects of ketogenic diet in obese diabetic subjects.

Ketogenic diet in cancer therapy

The Ketogenic Diet: Uses in Epilepsy and Other Neurologic Illnesses

Ketogenic diet in endocrine disorders: Current perspectives

D-beta-hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease.

D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease.

A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease.

Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet.

Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation

Ketone bodies are protective against oxidative stress in neocortical neurons.

Application of a ketogenic diet in children with autistic behavior: pilot study.

The anti-depressant properties of the ketogenic diet. Biol Psychiatry.

Diet-induced ketosis increases capillary density without altered blood flow in rat brain​              .

Growth of human gastric cancer cells in nude mice is delayed by a ketogenic diet supplemented with omega-3 fatty acids and medium-chain triglycerides

Stroke outcome in the ketogenic state – a systematic review of the animal dat​       a

β-hydroxybutyrate: Much more than a metabolite 

Potential Synergies of β-Hydroxybutyrate and Butyrate on the Modulation of Metabolism, Inflammation, Cognition, and General Health

A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss

Effects of beta-hydroxybutyrate on cognition in memory-impaired adults.

The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism.  

β-Hydroxybutyrate Elicits Favorable Mitochondrial Changes in Skeletal Muscle

Fueling Performance: Ketones Enter the Mix.

D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease

https://peterattiamd.com/how-to-make-a-fat-cell-less-not-thin-the-lessons-of-fat-flux/

https://epublications.uef.fi/pub/urn_nbn_fi_uef-20190622/urn_nbn_fi_uef-20190622.pdf




Rasvateoria

Rasvasota on Suomessa, Ruotsissa ja Yhdysvalloissa sekä monissa muissa länsimaissa 1950-1970 alkanut ja edelleen jatkuva julkinen keskustelu ravintorasvojen asemasta ja terveysvaikutuksista.

Keskustelun ytimessä on kiista siitä, aiheuttavatko tyydyttyneet eläinperäiset (ns. kovat rasvat) ja kolesteroli sydän- ja verisuonitauteja. Suomessa keskustelu alkoi Pohjois-Karjala-projektin seurauksena 1970-luvulla.

Keskustelu on tärkeää, sillä sydän- ja verisuonitaudit tappavat eniten ihmisiä maailmassa. Vuosittain Yhdysvalloissa 610 00 ihmistä kuolee sydäntauteihin ja 735 000 ihmistä saa sydän- tai aivoinfarktin. Australiassa yksi ihminen kuolee sydän- ja verisuonitautien vuoksi keskimäärin kahdentoista minuutin välein.

Diabetes lisää merkittävästi sydäntautien riskiä ja 65 % – 75 % diabeetikoista kuolee sydän- ja verisuonitauteihin. Diabetes on lisääntynyt huimalla vauhdilla 1980-luvun jälkeen.

Onngelmalliseksi ilmiön tekee se, että kolesterolilääkitys, eli sydäntautien ehkäisyyn käytettävät statiinit lisäävät aikuistyypin diabeteksen riskiä jopa 46 %.

Diabeteksessa sydäntautien riskiä kasvattavat mm. verenpaine, veren korkeat triglyseridi- ja kolesterolitasot, verensokerit (hyperglykemia) ja ylipaino. Diabeetikon riski saada sydänkohtaus tai sairastua sydän- ja verisuonitautiin on 2-4 kertainen muuhun väestöön nähden.Kuolemansyytilastoja USA:sta.

heart-disease-stats

The devil has put a penalty on all things we enjoy in life. Either we suffer in health or we suffer in soul or we get fat.

Albert Einstein

Kohti vähärasvaisia ravintosuosituksia
”Vaikka kaikki asiantuntijat olisivat yksimielisiä, he voivat hyvinkin olla väärässä.” B. Russell

Johtava kirurgi C. Everett Koop antoi 1988 lausunnon, joka vaikutti merkittävällä tavalla tulevien sukupolvien ravintosuosituksiin. Lausunnossaan hän totesi, että rasvaiset ruoat aiheuttavat sydän- ja verisuonitautien (CHD/CVD) lisäksi useita muita vakavia terveysongelmia ja siksi rasvaiset ruoat ovat yhtä epäterveellisiä, kuin tupakka. Suurin osa meistä luottaa yhä tähän teoriaan, koska meidät ehdollistettiin rasvakammoon tehokkaalla ja periksi antamattomalla valistuksella, joka alkoi jo 1970-luvulla Pohjois-Karjala-projektin myötä.
[socialpoll id=”2260878″]
C. Everett Koop oli väärässä, mutta miksi?
C. Everett Koop luotti dogmaattisesti edeltäneisiin tutkimuksiin, mikä johti hänet vääriin johtopäätöksiin. Virhe tutkimuksessa tai tutkimuksen virheellinen analyysi kertautuu kaikissa niissä tutkimuksissa, jotka asettavat virheellisen tutkimuksen uuden tutkimuksen lähtökohdaksi. Kuvio on yksinkertainen: Tutkimukseen eksyy virhe, sitä vääristellään, osa jätetään julkaisematta tai sitä tulkitaan väärin. Seuraavaksi uusi ryhmä tekee omaa tutkimustaan ja he käyttävät lähdeaineistona virheellistä tutkimusta. Kolmas tutkija uskoo löytäneensä tutkittavaan ilmiöön oikean selityksen, mutta korjaakin hypoteesiaan, koska luottaa kahden edellisen tutkimuksen tuloksiin enemmän kuin omaan tutkimukseensa.
Analogiana: Tutkija havaitsee, että kaikki pallot ovat palloja, mutta tutkimuspapereihin eksyy virhe, jonka mukaan jokin pallo voi olla kuutio; seuraavassa tutkimuksessa tämä fakta esitetään niin, että useimmat pallot ovat palloja, mutta on kasvavaa näyttöä siitä, että jotkin pallot voivat olla kuutioita. Kolmannessa tutkimuksessa raja pallon ja kuution välillä hämärtyy entisestään: sen mukaan suurin osa palloista on palloja tai kuutioita, mutta eron tekeminen nykytietämyksellä on mahdotonta. Ymmärrätte pointin. Hyvin pieni inhimillinen virhe tai väärintulkinta voi kertautua tutkimuksissa yhä uudestaan ja johtaa virheellisen tiedon leviämiseen tutkimuksesta toiseen. Virheellisestä teoriasta voi tulla jopa paradigma, eli vallitseva tieteellinen totuus. Näin vaikuttaa käyneen tyydyttyneiden rasvojen ja kolesterolin kohdalla. Lipid hypothesis on vahva, hyvin postuloitu ja vakuuttava paradigma, jota monikaan ei uskalla haastaa.
Palataan C. Everett Koopin lausuntoon. Hän perusti näkemyksensä arvostettuun tutkimukseen, joka tunnetaan nimellä: Seitsemän maan tutkimus. Yksi tutkimukseen osallistuneista maista oli Suomi. Tutkimuksen toteutti arvostettu yhdysvaltalainen fysiologi ja ravitsemustieteilijä Ancel Keys (s.1904, k.2004), jonka kiinnostus sydäntauteihin heräsi maailmansotien jälkeisestä huomiosta: Yhdysvalloissa menestyneet ja hyvin ravitut (ylipainoiset) yrittäjät ja johtajat sairastuivat usein sydän- ja verisuonitauteihin, kun puolestaan sodasta toipuvassa ja ruokapulasta kärsivässä Euroopassa sydäntaudit olivat harvinaisia. Tämän havainnon perusteella Ancel Keys postuloi hypoteesin, jonka mukaan syödyn rasvan määrä korreloi sydän- ja verisuonitautien kanssa. Keys esitteli hypoteesin WHO:n asiantuntijakokouksessa Genovassa 1955, jossa sitä kritisoitiin ankarasti. Keys ei kuitenkaan lannistunut kritiikistä, vaan aloitti seitsemän maan tutkimuksena tunnetun projektin.
Keys paneutui intohimoisen tutkijan tarmolla aiheeseen. Hän havaitsi, että koska Etelä-Italiassa eli väestönmäärään suhteutettuna eniten satavuotiaita, täytyi Välimeren vähän eläinrasvaa sisältävällä ruokavaliolla olla kausaalinen vaikutus sydänterveyteen. Tästä hän päätteli, että juuri eläinperäiset rasvat aiheuttavat sydän- ja verisuonitauteja. Palaan Ancel Keysiin hieman myöhemmin. Tarkastelen ensin häntä edeltänyttä ravitsemustieteen historiaa sydäntautien tutkimuksen osalta.

