1

Aineenvaihdunnan, inflammaation, kognition ja yleisen terveyden modulointi ketogeenisellä ruokavaliolla

Vähähiilihydraattinen ja runsasrasvainen ketogeeninen ruokavalio (LCHF), on menneiden vuosikymmenten saatossa nostettu tuon tuosta esiin terapeuttisena vaihtoehtona metabolisen oireyhtymän, ylipainon ja lihavuuden sekä eräiden lääkeresistenttien sairauksien, kuten epilepsian, syövän, dementian ja masennuksen hoitona. Oma motiivini selvitellä näitä on se, että ketogeenisen ruokavalion neuroprotektiivinen ja tulehduksia hillitsevä luonne voi hidastaa etenevään MS-tautiin liittyvien keskushermoston vaurioiden kehittymistä.

Ruokavaliota on hyödynnetty lääkehoidon rinnalla tai lääkehoidosta riippumatta vuosisatoja. Esimerkiksi diabeteksen hoitoon suositeltiin vähähiilihydraattista ruokavaliota jo 1700-luvun lopulla.

Tutuin tehokkaan ravintoterapian kohde on keliakia, jota sairastavat voivat elää jokseenkin normaalia elämää välttämällä viljojen sisältämää gluteenia. Lääkeresistenttiin epilepsiaan ei edelleenkään tunneta parempaa hoitoa, kuin ketogeeninen ruokavalio, jota on käytetty erityisesti lasten epileptisten kohtausten hillitsemiseen 1920-luvulta alkaen.

Tämän ruokavalion kiistattomista hyödyistä huolimatta, terveydenhuollon ja ravitsemuksen ammattilaiset kyseenalaistavat yhä ketogeenisen ruokavalion turvallisuuden sen aiheuttamien kohonneiden seerumin ketoaineiden ja ruokavalion rajoitetun ravintokuitujen saannin vuoksi.

Ruokavalion herättämiä epäilyjä lisää edelleen huoli aivojen glukoosinsaannin riittävyydestä sekä tyydyttyneisiin rasvoihin ja kolesteroliin liittyvät irrationaaliset pelot.

Siirtymävaiheessa ketogeeninen ruokavalio voi aiheuttaa energiasubstraatin vaihtumisen ja nestehukan seurauksena ohimenevän ketoflunssan. Se on tavallista, eikä lainkaan vaarallista. Usein se kertoo, että ruokavaliomuutoksen jälkeen vettä pitäisi juoda enemmän, koska sokereiden rajoittaminen poistaa kehosta nesteitä.

Ketogeeninen ruokavalio on turvallinen ja tehokas terapiavaihtoehto moniin aineenvaihduntasairauksiin. Tässä katsauksessa tutustutaan eksogeenisten ketoaineiden ja ketonilähteiden aineenvaihduntahyötyjen tieteellisiin perusteisiin.

Katsauksessa käsitellään myös eksogeenisen β-hydroksibutyraatin (BHB) ja siihen liittyvän lyhytketjuisen rasvahapon, butyraatin (BA), synergiaa (yhteisvaikutusta) solutason aineenvaihduntatapahtumissa.

β-hydroksibutyraatin ja butyraatin hyödyt aineenvaihdunnan, inflammaation, kognition ja yleisen terveyden moduloinnissa

Monet soluistamme voivat käyttää rasvahappoja ATP-tuotannon energiasubstaattina, jos glukoosia ei ole riittävästi saatavilla. Aivot eivät kuitenkaan voi suoraan hapettaa rasvohappoja energiaksi, koska rasvahapot eivät läpäise veri-aivoestettä. Vesiliukoinen pienemmän molekyylipainon omaava ketoaine läpäisee vaivatta veri-aivoesteen ja tarjoaa hermosoluille erittäin tehokkaan energialähteen [1, 2].

Ketoaineet, kuten β-hydroksibutyraatti, ovat neuroneille erinomaisia energiasubstraatteja. Erityisen tärkeitä ketoaineet ovat henkilöille, joiden hermosolujen glukoosimetabolia (solujen glukoosin otto) on heikentynyt geneettisten tai elintapoihin liittyvien syiden vuoksi [3]. Ketoaineet aktivoivat mm. kognitiivisista häiriöistä kärsivien aivosolujen energiantuotantoa [4, 5].

Ruokavalion sisältämällä rasvalla on väitetty olevan ratkaiseva rooli ihmisen aivojen evoluutiossa, koska aivot tarvitsevat runsaasti energiaa sisältävää ravintoa sekä rasvojen sisältämiä rakennuspalikoita [6] ja kolesterolia. Tällaista käsitystä tukee huomio, joka osoittaa, että dokosaheksaeenihapolla (DHA) ja muilla rasvoilla on ratkaiseva rooli hermokudosten kasvussa ja toiminnassa. Rasva-aineenvaihdunnan poikkeavuudet tai ravintorasvojen puutteet voivat häiritä aivojen kehitystä ja toimintaa [7].

Eräät asiantuntijat arvelevat, että siirtyminen runsasrasvaisesta ruokavaliosta vähärasvaiseen ruokavalioon on selittävä syy Pohjois-Amerikan metabolisen oireyhtymän (insuliiniresistenssi, diabetes, verenpaine, dyslipidemia, lihavuus) yleistymisen taustalla. USAn makroravinteiden kulutuksen tilastollinen tarkastelu osoittaa lihavuuden lisääntymisen korreloivan ravinnon rasvan vähentämisen kanssa. Rasvan kulutuksen vähentäminen on puolestaan lisännyt runsaasti hiilihydraatteja (sokereita) sisältävien ruokien kulutusta [8].