Sydäntautien tutkimuksen historia

Rudolf Virchow (1821-1902) Rudolf_Virchow_NLM3

Rudolf Virchow oli saksalainen patologi, lääketieteilijä ja biologi ja häntä pidetään yleisesti patologian isänä. Virchow tunnisti mm. leukemian ja selvitti solunjakautumisen (omnis cellula e cellula), jonka mukaan jokainen solu syntyy samanlaisesta solusta. Patologina Rudolf Virchow kuvasi lipidien kasaantumisen valtimoiden seinämiin.

Nikolai Anitschkov (1885-1964) – The Response-to-Injury Rabbit Modelindex
Nikolai Anitschkov oli huomattava venäläistaustainen patologi ja tutkija, joka esitti teorian kolesterolin yhteydestä ateroskleroosin patogeneesiin vuonna 1958 (Annals of Internal Medicine). Tätä kutsutaan joskus myös ”kolesterolilla ruokitun jäniksen malliksi” (cholesterol-fed rabbit model). William Dock vertasi Anitschkovin merkitystä tutkijana Robert Kochiin. joka löysi tuberkkelibakteerin.
 ♥
Vuonna 1913 Nikolai Anitschkov osoitti, että kolesterolilla ruokituille jäniksille kehittyi valtimoihin ateroskleroosia muistuttavia leesioita ja vuonna 1951 tunnustettiin, että vaikka aterooman, eli valtimorasvoittuman syy oli edelleen tuntematon, rasvan kasaantuminen verisuonten ja valtimoiden seinämiin ja seinämien sisäkerroksiin (intima) oli ateroskleroosin patogeneesin olennainen faktori. Anitschkov ei pitänyt kolesterolia ateroskleroosin syynä, mutta välttämättömänä vaikuttajana taudin etiologiassa. Toisin kuin usein luullaan, Anitschkov ei koskaan väittänyt, että ravinnon sisältämä kolesteroli aiheuttaa ateroskleroosia. Sen sijaan hän kirjoitti:
”In human atherosclerosis the conditions are different. It is quite certain that such large quantities of cholesterin are not ingested with the ordinary food. In human patients we have probably to deal with a primary disturbance of the cholesterin metabolism, which may lead to atherosclerosis even if the hypercholesterinemia is less pronounced, provided only that it is of long duration and associated with other injurious factors.”
Kolesteroliteorian puolesta puhui Steinberg, joka on osoittanut, että veren kolesterolitasoa lisäämällä ateroskleroosi voidaan tuottaa paviaaneille, kissoille, kanoille, simpansseille, koirille, vuohille, marsuille, hamstereille, apinoille, hiirille, papukaijoille, sioille, kyyhkyille, jäniksille ja rotille. Entä mitä tämä todistaa? Se todistaa vain sen itsestäään selvän tosiasian, että minkä tahansa substanssin määrällisesti riittävä injektointi verisuoneen voi aiheuttaa vakavien tervesongelmien ohella kuoleman.
Yhdysvalloissa 1950-luvulla sydäntautikuolemat olivat yleistyneet voimakkaasti vaurastuneen keskiluokan keskuudessa ja syytä etsittiin mm. sokerista ja rasvasta. Lopulta voimakkaan lobbauksen seurauksena Ancel Keysin edustama tyydyttyneiden rasvojen vastainen linja hyväksyttiin ja yleisiin ravintosuosituksiin se hyväksyttiin 1970-luvulla. Vuonna 1984 kolesteroli nimettiin Yhdysvalloissa syylliseksi sydänsairauksiin.

Anitschkovin varhaisten ideoiden mukaan valtimoita kovettava arterioskleroosi, jonka spesifinen muoto ateroskleroosi on, oli seurausta verisuonten vahingoittumisesta. Vahingoittuminen saattoi johtua fyysisestä vammasta tai toksisesta myrkytystilasta; vamma saattoi Anitschkovin mukaan myös olla hermoradoissa. Tämän hypoteesin perusteella toteutettiin useita eläinkokeita, joissa koe-eläinten:

  • Verisuonia vahingoitettiin mm. suonia solmimalla, puristamalla, vetämällä ja leikkaamalla sekä polttamalla kuumalla johdolla sekä hopeanitraatilla.
  • Verenpaine kohotettiin keinotekoisesti mm. ahtauttamalla aorttaa, jolloin verenvirtaus aortan läpi heikkeni tai munuaisia vahingoittamalla ja roikottamalla jäniksiä jaloista.
  • Hermoja vahingoitettiin ja niitä ärsytettiin erilaisilla ärsykkeillä.
  • Jäniksille injektoitiin adrenaliinia.
  • Jäniksille injektoitiin erilaisia myrkyllisiä aineita, kuten raskasmetalleja, ergosteroleita, erilaisia suoloja, formaliinia, nikotiinia, kofeiinia, barium kloridia jne.
  • Koe-eläimille injektoitiin erilaisia bakteerikantoja ja näiden myrkyllisiä sivutuotteita.