Samalla noususuuntaisella tilastokäyrällä ovat vuoden 1980 jälkeen kolminkertaistunut lihavien määrä ja aikuistyypin diabeetikkojen määrän kaksinkertaistuminen samana aikana. Iltapäivälehtien clickbait-jutut ketogeenisellä ruokavaliolla sairastuneista kannattaa jättää omaan arvoonsa. Diabeetikkojen määrä on globaalisti jo lähes puoli miljardia ja lihavia on kolmannes kaikista ihmisistä.

Iltapäivälehtien tulisi kiinnittää huomiota todelliseen ongelmaan: Suomessa on puoli miljoonaa aikuistyypin diabetesta sairastavaa. Näistä tilastollisesti joka toinen tulee kuolemaan sydän- ja verisuonitauteihin.

Kaiken lisäksi diabeteksen hoitokustannukset Suomessa ovat samaa luokkaa tai korkeammat kuin tupakoinnin ja alkoholin aiheuttamien sairauksien hoitokustannukset. Koskettavat mielipiteitä muokkaavat tarinat ketogeenisellä ruokavaliolla elämänsä tuhonneesta Penasta tai Sirkka-Liisasta eivät muuta tosiasioita miksikään: voi ja kolesteroli eivät ole suomalaisten suurin terveysongelma.

Tämän hetken kriittisin terveysongelma on hyperglykemian ja hyperinsulinemian aiheuttama insuliiniresistenssi sekä siihen liittyvät aineevaihduntasairaudet. Niiden hoito ravintoterapialla on helppoa ja halpaa.

Jossain ruokavalioiden ääripäiden välillä voi olla terveyden Shangri-La, jossa jalostettuja hiilihydraatteja (sokereiden lähteitä) rajoitetaan, tyydyttyneitä rasvoja ei pelätä ja tuoreilla (matalan glykeemisen indeksin) vihanneksilla on edelleen tärkeä rooli osana terveellistä ruokavaliota [9]. Tai sitten sellaista ei ole.

Energiansaannin rajoittaminen paastoamalla tai ruokavalion sisältämien hiilihydraatteja rajoittamalla johtaa ketoosiin ja seerumin ketonipitoisuuden nousuun [10].

Ketogeeninen vähähiilihydraattinen, runsasrasvainen ruokavalio (LCHF) on kokenut kuluneiden sadan vuoden aikana monta renesanssia ja romahdusta. Jotkut, jotka eivät tunne historiaa, pitävät ketogeenistä ruokavaliota vain muotioikkuna (fad), mutta hiilihydraattien rajoittamista on harjoitettu terveyden kohentamiseksi jo esikristillisillä ajoilla. Lähes jokaiseen uskontoon sisältyy puhdistava paasto, eikä se ole sattumaa, sillä paastolla on tunnustettuja terveyshyötyjä. Paasto johtaa ketoosiin.

Viime vuosisadalla ketogeenisen ruokavalion positiivisista terveysvaikutuksista raportoitiin laajemmin esimerkiksi 1930- ja 1940-luvuilla, jolloin sitä hyödynnettiin mm. astman hoidossa.

Ketogeenistä ruokavaliota on käytetty tehokkaasti hoitona:

  • metaboliseen oireyhtymään[11]

  • epilepsiaan [12]

  • kognitiivisten ja neurologisten häiriöiden [13], kuten Alzheimerin taudin hoitona, jossa sen on osoitettu vähentävän haitallista amyloidiproteiinia [14]
  • termogeneesin proteiiniaktiivisuuden irrottamisen aktivaattorina [15]

  • laihduttamiseen [16]

Ketogeeninen ruokavalio ei ole uusi ja muodikas ruokavalio-oikku, vaan ruokavalio, johon kehomme on täydellisesti adaptoitunut nisäkkäiden ja hominidien evoluution aikana.

Se, että tämä ruokavalioprotokolla voi tehokkaasti vähentää epileptisten kohtausten esiintymistiheyttä [17] ja auttaa hoitamaan lääkeresistenttiä epilepsiaa [18], vahvistettiin jo 1920-luvulla [19, 20].

Tässä katsauksessa käydään läpi joitain ketogeenisen ruokavalion metabolisten ja terveydellisten hyötyjen todisteita, sekä tarkastellaan ruokavalion turvallisuutta ja tehoa terapiavaihtoehtona lääkkeiden rinnalla ja lääkkeistä riippumatta.

Tieteellinen näyttö esitetään myös eksogeenisten ketoaineiden ja muiden erityyppisten ketonilähteiden antamiselle hiilihydraatteja rajoittavan ruokavalioprotokollan täydennyksenä tai vaihtoehtona ruokavaliolle.

Kirjoittajat suosittelevat erityistä menettelytapaa, johon sisältyy eksogeenisen ketonin, β-hydroksibutyraatin (BHB) antaminen lyhytketjuisen rasvahapon, butyraatin (BA) mukana.

Tässä katsauksessa painotetaan tämän BHB-BA-yhdistelmän synergiaa solusignaloinnin ja elimistön hiljaisen tulehduksen, eli inflammaation hallinnan yhteydessä ja sen käyttöä energiasubstraattina ATP: n muodostamiseen TCA-syklissä (sitruunahappokierrossa).

2. Mitä ketogeenisellä ruokavaliolla tarkoitetaan?

Ketogeenisessä ruokavaliossa ravintoaineiden makroravinnprofiili on tärkeä. Päivittäinen energiansaanti sisältää:

  • 65–70% rasvaa

  • 20% proteiinia

  • 5–10% hiilihydraatteja

Ketogeeninen ruokavalio kääntää perinteisen ravintopyramidin ylösalaisin. Päivittäinen hiilihydraattien saanti, joka ei ylitä 75 grammaa, on vähimmäisedellytys ketoosissa pysymiseen; 50 gramman hiilihydraattien saannin enimmäismäärä on toki ketoosin ylläpitämisen kannalta turvallisempi hiilihydraattien saanti. Ketogeenisen ruokavalion alussa hiilihydraattien saantia voi olla järkevää rajoittaa ~20 grammaan päivässä, ja monet ketoilijat pysyvät ~20 gramman päiväsaannissa ilman mitään ongelmia.