Kokeiden seurauksena verisuonet vahingoittuivat ja kovenivat, mikä osoittaa, että valtimoiden muutosten aiheuttajina vammat ovat varmasti totta. Mikään kokeista ei kuitenkaan tuottanut ihmisellä esiintyvää ateroskleroosia muistuttavia oireita. Arterioskleroosi määrittelee verisuonten yleistä rappeutumista ja ateroskleroosi on yksi sen spesifimpi muoto. Siinä plakkiutuneet rasvatäytteiset valkosolut, kolesteroli, rasvahapot, kalsium ja erilaiset verisuoniin kertyvät jätökset (atheroma) kerääntyvät verisuonen seinämän osaan (intima), joka on endoteelin takana. Endoteeli on yksikerroksinen epiteeli, joka verhoaa sydämessä, veri- ja imusuonissa niiden sisäpintaa ja koostuu endoteelisoluista. Kuva: verisuonen rakenne.

Anatomy_artery

Määritellään artikkelissa esiintyviä käsitteitä

Kolestroliteoria (lipid hypothesis): Kolesteroliteoria viittaa lipidien (rasvojen, eli triglyseridien) ja kolesterolin oletettuun sydän- ja verisuonitaudeille altistavaan vaikutukseen verenkierrossa. Sitä kutsutaan myös nimellä rasva-kolesteroliteoria. Virallisen määritelmän mukaan plasman rasvoja vähentämällä hyperlipidemiaa sairastavien potilaiden sydän- ja verisuonitautien riski pienenee. Toinen määritelmä on, että veren kolesterolitasojen alentaminen vähentää merkittävästi sydän- ja verisuonitautien riskiä. Hypoteesin taustalla on ajatus veren kolesterolipitoisuuden ja valtimonkovettumataudin synnyn syy-yhteydestä, alkaen Rudolf Virchovin kuvauksesta valtimoplakin kolesterolikiteistä (1865). Nikolai Anitschkovin jänis-kolesteroli-kokeisiin Pietarissa (1913). Anitschkov toisti kokeet muilla eläimillä, lihansyöjillä, mutta hän ei saanut samoja tuloksia. Valtimot eivät jäykistyneet, kovettuneet eivätkä ahtautuneet.Usein kolesteroliteoriasta puhuttaessa viitataan myös ruokavalio-sydän hypoteesiin, jolla on hieman eri merkitys kuin kolesteroliteorialla. Ruokavalio-sydän hypoteesi perustuu kahteen periaatteeseen: 1) ravinnosta saatu tyydyttynyt rasva ja kolesteroli lisäävät plasman rasva- ja kolesterolitasoja, 2) ja altistaa siksi sydän ja verisuonitaudeille.

Aterooma: Valtimonrasvoittuma. Aterooma on ateroskleroosille ominainen suuren tai keskisuuren valtimon sisäkalvon pullistuma, jonka syynä on rasva-aineiden, erityisesti kolsesterolin kertyminen suonenseinämään.

Ateroskleroosi, eli valtimonrasvoittumatauti on verenkiertoelimistön sairaus. Sairaudelle on ominaista kolesterolin kertyminen valtimoiden seinämiin, paikallisten kohoumien (ateroomaplakkien) muodostuminen sekä valtimon ontelon kaventuminen. Sen kliinisesti merkittävimmät ilmenemismuodot ovat sepelvaltimotauti sekä aivoverenkierron sairaudet, jotka taas voivat johtaa akuutteihin komplikaatioihin, sydäninfarktiin tai aivohalvaukseen. Ateroskleroosi aiheuttaa myös perifeeristä valtimotautia. LDL-lipoproteiinit kuljettavat kolesterolia soluillerakennusaineiksi. Tämän seurauksena verisuonten endoteelin alla olevaan intimaan kertyy vähitellen LDL-hiukkasia. Solujen muokkaustoiminta muuttaa ne suuriksi rasvapisaroiksi. Paikalle tulevat makrofagit fagosytoivat pisarat sisäänsä ja makrofagin solulima täyttyy LDL:n kolesterolista. Makrofagi muuttuu vaahtosoluksi, joiden kertyminen aiheuttaa verisuonten seinämään kellertäviä raitoja eli rasvajuosteita. Ne voivat kehittyä kohoumiksi eli plakeiksi. Veren suurentunut LDL-pitoisuus edistää rasvajuosteen kehittymistä plakiksi. Plakkien olemassaolo on tunnusomaista ateroskleroosille, joka voi ajan kuluessa johtaa esimerkiksi sepelvaltimoissa verenvirtausta ja sydänlihaksen hapensaantia heikentävään suonen seinämien paksuuntumiseen. Seurauksena on sepelvaltimotauti. Diabetekseen kuuluva hyperglykemia edistää ateroskleroosin kehittymistä. Valtimonkovettumatautia voi olla missä tahansa valtimoissa, mutta erityisen hankalaa se on aivo- ja sepelvaltimoissa, joihin ei ole korvaavia reittejä hapen tuomiseksi. APO A-1 Milano -proteiinin on havaittu ehkäisevän valtimonkovettumistautialähde?. Tulehduksella on suuri merkitys valtimonkovettumataudin kehityksessä ja on ilmeistä, että bakteerit osallistuvat tulehduksen syntyyn. Ateroomaplakissa vallitsee krooninen tulehdus, joka vaikuttaa aterooman kasvumekanismeissa ja repeämisessä. Repeämälle alttiissa plakeissa on ohut sidekudoskatto ja usein paljon tulehdussoluja, jotka erittävät sidekudoskattoa heikentäviä matriksin metalloproteinaaseja (MMP). Valtimonkovettumatautiin liittyvistä bakteereista tunnetuimpia ovat keuhkoklamydia ja kariesia aiheuttavat bakteerit. Ihmisen elinaikanaan sairastamien infektioiden kokonaismäärä lisää valtimonkovettumataudin riskiä. Valtimon seinämän tulehdus ja mahdollisesti myös bakteeri-infektiot ovat yhteydessä valtimonkovettumataudin kehitykseen.

Lähde: Wikipedia

Kolesteroli ja statiinit: kolesteroliteorian kritiikki

Kolesteroliteoria on hallinnut vuosikymmeniä lääkäreiden ja maallikoiden käsityksiä sydän-  ja verisuonitautien syistä, mutta on tullut aika hylätä tämä käsitys, kirjoittavat ruotsalaiset tiedemiehet, sisätautiopin professori Lars Werkö, kirurgian professori Tore Schrestén ja elinsiirtokirurgian dosentti Ralf SundBerg.

Sydänkohtaukseen sairastuneiden ja kuolleiden ihmisten kolesterolilukemat ovat usein muita pienempiä. Matala seerumin kolesteroli liittyy suurentuneeseen kuoleman riskiin.