Mitä vähämmän hiilihydraatteja ravinto sisältää, sitä tehokkaammin elimistö purkaa rasvasolujen sisältämiä triglyseridejä verenkiertoon, tuottaa ketoaineita energiasubstraateiksi ja hapettaa vapaita rasvahappoja betaoksidaatiossa.

Ketogenressä 75 grammaa hiilihydraatteja päivässä on jo melkoisen villiä sokerihurjastelua, mutta virallinen linja, josta olen kuullut puhuhttavan, on, että alle 150 grammaa hiilihydraatteja päivässä luokitellaan vähähiilihydraattiseksi ruokavalioksi tai karppaamiseksi. Sellainen on absurdia roskaa.

Minä en laske sen enempää hiilihydraatteja, kuin kaloreita. Syön ravintoa, jossa on hiilihydraatteja vähän (alle 6 g/ 100 grammassa) tai ei ollenkaan. Hiilihydraattien saanti vaihtelee minulla keskimäärin 20 ja 50 gramman välillä päivässä. 50 gramman ylittäminen näkyy painossa, verenpaineessa ja verensokerissa. Se ei sovi minulle. Joillekin 50-100 g hiilihydraatteja päivässä voi sopia.

Annos keitettyä riisiä sisältää ~50 gramman hiilihydraatteja. Suuri omena tai banaani, joissa hiilihydraattien määrä on ~40 grammaa, voivat katkaista ketoosin, etenkin kun päälle lasketaan muut päivittäiset hiilihydraattien lähteet.

Myös ruokavalion sisältämillä proteiineilla on vaikutusta seerumin glukoosipitoisuuteen. Esimerkiksi leusiinilla jota saadaan yleensä riittävästi arkiruoasta (eläinperäisestä ravinnosta sekä palkokasveista, siemenistä ja hiivasta), voi olla merkittävä vaikutus ketogeneesin aktivointiin, insuliiniherkkyyteen ja veren puhdistamiseen glukoosista [21].

Sen sijaan eräät mut aminohapot, kuten alaniini, kysteiini ja glysiini, ovat erittäin glukoneogeenisiä (ts. glukoneogeneesiä indusoivia). Matalan energiansaannin aikana keho voi helposti syntetisoida glukoneogeenisiä aminohappoja glukoosiksi [22]. Glukoneogeenisiin / glukogeenisiin aminohappoihin kuuluvat myös arginiini, seriini ja proliini.

Jos ravinto sisältää runsasti glukoneogeenisiä aminohappoja, niistä tuotetaan glukoneogeneesissä glukoosia, mikä kohottaa verensokeria ja insuliinipitoisuutta ehkäisten ketogeneesin käynnistymistä.

Vaikka kohtalaiseen hyperketonemiaan liittyy merkittäviä terveysvaikutuksia riippumatta siitä, käytetäänkö sitä ravintoterapiana tai yksinkertaisesti elämänlaadun parantamiseen, tätä tilaa ei ole helppo saavuttaa ja ylläpitää ilman suunnittelua ja ruokavaliossa tehtäviä uhrauksia [23, 24]. Itse asiassa ketogeenistä elämäntapaa on nykyään jo hieman hankala ylläpitää, kun otetaan huomioon hiilihydraatti- ja sokerikeskeinen kulttuurimme. Hiilihydraattien lähteet ovat hyvin piilossa monissa arkisissa ja jalostetuissa elintarvikkeissa. Moni ei esimerkiksi tule ajatelleeksi, että maito sisältää sokeria (maitosokeria, eli laktoosia).

Yhtäältä lääketieteellisen yhteisön ketogeeniseen ruokavalioon ja varsinkin ketoasidoosiin liittyvä virheellinen viestintä ohjaa väestön kulutustottumuksia kohti hiihihydraattien runsasta saantia.

Ketoasidoosi ja ketoosi sotketaan iloisesti keskenään. Ravintoketoosi on kuitenkin hyvin erilainen fysiologinen tila kuin ketoasidoosi.

Hiilihydraattien rajoittamiseen tai paastoon perustuvista ruokavalion muutoksista johtuva ketoosi ei tarkoita samaa kuin tyypin 1 diabetekseen ja siihen liittyviin diabeettisiin tiloihin liittyvä patologinen ketoasidoosi [25, 26]. Turvallinen hyperketonemia voi saavuttaa jopa 10 mmol/l ketoaine-pitoisuuden paastoamalla tai ketogeenisella ruokavaliolla [27, 28]. Keho  säätelee ketoosia autonomisilla palautemekanismeilla [29]. Ketoasidoosille on ominaista seerumin ketonitasot, jotka ylittävät 18 mmol/l [30].

Ketoasidoosi on fysiologinen tila, jossa jotkin solujen ulkoiset nesteet happamoituvat kun niihin kertyy liikaa happamia ketoaineita. Ihmisillä ketoasidoosit jaetaan aiheuttajien mukaan muun muassa diabeettiseen ketoasidoosiin (DKA) ja alkoholiketoasidoosiin (AKA). Yleisempi diabeettinen ketoasidoosi voi johtaa hoitamattomana kuolemaan. Happomyrkytys on hengenvaarallinen tila, mutta aivan eri eri asia kuin terveen ihmisen paastotessa muodostuvat ketoaineet eli nälkähapot(diabetes.fi). Diabeetikon uhkaavasta happomyrkytyksestä kertoo se, kun verensokeri on koholla ja samaan aikaan verestä löytyy ketoaineita. DKA:n ja AKA:n yhteisiä oireita ovat muun muassa hyperventilaatio, oksentelu, mahakipu, sydämen tiheälyöntisyys ja matala verenpaine. Usein DKA:ssa ilmenee korkea verensokeri, potilas on sekava ja hengitys haisee asetonilta (hedelmäiseltä). Verensokeritaso on AKA:ssa usein normaali tai matala, potilas on lähes tajuissaan ja hengitys ei juurikaan haise asetonilta. – Wikipedia & Diabetes.fi

Koska ketogeeninen ruokavalio muuttaa kehon energia-aineenvaihduntaa glukoosipolttoisesta rasvapolttoiseksi, se imitoi paastoa. Ketogeenisen ruokavalion vaikutukset aineenvaihdunnan modulointiin ovat samanlaisia kuin paaston vaikutukset. Solujen energiasubstraatti vaihtuu glukoosista ketoaineiksi ja vapaiksi rasvahapoiksi, joista hapetetaan asetyylikoentsyymi-A:ta sitruunahappokiertoon.

Energiasubstraatin muutos käynnistää solujen puhdistusjärjestelmän, eli autofagian, joka siivoaa soluja kuona-aineista ja tuottaa niistä energiaa.

Miksi ketogeeninen elämäntapa?

Nykyisillä elintavoilla monet syövät huomamattaan aivan liian hiilihydraattipainotteisesti. Hiilihydraatit muodostuvat sokereista ja kohottavat seerumin glukoosi- ja insuliinipitoisuuksia.

Glukoosi ja sen pitoisuuden kasvun lisäämä seerumin insuliini vaurioittavat esidiabeettisella ja diabeettisella tasolla etenkin kehon pieniä verisuonia. Diabeteksen kehittymisen voi välttää tarkkailemalla sokereiden saantia.

Maksassa ylimääräinen glukoosi (ja fruktoosi) muutetaan lipogeneesissä triglyserideiksi (vrt. alkoholista riippumaton rasvamaksa). Verenkiertoon maksasta erittynyt ylimääräinen glukoosi varastoidaan ylimääräisen rasvan tapaan rasvasoluihin, jossa se muutetaan de novo lipogeneesissä triglyserideiksi.

Ylimääräinen glukoosi on siivottava verenkierrosta, koska glukoosi glykatoituu veressä olevien muiden molekyylien kanssa. Glykaation lopputuotteet (AGE) altistavat monille sairauksille. Tämä on myös se syy, miksi diabetes lisää virtsaamistarvetta: keho yrittää pissaamalla päästä eroon ylimääräisistä sokereista.

Ketogeeninen ruokavalio ei aiheuta ketoasidoosia terveillä. Jatkuvasti kohollaan oleva verensokeri ja korkea insuliini kasvattavat metabolisen oireyhtymän ja insuliiniresistenssin (ne ovat itse asiassa sama asia) ja diabeteksen riskiä. Tyypin 2 diabetes aiheuttaa lihavuutta, alkoholista riippumatonta rasvamaksaa sekä sydän- ja verisuonitauteja monien muiden aineenvaihduntaan kytkeytyvien sairauksien lisäksi.

Tyypin 2 diabetes on ongelma ja ketogeeninen ruokavalio ongelman ratkaisu.

Kun seerumin glukoosia hoidetaan väärin, seurauksena olevat edistyneet glykaation lopputuotteet (AGE) [31, 32] sekä inflammaatio [33, 34] aiheuttavat merkittävää veren toksisuutta [35] ja lisäävät sairastumisriskiä [36].

Glykaation kehittyneille lopputuotteille (AGE) altistunut LDL (matalatiheyksinen lipoproteiini) on ateroskleroosin ja muiden sydän- ja verisuonitautien riskitekijä ja aiheuttaja [37].

LDL itsessään ei ole sydän- ja verisuonitautien riskitekijä, vaan elimistön luonnollinen triglyseridejä, kolesterolia ja rasvaliukoisia vitamiineja kuljettava kuljetusmolekyyli (lipoproteiini), mutta korkean verensokerin aiheuttaman glykaation ja vapaiden happiradikaalien hapettamasta LDL-partikkelista tulee sydäntautien riski.

Elimistön reaktio (hyperglykemia, hyperinsulinemia, glykaatio ja insuliiniresistenssi) seerumin korkeaan glukoosiin, jonka aiheuttaa korkean glykeemisen kuorman ravinto, ei ole terveyttä ja kehon hyvinvointia edistävä. Monet meistä myrkyttävät itseään sokereilla.

Endokriinisen fysiologian peruskäsitys kertoo meille, että joka kerta kun insuliinia erittyy haimasta korkean glykeemisen kuorman ruokien saannin vuoksi tai sitä piikitetään haiman vaurioituneen insuliinintuotannon vuoksi kohonneen glukoosin laskemiseksi, lipolyysi estyy ja energiasubstraatit, glukoosi ja rasvahapot varastoidaan [38]. Tämä toiminta lisää rasvan kertymistä erityisesti sisäelinrasvana ja viskeraalisena keskivartalolihavuutena, mikä vähentää rasvahappojen syntetisoimista ketoaineiksi tai hapettumista betaoksidaatiossa.

Seerumin ketoaineiden saanti soluissa tapahtuu insuliinista riippumattomien metabolisten reittien kautta [39]. Siksi, vaikka insuliiniresistenssi heikentää glukoosin ottoa insuliinista riippuvaisissa soluissa, ketoaineita voidaan hyödyntää energiasubstraatteina insuliinin aineenvaihduntahäiriöistä huolimatta.

Tämä on valtava kehitysaskel neurodegeneratiivisten sairauksien, kuten Parkinsonin ja Alzheimerin taudin tulevia terapiavaihtoehtoja suunniteltaessa. Glukoosin heikentynyt energiametabolia aivoissa on yksi, ei toki ainoa, tekijä monitekijäisissä neurodegeneratiivisissa sairauksissa.