Kiista kolesterolin merkityksestä vauhdittui 1990-luvulla, jolloin monet tutkijat (mm. Ruotsissa sisätautiopin dosentti Uffe Ravnskov) kyseenalaistivat syy-yhteyden korkeiden kolesteroliarvojen ja sydäntautien välillä. Tämä perustui suureksi osaksi 30 vuotta jatkuneeseen Framinghamin tutkimukseen. Se näet osoitti, ettei kohonnut kolesteroli ole sydäntaudin riskitekijä yli 47-vuotiailla ihmisillä. Asia oli pikemminkin niin päin, että kolesterolin aleneminen lisäsi kuolleisuutta verrattuna niihin, joiden kolesterolipitoisuus suureni. Lähde: Tohtori Tolonen

Sachdevan työryhmä julkaisi tammikuussa 2009 jättitutkimuksen Amerikan Sydänliiton aloitteesta, jossa mitattiin veren kolesteroliarvot lähes 137 000 sydänkohtauksen vuoksi sairaalahoitoa saaneelta potilaalta. Kaikki kolesteroliarvot olivat oletettuja pienempiä, jopa huomattavasti alle amerikkalaisten keskiarvon.

Emeriusprofessorit Matti Järvilehto Oulusta ja Pentti Tuohimaa Tampereelta kritisoivat Medical Hypotheses-lehden artikkelissaan kolesterolihoitoja. Medialle lähettämässään tiedotteessa he esittävät näkemyksensä, joka tukee täysin Erkki Antilan, Pentti Raasteen ja Matti Tolosen vuosia esittämiä näkemyksiä: ravinnon rasvat ja kolesteroli eivät ole valtimotautien syy ja kolesterolin alentaminen lääkkein on enimmäkseen turhaa ja terveydelle haitallista.

Statiinien käyttäjillä D-vitamiinin vajauksen yhteydessä lähes kaikilla esiintyy lihas- ja sidekudoskipuja. Statiinit saattavat lisäksi heikentää D-vitamiinin vaikutusta syrjäyttämällä hoitopitoisuuksilla D-vitamiinin reseptoristaan.

statin_scamEtusivun uutiseksi päätynyt Oxfordin yliopiston professori Rory Collins myöntää salanneensa tutkimuksissaan statiinien sivuvaikutuksia. Statiineista voi olla vakavaa haittaa sydänlihakselle kirjoittavat japanilaiset sydänlääkärit yhdessä amerikkalaisen kardiologin Peter Langsjoenin kanssa julkaisemassaan artikkelissa. Vääristeltyjen tutkimusten perusteella miljoonat britit syövät statiineja turhaan. Collins johtaa vuonna 1994 perustettua Cholesterol Treatment Trialists (CTT) Collaborationia, jonka tutkimuksiin mm. Suomen Sydänliiton ylilääkäri Mkko Syvänne on vedonnut statiineja puolustaessaan.

Yli 20 tutkimusta osoittaa, että pisimpään elävät ne ihmiset, joiden veressä on riittävästi kolesterolia. Siis enemmän kuin 5 mmol/l, jota lääkärit pitävät lääkehoidon rajana. Päivi Tirkkalan väitöskirjassa (2011)osoitettiin, että matalat kolesteroliarvot ovat yhteydessä kuolleisuuteen. Sen sijaan korkeat kolesterolitasot yli 74-vuotiailla eivät lisänneet sairastumisen tai kuoleman riskiä. Lisäksi kolesterolit ovat yhteydessä kognitiivisiin kykyihin. Matalat kolesterolitasot heikentävät muistia ja voivat aiheuttaa dementiaa. Norjan HUNT2-tutkimuksessa seurattiin yli 50 000 20-74 vuotiasta henkilöä. 1,0 mmol/l kokonaiskolesterolin nousu naisilla vähensi kuolleisuutta 6 %, kun alle 5 mmol/l tasot lisäsivät kuoleman riskiä. Miehillä kuolleisuus oli pienintä, kun kolesteroli oli 5,0-5,9 mmol/l. Naisten kuoleman riski on 28 % pienempi, kun kokonaiskolesteroli on yli 7,0 mmol/l verrattuna arvoon alle 4,9 mmol/l. Myös Pietarissa ja Honolulussa tehdyissä tutkimuksissa toistuu sama ilmiö: matala kolesteroli korreloi suurentuneen kuolemanriskin kanssa (Shestov ym. 1993, Schatz ym 2001). Myös Kelan autoklinikkatutkimus tukee näitä tutkimuksia: sen mukaan miesten optimaalinen kolesterolitaso on 5-7 mmol/l ja naisilla vastaava suositus on 6-9 mmol/l.

Statiinit nostavat verensokeria ja lisäävät aikuistyypin diabeteksen riskiä keskimäärin 9-13 %, mutta naisilla riski kasvaa lähes 50 %. Suomalaiseen tutkimukseen osallistui 10 149 henkilöä, joilla oli suurentunut diabeteksen riski.

Rasvateoria on itsessään ristiriitainen, eikä selitä loogisesti ateroskleroosin kehittymistä. Veren korkea kolesteroli ei selitä plakin syntymistä syvälle verisuonen seinämään. Tämä on selitettävissä loogisesti vain verisuonen seinämää ravitsevien suonten (vasa vasorum) toiminnan perusteella. Viime vuonna tekijät julkaisivat teoriansa ravitsevien suonten toiminnallisesta happivajauksesta ateroskleroosin syynä. Näiden pienten päätevaltimoiden vaurio aiheuttaa makromolekyylien (kolesterolipartikkeleiden, mikrobien jne) vuotamisen ja kerääntymisen valtimon seinään. Kolesteroli ei siis ole syy ateroskleroosiin, vaan sen kertyminen on seurausta vasa vasorumien pintakalvon happipuutoksen aiheuttamasta vauriosta. Lähde: Tohtori Tolonen

Sivuhuomautus: K-vitamiinit ja kalsium

K-vitamiinista riippuvaiset proteiinit suojelevat soluja, siivoavat kuolleiden solujen jäännöksiä verestä ja ehkäisevät pehmytkudosten kalkkeutumista. Kun elimistö saa K-vitamiineja riittämättömästi, niistä riippuvaiset proteiinit menettävät toimintakykynsä ja tarkoituksensa, jolloin niistä tulee verenkierron jäteainesta. Näyttää siltä, että K2-vitamiini, jota saadaan mm. eläinrasvoista ja fermentoiduista ruoista, on paljon tärkeämpi tekijä tässä yhtälössä kuin K1-vitamiini, jota saadaan mm. vihreistä kasviksista. Tällä on merkitystä erityisesti miljoonille diabeetikoille, joilla verisuonten kalkkeutuminen lisää sydän- ja verisuonitautien, sydänkohtausten ja pienten verisuonten tukkeutumisen aiheuttamien kuolioiden riskiä. Verisuonille aiheutetut vammat aiheuttavat paikallisen ”korjausprosessin”, jossa solut kerääntyvät vahingoittuneen verisuonen osan ympärille ja siten aiheuttavat suonenseinämän paksuuntumisen. Adrenaliini-injektiot tuottivat mielenkiintoisia tuloksia jäniksillä: ne aiheuttivat solujen nekroosin (kuoleman) ja lisäsivät kalkkeutumista suonessa. Vastaavia oireita esiintyy ihmisillä diabeteksen, munuaistautien ja ikääntymisen seurauksena. K-vitamiinin puutoksen oireet, kuten kalkkeutuminen jäykistyttävät valtimoita ja vaikuttavat sydämen toimintaan. Eräs merkittävä vaikuttaja tässä yhtälössä on K2 -vitamiini, joka puhdistaa verta.