Lisäksi todisteet osoittavat, että kohonneet seerumin ketoainepitoisuudet vähentävät maksan glukoosintuotantoa ja auttavat tällä mekanismilla myös lieventämään kohonneita seerumin glukoosipitoisuuksia [40].

Ketogeeninen ruokavalio on tehokkain lääkkeetön hoito tyypin 2 diabetekseen, metaboliseen oireyhtymään ja alkoholista riippumattomaan rasvamaksaan. LCHF voi kääntää alkavan diabeteksen suunnan [41] ja johtaa aikuistyypin diabeteksen lääkkeettömään remissioon. Hiilihydraattirajoitus vaikuttaa tehokkaasti painonhallintaan [42, 43], laskee seerumin glukoosia eli verensokeria prediabeettisilla sekä diabetesta sairastavilla potilailla [44]. Ketogeeninen ruokavalio laskee myös insuliinin tarvetta insuliiniriippuvaisissa aikuistyypin diabeettisissa oireissa [45, 46].

Hiilihydraattirajoitus ei ole ainoa ruokavaliostrategia, joka torjuu elämäntapaan liittyviä sairauksia. On monta tapaa syödä oikein ja vähintään yhtä monta tapaa syödä väärin.

Ketogeeninen ruokavalio on kuitenkin yksi tehokkaimmista solujen ja elimistön hyvinvointia ylläpitävistä ruokavalioista. Niin hyödyllinen kuin se onkin painonhallinnassa ja metabolisen oireyhtymän terapiana, ketogeenisellä ruokavaliolla tapahtuva kalorirajoitus on tunnetusti huonosti siedetty, ellei sitä kompensoida korkeammalla rasvasta saadulla energialla [47]. Riittävästi rasvaa sisältävä ruoka pitää nälän tehokkaasti loitolla ja ravinnon energiapitoisuus laskee kaloreita miettimättä.

LCHF-ruokavalio myötävaikuttaa seerumin glukoosin ja paastoseerumin glukoosin laskuun sekä parantaa glukoositoleranssia [48]. Jos hiilihydraattien saanti on riittävän matala, seerumin ketonitasot voivat kasvaa riittävästi täyttämään elimistön energiantarvetta ja tukemaan terveyttä useilla tavoilla [49, 50].

Silti vähähiilihydraattisen ruokavalion edellyttämien uhrauksien, kuten leivästä, perunasta, pizzasta, hampurilaisista, bissestä ja sokeriherkuista luopumisen vaikeus on ketoilijoille haaste, joka johtaa herkästi ketogeenisestä ruokavaliosta luopumiseen.

Tämä on hyvin tavallista ruokavalion alkuvaiheessa, mutta vähitellen kaikki sokeriin liittyvät mielihalut vain katoavat. Rasva pitää nälän erinomaisesti loitolla ja energiatasot pysyvät vahvoina koko päivän 1-3 aterialla ilman parin tunnin välein mussutettavia välipaloja.

Monille meistä lääkärin määräämä pilleri tai dosetillinen päivän käynnistäviä lääkkeitä voi olla kuitenkin helpompi ratkaisu, kuin hieman selkärankaa ja sokereista luopumista edellyttävä ketogeeninen ruokavalio.

3. Endogeenisten ketoaineiden muodostuminen

Lihomisen ja laihtumisen metabolinen perusta

Lipolyysi purkaa rasvasoluihin varastoituja triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi verenkiertoon lipolyyttisten hormonien (glukagoni, kortikotropiini, adrenaliini ja noradrenaliini) vaikutuksesta.

Veren insuliinipitoisuus säätelee lipolyyttisten hormonien erittymistä. Insuliini on myös lipolyysin tarvitsemien entsyymien estäjä, joten, kun veren insuliinipitoisuus on korkea, lipolyysi ei voi käynnistyä.

Käytännössä: Kaloreita rajoittavalla dieetillä, jossa suuri osa päivittäisestä energiasta otetaan hiilihydraateista, rasvasolujen polttaminen energiaksi estyy veren jatkuvasti korkean insuliinipitoisuuden vuoksi. Tämä tarkoittaa sitä, että painon laskua tapahtuu lähinnä rasvattoman massan (lihasten) vähenemisen kautta. Niukkakalorisella hiilihydraattipitoisella dieetillä rasvaa poltetaan yöaikaan, sillä insuliinipitoisuus laskee riittävästi ~8 tuntia syömisen jälkeen, ja vasta silloin lipolyysi voi käynnistyä. Tällöin laihtumisen aikaikkuna jää kuitenkin verrattain lyhyeksi.

Lipolyysin vastareaktio on lipogeneesi, joka edistää insuliinin vaikutuksesta rasvan ja sokereiden varastoimista rasvasoluihin triglyserideinä. Evoluution ja aineenvaihdunnan kannalta lihominen on perusteltua vain, jos rasvasoluihin tallennettu energia voidaan hyödyntää energiaksi silloin, kun ravinnosta saadaan puutteellisesti energiaa. Tämä on lihomisen ja laihtumisen metabolinen perusta.

Maksa on rasvasoluista vapautuneiden rasvahappojen ja glyserolin ensisijainen kohde. Ketoaineita tuotetaan vapaista rasvahapoista maksassa tapahtuvassa ketogeneesissä. Ketoaineet voivat myöhemmin toimia aivojen energiasubstraateina [51–53].

Triglyseridien glyseroliosaa käytetään glukoosia syntetisoivassa glukoneogeneesissä. Keho pystyy helposti syntetisoimaan kaiken tarvitsemansa glukoosin. Sanonpahan vain, koska kymmenen vuotta sitten aiheesta väiteltiin ankarasti.

Terveellä ihmisellä, jolla haiman β-solut toimivat normaalisti, seerumin ketonitasoja hallitaan autonomisesti [54]. Seerumin ketonit, asetoasetaatti ja asetoni, samoin kuin β-hydroksibutyraatti, toimivat signaaliligandeina, jotka säätelevät maksan β-oksidaatiota [55] seerumin ketoaineiden kuormituksen säätelemiseksi.

Vuosikymmenien aikana on kerääntynyt kiistattomia todisteita, jotka tukevat tämän palautejärjestelmän olemassaoloa ja tehokkuutta sekä ketonisynteesin huolellista säätelyä transkriptiotasolla [27].

Kuinka seerumin ketonikertomus liittyy seerumin glukoosimalliin?

Tarina on rinnasteinen. Molemmissa malleissa huonosti säännellyt energiasubstraatin tasot voivat johtaa toksiseen tasoon, mutta tasot, joita terve fysiologia hallitsee autonomisesti, tukevat terveellistä aineenvaihduntaa.

Itse asiassa terve seerumin glukoosipitoisuus (~5,0 mmol/l) ei ole sen ihmeellisempi kuin seerumin ketonien terveellinen taso. Seerumin ketonien terveeksi tasoksi hyperketonemian yhteydessä on dokumentoitu 2,0 mmol/l – 8,0 mmol/l [56].

Tätä ketoositasoa pidetään lievänä tai kohtalaisena hyperketonemiana, jonka keho tuottaa selviytymismekanismina pitkittyneisiin paastojaksoihin [25, 53].

Ketoaineiden perustaso terveillä henkilöillä vaihtelee 0,1 – 0,2 mmol/l pitoisuutena [57]. Seerumin ketoneja käytetään useimmissa kudoksissa tehokkaasti energiasubstraateina silloin kun glukoosia on niukasti saatavilla [58]. Ketoaineita käyttävät mm.sydän [59] ja aivot. Sydän on hyvin joustava energiasubstraattien suhteen, mutta sydämen energiansaannin kannalta tehokkain energiasubstraatti on rasva, joka hapettuu β -oksidaatiossa. Sydänlihaksen soluihin varastoituu herkästi lipotoksiineja, jos veren glukoosi- ja rasvapitoisuus on jatkuvasti liian korkea ja sydänlihakselle syötetään liikaa erilaisia energiasubstraatteja. Sydänkin rasvoittuu.

Tästä rajoittavasta ruokavaliosta voidaan tehdä siedettävämpi antamalla eksogeenistä ketonilisää (lisäravinteena) etenkin, jos halutaan kiihdyttää ketoosin positiivisia metabolisia vaikutuksia elimistössä. Endogeenisen (elimistön tuottaman) ketoosin käynnistymisen aikaikkuna ~20 g päivittäisillä hiilihydraateilla on 2-3 vuorokautta [60, 61].

Eksogeenisten ketoneiden ja erityisesti β-hydroksibutyraatin tutkimus lääkinnällisenä ja elimistön toimintaa tehostavana metabolisena substraattina on hyvin aktiivista. β-hydroksibutyraatin vaikutuksia tutkitaan aiemmin mainittujen neurodegeneratiivisten sairauksien terapian lisäksi NASAn rahoittamana astronauttien kognitiivisten kykyjen parantamiseksi äärioloissa ja USAn puolustusministeriön rahoittamana taistelusukeltajien toimintakyvyn tehostamiseksi ja sukellusaikojen pidentämiseksi.

Ketogeenisen ruokavalion aloittamisen jälkeen seerumin ATP-tuotannon kannalta riittävän ketonitason saavuttaminen, voi kestää hiilihydraattien saannista riippuen jopa viisi päivää (yleensä 2-3 päivää). Nämä siirtymäpäivät voivat osoittautua vaikeiksi ja johtaa huijauspäiviin. Seerumin toiminnallisten ketonitasojen ylläpito edellyttää ruokavalion noudattamisesta [62, 63]. Tässä eksogeeninen ketonilisäaine voi helpottaa ketogeeniselle ruokavaliolle siirtymistä.

Huijaaminen ketogeenisen ruokavalion aikana hidastaa aineenvaihdunnan siirtymistä glukoosimetaboliasta rasvametaboliaan, ketogeneesiin ja β-oksidaatioon, joka itse asiassa on ketogeenisen ruokavalion pidemmän aikavälin tavoite. Solut oppivat käyttämään vapaita rasvahappoja energiasubstraatteina β-oksidaatiossa joitain viikkoja ketoosin alkamisen jälkeen. Aikaikkuna on varsin lavea, koska toisilla primaaristi β-oksidaatioon perustuva energia-aineenvaihdunta käynnistyy nopeammin kuin toisilla.

Tunnusomaista β-oksidaatioon siirtyneessä metaboliassa on ketoaineiden tuotannon väheneminen. Ruokailujen välillä rasvahappoja vapautuu tasaisena virtana rasvasoluista verenkiertoon, jossa ne kulkeutuvat soluihin ja hapettuvat β-oksidaatiossa energiaksi, mikä ylläpitää energistä, aktiivista, hieman euforista ja kylläistä oloa. Sama tapahtuu paastotessa.

Ketogeenisessä ruokavaliossa voi ja saa tehdä syrjähyppyjä. Jos mielesi tekee juoda lava bisseä, syödä perhepizza tai suklaalevy, anna palaa! Syrjähyppy ei ole maailmanloppu. Ketogeenisen ruokavalion tarkoituksena ei suinkaan ole kurjistaa elämää, vaan parantaa terveyttä ja elämänlaatua. Syrjähyppy on toki horjahdus ja askel taaksepäin, mutta se korjaantuu, kun ketogeenistä ruokavaliota jatkaa. Alussa syrjähyppyjen teko on helppoa ja houkuttelevaa, mutta pidempään ketoillessa syrjähypyn jälkeen on aivan yhtä helppoa ja luontevaa palata hiilihydraatteja rajoittavaan ruokavalioon. Ilmiö rinnastuu mielestäni alkoholin käyttöön: ihminen voi ja saa juoda toisinaan, mutta dokaamisesta ei pitäisi tehdä elämäntapaa. Ketogeeninen ruokavalio on elämäntapa, ei laihdutusruokavalio ja siksi minäkin vältän dieetistä puhumista. sanana dieetti rinnastuu vahvasti laihduttamiseen.