In the 1960s, you could eat anything you wanted, and of course, people were smoking cigarettes and all kinds of things, and there was no talk about fat and anything like that, and butter and cream were rife. Those were lovely days for gastronomy, I must say.

Julia Child

Ancel Keys – Sankari vai konna?

Ancel-KeysPalataan siis Keysin ajatuksiin. Vuonna 1953 hän raportoi, että ravinnon rasva korreloi merkitsevästi seerumin kolesterolin pitoisuuteen ja sydänkuolemiin kuudessa maassa: Japanissa, Italiassa, Englannissa, Walesissa, Kanadassa ja USA:ssa. Tämän tutkimuksen ongelma oli, että Keys kelpuutti tutkintoaineistonsa 22 maasta mukaan vain kuusi maata, joiden aineisto tuki hänen kolesterolihypoteesiaan. Kun kaikkien 22 maan tutkimusaineisto analysoidaan, Keysin esittämää korrelaatiota ei enää löydy. Tutkimus on laadittu tukemaan ennalta asetettua hypoteesia ja koska suurin osa tutkimusaineistosta on tarkoituksella hylätty, ei tutkimus täytä tieteellisen tutkimuksen kriteerejä. Se  on malliesimerkki tieteellisestä huijauksesta.
ancel-keys-destoying-health-bogus-science-1953-tshirt-zoomKeysin toinen merkittävä raportti oli jo mainitsemani seitsemän maan tutkimus, jossa myös Suomi oli mukana. Se julkaistiin Circulation-lehdessä vuonna 1970 ja siinä Ancel Keys ja professori Martti Karvonen kertoivat todistaneensa maaeläinrasvan olevan vaarallista, koska se kohotti veren kolesterolipitoisuutta ja lisäsi sydänkuolleisuutta. Seitsemän maan tutkimus on osoitus siitä, kuinka kikkailemalla tilastot saadaan tukemaan omaa agendaa. Tutkimuksen arviointi on tehty liki mahdottomaksi, koska välillä raportoitiin seitsemän maan ja välillä kuuden maan tilastoja ja raportit muuttuivat matkan varrella siten, että välillä suomalaisia verrattiin hollantilaisiin, kreikkalaisiin ja italialaisiin, jotta saatiin haluttuja tilastollisia tuloksia. Seitsemän maan tutkimus ja sen metodologia on sittemmin useampaankin kertaan tyrmätty tieteellisessä yhteisössä.
chd-deaths
Nykyinen virallinen käsitys tyydyttyneistä rasvoista ja kolesterolista perustuu kuitenkin tähän 1958 Jugoslaviassa alkaneeseen epidemiologiseen seurantatutkimukseen, joka julkaistiin Circulation-lehdessä vuonna 1970. Tämä on tärkeä osa rasvakeskustelua. Seitsemän maan tutkimus alkoi muodollisesti Jugoslaviassa syksyllä 1958 ja siinä seurattiin 12 763 40-59 vuotiaan miehen elämäntapojen ja sydäntautien korrelaatioita. Tutkimuksessa otettiin mukaan 16 tilastollista kohorttitutkimusta seitsemästä maasta, joista: 1 Yhdysvalloista, 2 Suomesta, 1 Alankomaista, 3 Italiasta, 5 Jugoslaviasta, 2 kreikasta ja 2 Japanista. Tutkimuksen aineistoa seurattiin 1958-1964. Epidemiologinen kohorttitutkimus on altistelähtöinen eli tutkitaan altisteen vaikutuksia valitussa väestössä. Yleensä voidaan tutkia yhtä altistetta kerrallaan. Joskus voidaan kohortti jakaa alakohortteihin, mutta tämä edellyttää että kohortti on tarpeeksi suuri ja että altistumistiedot ovat tarpeeksi hyviä. Kohorttitutkimus sallii kuitenkin usean sairauden yhtäaikaisen tutkimisen.Keysin 22 maan tutkimus oli ensimmäinen monikansallinen epidemiologinen seurantatutkimus, jossa verrattiin elintapojen korrelaatiota sydäntauteihin ja sydäninfarkteihin. (Lähteet: Wikipedia, Tohtori Tolonen, jne.)

Framingham Heart Study

Framinghamin sydäntutkimus on pitkäkestoinen seuranta, joka toteutetaan Framinghamissa, Massachusettsissa. Tutkimus alkoi jo 1948, jolloin seurantaan osallistui 5209 aikuista. Nyt tutkittavina on jo kolmas sukupolvi. Projektista vastaa National Heart, Lung and Blood Institute yhteistyössä Bostonin yliopiston kanssa. Framinghamin tutkimuksen seurauksena on julkaistu yli 1000 tutkimusraporttia ja saatu paljon arvokasta tietoa ateroskleroosin ja hypertension epidemiologiasta sekä ruokavalion, liikunnan ja esimerkiksi aspiriinin vaikutuksista sydänterveyteen. Tutkimuksesta suunniteltiin 20-vuotista, mutta vuonna 1968 tutkijat halusivat edelleen jatkaa projektia. Vuonna 1971 seurantaan osallistui jo toinen sukupolvi ja 2002 seurantaan otettiin kolmas sukupolvi. Vaikka Framinghamin sydäntutkimuksen on yleensä uskottu tukevan rasva- ja kolesteroliteoriaa, 30-vuotisseuranta yllätti tutkijat: siinä kävi ilmi, ettei kolesteroli ollutkaan yli 47-vuotiaiden miesten riskitekijä, eikä myöskään minkään ikäisten naisten. Erityisen kiusallista kolesteroliteorian kannattajien kannalta oli se, että eniten oli kuollut niitä miehiä, joiden kolesterolitasot olivat vuosien mittaan laskeneet. Tutkijat kirjoittivat: ”Jokaista alentunutta kolesterolin milligrammaprosenttia kohti sydänkuolleisuus kasvoi 11 % ja kokonaiskuolleisuus 14 %.
Amit Sachdeva ym. havaitsivat 136 905 potilaan tutkimusaineisossa, että akuutin sydänkohtauksen saaneiden potilaiden kolesteroli oli merkittävästi matalampi kuin samanikäisten terveiden verrokkien (American Heart Journal 2009). Al-Mallah ym. totesivat, että ”pahan” LDL-kolesterolin pioisuudet olivat tavallista pienempiä ja kuolleisuus kaksin verroin yleisempää matalien LDL-lukemien potilailla (Cardiology Journal 2009). Nämä tutkimukset osoittavat, että seerumin kohonneen kolesterolipitoisuuden ja sydänkuoleman välillä ei vallitse kausaalisuhdetta.

Rasva onkin ystävä

Pohjoismaiden tunnetuin ja vaikutuvaltaisin ravitsemustieteilijä, tanskalainen professori Arne Astrup on muuttanut täysin mielipiteensä rasvoista ja kolesteroliteoriasta. Aikaisemmin hyvin kriittisesti tyydyttyneisiin rasvoihin suhtautunut Astrup kirjoitti vastattain maailman johtavan ravitsemuslääketieteen lehden pääkirjoituksessa, ettei tyydyttyneillä rasvoilla ole syy-yhteyttä sydän- ja verisuonitauteihin. Astrupin kanssa samoilla linjoilla on myös professori Heikki Karppanen, joka sai melkoisesti kuraa niskaansa puhuessaan kolesteroliteoriaa vastaan.

Arne Astrup oli vannoutunut tyydyttyneiden rasvojen vastustaja ja hiilihydraattien puolestapuhuja. Vuonna 2013 Astrup siirtyi näkemykissään lähelle vähähiilihydraattisen ruokavalion periaatteita. Hän myönsi julkisesti, ettei rasva ole vaarallista, kuten vuosikymmeniä on opetettu. Samaa sanoi myös professori Jussi Huttunen Suomessa.  Nykyisin tiedetään, että elintasosairauksien taustalla ei ole välttämätön rasva, vaan hiilihydraattien liiallinen painottaminen ruokavaliossa.

Hiilihydraatit ovat sokereita ja niiden lisäksi syödään ja juodaan virvoitusjuomina valtavasti lisättyä sokeria. Tämä tiedettiin jo 1960-luvulla, jolloin professori John Yudkin puhui sokerien epäterveellisyydestä. Ikävä kyllä Yudkinin näkemykset tyrmättiin täydellisesti ja vaikka hän oli oikeassa, hänen maineensa kärsi valtavasti.

Uudet suuret meta-analyysit (koontitutkimukset) osoittavat, ettei maaeläinrasvan syönti lisää sydän- ja valtimotauteja, eikä kuolleisuutta näihin. Rasvat kuuluvat välttämättömiin ravintoaineisiin ja niitä tarvitaan mm. solujen rakennusaineina ja steroidien lähtöaineina sekä rasvaliukoisten vitamiinien imeytymiseen.

yudkin

John Yudkin (1910–1995) toimi vuosina 1954–1971 Lontoon yliopiston ravitsemustieteen professorina. Hän esitti jo 1960-luvulla, ettei eläinrasva ole vaarallista terveydelle, mutta sitä vastoin sokeri on. Yudkin julkaisi vuonna 1972 sokerista kirjan Pure, White and Deadly, suomennettu nimellä Puhdasta valkoista ja tappavaa: kirja sokerista. Keysin ja Yudkinin välillä käytiin ankaraa kiistaa, ja lopulta – valitettavasti – Keysin kanta voitti, voi ja muu maaeläinrasva julistettiin pannaan, ja sokeria sai syödä. Vasta nyt myönnetään, että Yudkin oli oikeassa ja Keys väärässä (vaikka suomalaiset ravitsemustieteilijät, Fogelholm, Schwab ym. ja Pekka Puska, Matti Uusitupa ja monet muut lääkärit pelottelevat edelleen ihmisiä eläinrasvalla ja kolesterolilla). Lähde: Matti Tolonen

Tutkimuksia tyydyttyneiden rasvojen ja sydäntautien korrelaatiosta:

A group of researchers from the Children’s Hospital Oakland Research Institute in Oakland, California and the Departments of Nutrition and Epidemiology at Harvard School of Public Health in Boston, Massachusetts, performed a meta-analysis of prospective epidemiologic studies on saturated fatty acid intake and risk of coronary heart disease, stroke, or cardiovascular disease in general. In prospective epidemiologic studies a group of initially healthy people, a cohort, is followed over time to investigate if occurrence of disease is related to the exposure of certain factors e.g. dietary and other lifestyle factors. In a meta-analysis, results from different studies on a specific topic are collected and jointly analysed in order to reach a general conclusion based on the accumulated scientific data. Twenty-one studies matched the inclusion criteria for the current meta-analysis. Together these comprised 347,747 individuals of which some 11,000 developed any cardiovascular disease. The results of the analysis showed no significant association between high intake of saturated fatty acids and an increased risk of coronary heart disease, stroke or cardiovascular disease. Age, sex, and study quality were factors taken into account in the analysis, but they did not impact on the outcome.

http://www.eufic.org/page/en/show/latest-science-news/fftid/Study-no-association-dietary-saturated-fats-cardiovascular-disease-risk/

A meta-analysis of prospective cohort studies and randomized controlled trials examined the association between fatty acids and coronary disease. A total of 32 prospective cohort studies with data on dietary fatty acid intake were identified. The analysis included 530,525 participants with 15,907 incident coronary outcomes and an average follow-up of 5 to 23 years. The authors also examined 17 observational studies with data on circulating fatty acid composition (i.e., fatty acids in the blood). These studies included 25,721 participants with 5,519 incident coronary outcomes for whom the average follow-up was 1.3 to 30.7 years.1

  • Total saturated fatty acid intake was not associated with coronary disease risk (pooled relative risk of 1.02, 95% CI: 0.97-1.07);
  • Total circulating saturated fatty acids were not associated with coronary disease risk (pooled relative risk of 1.06, 95% CI: 0.86-1.30);
  • Individual circulating fatty acids, such as palmitic and stearic acids, were also not associated with coronary disease risk;
  • Margaric acid (a saturated fatty acid found in dairy foods) was significantly associated with a lower risk of coronary disease;
  • The authors concluded that the current evidence does not clearly support cardiovascular guidelines that encourage a low intake of total saturated fats.

Another meta-analysis of 26 prospective cohort studies assessed the association between foods high in saturated fat and the risk of mortality.2

  • High intakes of milk, cheese, yogurt and butter were not associated with a risk of all-cause mortality compared to low intakes;
  • High intakes of total dairy, milk and cheese were not associated with cardiovascular mortality.

A 2010 meta-analysis of prospective cohort studies, which included the follow-up of 347,747 subjects over 5 to 23 years, provided the following evidence on the association between dietary saturated fat and coronary heart disease, stroke and cardiovascular disease:3

  • Saturated fat intake was not associated with an elevated risk of coronary heart disease, stroke or cardiovascular disease;
  • The pooled relative risks were 1.07 (95% CI: 0.96-1.19, p = 0.22) for coronary heart disease, 0.81 (95% CI: 0.62-1.05, p = 0.11) for stroke, and 1.00 (95% CI: 0.89-1.11, p = 0.95) for cardiovascular disease;
  • After adjustments for covariates such as age, sex and study quality, the results did not change, and no significant association was observed;
  • No association between dietary saturated fat and disease prevalence was found after adjustment for other nutrients and total energy.