Yleensä kahden-kolmen päivän ketoilun jälkeen hiilihydraattien rajoittaminen johtaa siihen, että aivot alkavat käyttää solujen energiasubstraatteina enimmäkseen ketoaineita. Tämä aikaikkuna johtuu siitä, että maksan sokerivarastoissa, eli glykogeeneissä on glukoosia ihmisestä riippuen 1-3 päiväksi (~250 g) ja ketogeneesi käynnistyy glukoosivarastojen tyhjennyttyä.

96 tunnin kuluessa hiilihydraattien rajoittamisesta keskushermoston solut tyydyttävät suurimman osan ATP-tarpeestaan ketoaineilla [64]. Itse asiassa ketonit voivat toimia ATP-substraatteina ja tuottaa jopa 70% aivojen energiasta energiakysynnän tyydyttämiseksi [65, 66].

Alzheimerin taudin, dementian ja Parkinsonin taudin hoidossa kohonnut seerumin ketonipitoisuus (ketoosi) on lupaava terapiavaihtoehto [67–69]. Magneettikuvissa ketoosin on huomattu aktivoivan taudin passivoimia aivoalueita Alzheimerin tautia sairastavilla. Hyviä tuloksia on saatu myös dementiaa sairastavien potilaiden kognitiivisissa testeissä, joiden tulokset ovat glukoosin vähentymisen ja ketoaineiden lisääntyneen pitoisuuden seurauksena selvästi parantuneet.

Tähän on looginen selitys: hermosolujen glukoosinoton heikentyminen on yksi monista neurodegeneratiivisten tautien solutason vaurioitumisen syistä. Glukoosimetabolian heikentyesssä solut surkastuvat ja kuolevat energianpuutteeseen, mikä lisää aivojen atrofiaa ja ko. tautien oireita. Nämä solut kuitenkin saavat energiaa β-hydroksibutyraatista. Tämä ehkäisee solujen surkastumista ja dementian oireiden pahenemista. Taustalla oleva mekanismi on kiehtova.

4. Eksogeenisten ketonien käyttö

Endogeenisten ketonien muodostuminen on kehon normaali ja terveellinen selviytymismekanismi, jonka ansiosta ihminen selviää pitkään ilman ravintoa [58]. Tämä on ollut erityisen tärkeää esihistoriallisille esivanhemmillemme, joille ravinnon saanti päivittäin tai edes joka viikko ei ollut mikään itsestäänselvyys. Suuri muutos ravinnonsaannissa tapahtui oikestaan vasta maanviljelyn kehityttyä noin 10 000 vuotta sitten, jolloin ravintoa tuotettiin ja varastoitiin yli välittömän kulutuksen.

Metsästäjä-keräilijät elivät sillä, mitä löysivät tai saivat saaliiksi. Ruokaa syötiin silloin kun sitä oli. Ravinnosta saatu ylimääräinen energia varastoitiin rasvakudokseen. Aikoina, jolloin ravinnosta oli pulaa, solut tuottivat energiaa varastorasvasta. Ketogeneesi, glukoneogeneesi, rasvan β-oksidaatio ja perusaineenvaihdunnan hidastuminen pitävät ihmiset hengissä tarvittaessa useita viikkoja ilman ravintoa. Lihomisella on tärkeä fysiologinen tehtävä ihmisen selviytymisessä.

Solusignalointi

ATP-substraattina toimimisen lisäksi ketonit toimivat myös ligandeina, jotka säätelevät solujen signalointia ja käyttäytymistä [27]. Nämä edut toteutuvat vain, jos henkilö noudattaa ketogeenistä ruokavaliota. Ketogeenisen ruokavalion täydentäminen eksogeenisilla ketoaineilla voi ylläpitää ketoosiin perustuvaa aineenvaihduntaa pienistä syrjähypyistä huolimatta. Samanaikaisesti eksogeeniset ketonit edistävät suotuisaa farmakologiaa.

Ketonien tai proketonien (BHB) eksogeeninen käyttö lisäravinteena on ollut käytössä vuodesta 1975 alkaen. BHB (β-hydroksibutyraatti) muuttuu tarpeen mukaan muiksi ketoaineiksi, kuten asetoasetaatiksi tai alavirtaan asetoniksi. Asetoni ja asetoasetaatti ovat biologisia ketoneja, joista seerumin ketonipitoisuus suurimmaksi osaksi muodostuu [70].

Ketogeeninen ruokavalio ruokavalioterapiana aiheuttaa haasteita, koska se vaatii ylimääräistä omistautumista ja rruokavaliorajoituksia. LCHF voi johtaa siirtymäaikana huonovointisuutta aiheuttavaan ketoflunssaan. Joillekin ketoosin saavuttaminen on vaikeampaa kuin toisille metabolisten, geneettisten, ympäristön, sosiaalisten, kulttuuristen ja elämäntapoihin liittyvien tekijöiden vuoksi.

Eksogeeninen ketonilähde voi toimia siltana, joka kompensoi metaboliseen siirtymään liittyvää energiapuutetta, samalla kun se tarjoaa ketonilähteen, joka toimii solujen signalointiligandina. Sillä voi kuitenkin olla myös ruokavaliosta riippumaton rooli solunsisäisten signalointiominaisuuksiensa vuoksi.

Nykyisissä kaupallisissa ketoaineissa käytettyä suurta annostusta voidaan pitää tarpeettomana. Kuluttajille tarjotaan jopa 10 gramman BHB:tä yhdessä keskipitkäketjuisten triglyseridien (MCT) kanssa.