In a 2009 systematic review, the following summary of evidence from prospective cohort studies and randomized controlled trials was provided:4

  • From the meta-analysis of cohort studies of saturated fat and coronary heart disease, intake of saturated fatty acids was not significantly associated with coronary heart disease death or events;
  • The relative risks for the highest compared to the lowest category of saturated fat intake were 1.14 (95% CI: 0.82-1.60, p = 0.431) for coronary heart disease mortality and 0.93 (95% CI: 0.83-1.05, p = 0.269) for coronary heart disease events;
  • There was no significant association between saturated fat and coronary heart disease death or events per 5% total energy increase in saturated fatty acids intake;
  • From the meta-analysis of randomized controlled trials of dietary fat and coronary heart disease, the relative risk of fatal coronary heart disease was not reduced by fat-modified diets.

Another systematic review of prospective cohort studies and randomized trials examined the evidence for dietary factors in relation to coronary heart disease.5

  • Pooled analyses of cohort studies did not show any significant association between higher intakes of saturated fatty acids, meat or milk and coronary heart disease;
  • The relative risks were 1.06 (95% CI: 0.96-1.15) for saturated fatty acids, 1.23 (95% CI: 0.98-1.49) for meat, and 0.94 (95% CI: 0.75-1.13) for milk;
  • After the dietary exposures were stratified by confounding variables such as dietary assessment tool, sex, geographic region, and type of prevention strategy, the association between saturated fatty acids and coronary heart disease in cohort studies remained statistically insignificant;
  • There was no evidence from pooled analyses of randomized controlled trials to support a causal association between saturated fatty acids, meat or milk and coronary heart disease.

In 2012, de Oliveira Otto et al. undertook a prospective cohort study to assess the association between the intake of saturated fat from different food sources and incident cardiovascular events in a multiethnic population. The participants consisted of 5,209 US adults aged 45 to 84 years, and together they represented 36,364 person-years of follow-up.6

  • After adjusting for potential confounders, a higher intake of dairy saturated fat was associated with a lower risk of cardiovascular disease, with a hazard ratio of 0.79 (95% CI: 0.68-0.92) for every additional 5 g/d of dairy and 0.62 (95% CI: 0.47-0.82) for every additional 5% of energy from dairy;
  • The substitution of 2% of energy from meat saturated fat with energy from dairy saturated fat was associated with a 25% lower risk of cardiovascular disease.

In another prospective cohort study, the association between saturated fatty acid intake and the risk of cardiovascular disease mortality was investigated in 58,453 Japanese adults aged 40 to 79 years.7

  • Dietary saturated fatty acid intake was inversely associated with risk of total stroke, intraparenchymal hemorrhage and ischemic stroke;
  • After adjustments for confounding variables such as potential cardiovascular disease risk factors and nutrients, the hazard ratios for the highest compared with lowest quintile were 0.69 (95% CI: 0.53-0.89, ptrend = 0.004) for total stroke, 0.48 (95% CI: 0.27-0.85, ptrend = 0.03) for intraparenchymal hemorrhage, and 0.58 (95% CI: 0.37-0.90, ptrend = 0.01) for ischemic stroke;
  • There was no association between saturated fatty acids intake and subarachnoid hemorrhage and heart diseases such as ischemic heart disease, cardiac arrest and heart failure.

Conclusions

There is strong evidence to support a lack of association between dietary saturated fat and an increased risk of cardiovascular disease.

Saturated fat derived from dairy has either no impact or a beneficial impact on cardiovascular disease risk.

Further research, especially prospective cohort studies and randomized clinical trials, is needed to evaluate the relationship between different food sources of saturated fat and cardiovascular disease outcomes and mortality.

http://www.dairynutrition.ca/nutrients-in-milk-products/fat/saturated-fat-and-cardiovascular-disease-where-are-we

A new review of published evidence challenges current guidelines that suggest in order to reduce heart disease risk, people should generally restrict intake of saturated fats – like those found in butter and dairy foods – in favor of unsaturated fats – such as in margarine and sunflower oil.

The analysis, published in the journal Annals of Internal Medicine by an international group led by a team at the UK’s University of Cambridge, included 72 separate studies on heart risk and intake of fatty acids.

They found no evidence to support guidelines that say people should restrict saturated fat consumption to lower their risk of developing heart disease.

They also found insufficient evidence to support guidelines that advise eating more foods containing polyunsaturated fats (such as omega-3 and omega-6) to reduce heart risk.

And when they dug into the detail of specific fatty acids (such as different types of omega-3), the researchers found their impact on heart risk varied even within the same family of fatty acids.

Findings question current guidelines

The researchers say their findings call into question current guidelines that focus mainly on saturated versus unsaturated fat amounts, as opposed to concentrating on the food sources of the types of fatty acid.

The study was part-funded by the British Heart Foundation, whose associate medical director, Prof. Jeremy Pearson, says:

”This analysis of existing data suggests there isn’t enough evidence to say that a diet rich in polyunsaturated fats but low in saturated fats reduces the risk of cardiovascular disease.”

Lead author Dr. Rajiv Chowdhury of the University of Cambridge, who describes the findings as ”interesting,” says they could open new lines of enquiry that carefully question our current dietary guidelines, and adds:

”Cardiovascular disease, in which the principal manifestation is coronary heart disease, remains the single leading cause of death and disability worldwide. In 2008, more than 17 million people died from a cardiovascular cause globally. With so many affected by this illness, it is critical to have appropriate prevention guidelines which are informed by the best available scientific evidence.”

Researchers pooled data from 72 separate studies

To arrive at their conclusions, Dr. Chowdhury and his colleagues pooled and re-analyzed data from 72 separate studies that included over 600,000 participants in 18 different countries.

The studies had assessed total saturated fatty acid in two ways: one as a component in participants’ diet, and the other way was by measuring levels in the bloodstream.

The results of the pooled analysis showed that whether measured in the bloodstream or as a component of diet, total saturated fatty acid was not linked to coronary disease risk.

The analysis also found no significant link between heart risk and intake of total monounsaturated fatty acids, long-chain omega-3 and omega-6 polyunsaturated fatty acids.

Totuus ostetaan rahalla kun tieteestä on tullut markkinoinnin väline

Monet elävät yhä siinä harhaluulossa, että rasva lihottaa ja on epäterveellistä, koska meidät ehdollistettiin ajattelemaan niin vuosikymmeniä sitten, jolloin behaviorismiakin pidettiin merkittävänä psykologian suuntauksena.

Joseph Goebbelsin sanoin: ”Kun valhetta toistetaan riittävän monta kertaa, se muuttuu totuudeksi”. Valhe voi olla savuverho: ignoratio elenchi, jossa asian vierestä puhumisella johdetaan keskustelu sivupoluille ja varsinainen ongelma jää sivuhuomioksi. Vuosikymmeniä erityisesti tupakkateollisuus käytti näitä argumentaation muotoja, mutta nykyisin niitä sovelletaan hyvin yleisesti lääke- ja elintarviketeollisuudessa. Näiden virheellisen argumentaation muotojen lisäksi nykyisin sovelletaan riskianalyysiä. lasketaan tuottoja ja verrataan voittoja mahdollisiin taloudellisiin sanktioihin. Lääketeollisuus maksaa vuosittain miljardeja erilaisina oikeudenkäynti- ja korvuskuluina vääristeltyjen ja peiteltyjen tutkimusten aiheuttamien joukkokanteiden kompensaationa, mutta maksetut sakot ja korvaukset ovat mitättömiä saatujen voittojen rinnalla. Totuus ostetaan rahalla ja tieteestä on tullut markkinoinnin väline. Kvartaalitalous etenee sijoittajien ehdoilla, ja siinä tärkeämpää on tulojen maksimointi ja ´taloudellisten sanktioiden minimointi; ihmiselämällä ei ole lääketeollisuudessa kuin välineellistä ja taloudellista arvoa. Valitettavasti raha menee kansanterveyden ja hyvinvoinnin edelle. Statiineja syö jo noin 700 000 suomalaista. Oikeastaan vain harvat yli 40-vuotiaat eivät syö säännöllisesti lääkkeitä. Statiinien valmistajien toimintatapa, ”modus operandi” on suunnitella, suorittaa ja analysoida kliinisiä tutkimuksia ja siten käyttää ammattimaisia haamukirjoittajia ja ostaa julkaisijoiden nimiksi tunnettuja akateemisia vaikuttajia: Key Opinion Leaders (KOLs).

Haamuraportteja kirjoittavat niiden tuottamiseen erikoistuneet organisaatiot (Contract Research Organizations, CROs). Haamukirjoituksista on tullut merkittävä osa lääkkeiden markkinointia. Todella taitavata markkinointivelhot toimivat kuin David Blaine, Chris Angel tai David Copperfield. He ovat sananmukaisesti silmänkääntäjiä.

Ruotsissa julkaistu väestötutkimus käsitti lähes kaksi miljoonaa miestä ja kaksi miljoonaa naista. Vuosina 1998–2002 määrätyt statiinit eivät olleet yhtään vähentäneet sydänkohtauksia eikä sydänkuolemia. Tulos on yhdenmukainen Ray ynnä muiden meta-analyysin kanssa (2010): Statiinien käyttö ei lisännyt elinikää satunnaistetuissa primaaripreventiotutkimuksissa, joihin oli osallistunut 65 229 ”suuren riskin” henkilöä. Analyysi käsitti 244 000 henkilövuotta ja 2793 kuolemantapausta.[Kelan ja Tilastokeskuksen tilastot kertovat samaa Suomesta: Statiinien jyrkästi lisääntynyt käyttö ei ole vähentänyt sydänkuolemia.]

Amerikkalaiset lääkärit Hayward ja Krumholz kritisoivat LDL-kolesterolin saamaa liaallista huomiota hoidossa. Heidän mielestään pitäisi hoitaa todellisia risikitekijöitä, ei LDL:ää. ”On aika jättää hyvästit tälle vanhalle, perusteettomalle ja harhaanjohtavalle rasvateorialle”, kirjoittivat ruotsalaislääkärit.

Lähde: Tohtori Tolonen

  ”Two strikingly polar attitudes persist on this subject, with much talk from each and little listening between.” Henry Blackburn, 1975

Seitsemän maan tutkimuksen tulokset ja vaikutukset virallisesti

Tutkimus osoitti populaatioiden ja yksilöiden kohdalla suoran korrelaation ja kausaalisuhteen veren kolesterolitasojen sekä sydän- ja verisuonitautien välillä. Lisäksi tutkimus löysi korrelaation veren kolesterolitasojen ja sydän- ja verisuonitautiriskin (CHD) välillä 5-40 vuoden seurantatutkimuksessa. Kolesteroli ja lihavuus korreloivat myös syöpäkuolleisuuden lisääntymisen kanssa.

Sydän- ja verisuonitautiriski osoittautui tutkimuksessa selvästi suuremmaksi Yhdysvalloissa ja Pohjois-Euroopassa, kuin Etelä-Euroopassa; tämän uskotaan liittyvän välimeren ruokavalioon. Tutkimuksessa kontrolloitiin mm. tupakointi, kolesteroli, liikuntatavat, ikä, verenpaine ja paino, jonka jälkeen merkittävimmäksi sydäntauteja alentavaksi muuttujaksi jäi välimerellinen ravinto. Pidempiaikaisessa seurannassa selvisi, että länsimaisten ruokailutottumusten omaksuminen, fyysisen aktiivisuuden väheneminen ja painon lisääntyminen lisäsivät myös Välimeren alueen ihmisten riskiä sairastua sydän- ja verisuonitauteihin.

Suomessa Ancel Keysin tutkimustulokset otettiin vastaan yhtä innokkaasti kuin DDR:n huippu-urheilijoille suunnittelemat harjoitusohjelmat ja niitä tehostavat anaboliset steroidit.

Seitsemän maan tutkimus sekä Framingham Heart Study, Nurses’ Health Study ja Women’s Health Initiative osoittivat ruokavalion, liikunnan ja normaalipainon merkityksen hyvän terveyden ylläpitäjinä. Seitsemän maan tutkimus osoitti myös, että korkea verenpaine (hypertensio) lisää sekä sydän- ja verisuonitautien että sydän- ja aivoinfarktin riskiä. Tutkimukset ovat sittemmin vaikuttaneet merkittävällä tavalla ravintosuosituksiin lähes kaikissa länsimaissa. Suomessa mm. THL, Valtion ravitsemusneuvottelukunta, Duodecim ja Itä-Suomen yliopisto vetoavat näihin tutkimuksiin ravitsemussuosituksissaan. Kolesteroliteorian vannoutuneisiin puolustajiin kuuluvat mm. Pekka Puska, Mikael Fogelholm, Matti Uusitupa ja ursula schwab, joiden mukaan tuhat tutkimusta tukee kolesteroliteoriaa (yhtään ei ole Antti Heikkilän ynnä muiden kolesteroliteorian vastustajien julkisista pyynnöistä huolimatta esitetty). Useilla Suomen ravitsemussuosituksista vastaavilla asiantuntijoilla on huomattavia sidonnaisuuksia lääke- ja elintarviketeollisuuteen. Helsingin yliopiston ravitsemustieteen professori Mikael Fogelholm on myöntänyt, että ravinnosta saatavat tyydyttyneet rasvat ja kolesteroli eivät aiheuta sydän- ja verisuonitauteja, mutta jo  seuraavassa haastattelussa varoitellut tyydyttyneiden rasvojen vaarallisuudesta (huikea logiikka!).

Englantilainen sydänkirurgi Shyam Kolvekar Lontoon yliopillisesta keskussairaalasta on ehdottanut voille täyskieltoa. Aamupalaksi Kolvekar suositteleekin paahtoleipää teollisella margariinilla. Kolvekarin ohjeen julkaisi KTB, Flora margariinia valmistavan Unileverin PR-yhtiö. Sydänkirurgilta outo lausunto ottaen huomioon, että kaksi paahtoleipäviipaletta vastaa viittä sokeripalaa ja kohonneen verensokerin tiedetään altistavan sydäntaudeille.