MCT toimii substraatina β-hapetukselle ja BHB:n muodostumiselle. Suun kautta otettava MCT liittyy monilla käyttäjillä ruoansulatuskanavan häiriöihin, kuten ripuliin [71–75]. Lisäksi nämä BHB-lisäravinteet sisältävät natriumia, jota voi olla 1300 mg annosta kohti. Terveydenhuollon ammattilaisen tulisi valvoa tällaisten erittäin suurten terapeuttisten annosten annostelua potilaille. Lisäravinteisiin liittyy aina yliannostuksen riski.

5. Eksogeenisten ketoaineiden hyödyt

Eksogeenisillä ketoaineilla, kuten BHB:llä (β-hydroksibutyraatilla) on on terapeuttista arvoa useiden sairauksien hoidossa. β-hydroksibutyraattilisän (BHB) in vivo -tutkimus vähensi syöpäkasvaimen kasvua ja pidensi tutkittavan kohteen eloonjäämistä muista ruokavalion tekijöistä, kuten seerumin glukoosipitoisuudesta riippumatta [76].

BHB:llä on havaittu tulehdusta hillitsevä vaikutus NLRP3-tulehduksen aiheuttaman IL-1β:n ja IL-18:n välittämisessä ihmisen monosyyteissä [77]. Tällä voi olla merkitystä autoinflammatoristen sairauksien hoidossa. Eksogeenisen ketonin tukema terapeuttinen ketoosi hillitsee epileptisten kohtausten alkamista [78].

β-hydroksibutyraatti (BHB) auttaa myös parantamaan sydämen terveyttä vähentämällä sydänlihaksen glukoosinottoa ja lisäämällä verenkiertoa [79]. Aivojen hypometabolisten sairauksien, kuten Alzheimerin taudin (AD), hoidossa käytetään menestyksekkäästi 10–20 grammaa eksogeenistä ketonilisää annoksiin jaettuna [80].

Alzheimerin tauti liittyy keskushermoston neuronien heikentyneeseen glukoosimetaboliaan, joka korreloi kognitiivisten kykyjen heikentymisen kanssa [81–84]. Ketoni ei ole riippuvainen insuliinista ja sitä voidaan käyttää hermosolujen mitokondrioissa tehokkaasti. β-hydroksibutyraatin saatavuus ehkäisee neurodegeneratiivisten tautien aivosolujen energiavajeen aiheuttamia solutuhoja [85].

Seerumitasojen ei tarvitse nousta merkittävästi, jotta aivojen energiansaantia voidaan tehostaa vaihtoehtoisella energiasubstraatilla. Tämä vähentää sivuoireiden riskiä ja minimoi hoidossa tarvittavan eksogeenisen ketoniannoksen.

Hyperketonemian, jossa systeemiset plasman ketonit nousevat vain tavallisten (0,2 mmol/l) perustasojen yli, on osoitettu parantavan aivojen ketonipitoisuutta ja tarjoavan neuroneille vaihtoehtoisen ja tehokkaan energiasubstraatin [80].

β-hydroksibutyraatti tukee mitokondrioiden energiantuotannon aktiivisuutta ja estää apoptoottisten (solukuolemaan indusoivien) proteiinien kumuloitumista neuroneihin [65]. Myrkytystilasta, vammoista tai iskemiasta johtuva neurodegeneraatio johtaa oksidatiiviseen stressiin. Eksogeenisten ketonien antaminen hiirimalleissa estää turvallisesti reaktiivisten happiradikaalien (ROS) muodostumista [86].

Ketogeenisen ruokavalion on dokumentoitu olevan tehokas hoito epilepsian ja lääkeresistentin epilepsian hoidossa [87, 88]. Eksogeenisten ketonien antamista on vuosikymmenien ajan käytetty hyvällä menestyksellä epilepsian hoitoon [78, 89].

Kokeellisessa rottamallissa eksogeenisten ketonien on havaittu lisäävän sekä rotan fyysistä aktiivisuutta että kognitiivista suorituskykyä [90]. Siitä, missä määrin eksogeeniset ketonit voivat säätää tai parantaa pitkittynyttä suorituskykyä ihmisillä, ei ole vielä tutkittua tietoa [91], mutta professori Tim Noakesin juoksemat ultramaratoonit ja triathlonisti Sami Inkisen käsittämättömät suoritukset ketogeenisellä ruokavaliolla viittaavat siihen, että ketogeeninen ruokavalio parantaa myös ihmisten henkistä ja fyysistä suorituskykyä.

Viime kädessä ketogeenisen ruokavalion vaikutuksia motivaatioon ja jaksamiseen tukee myös se, että minä multippelisklerootikkona käänsin, editoin ja uudelleenkirjoitin marraskuussa kahdeksan 10-25 A4-sivun mittaista tutkimuskatsausta Ruokasotaan. Kyllä sekin jotain kertoo ketogeenisestä ruokavaliosta ja sen vaikutuksista jaksamiseen.

Eksogeeniset ketonit voivat toimia terveyttä edistävinä aineina, mutta kuten myöhemmin osoitetaan, BHB:n ja sen molekyylisesti analogisen lyhytketjuisen rasvahapon, voihapon (BA) yhdistelmä voi olla tehokkaampi ja sopivampi terapiavaihtoehto mm. näiden yhteiskäytön tuoman synergiahyödyn vuoksi.

6. Eksogeenisten ketonien turvallisuus elintarvikkeissa ja hoidoissa

Ruoka sisältää useita luonnollisia ketonilähteitä. Maitotuotteet ja erityisesti täysmaito ovat luonnollisen β-hydroksibutyraatin lähteitä [92, 93]. Yhdysvaltain FDA luokittelee β-hydroksibutyraatin eri muodot yleisesti turvallisiksi (GRAS).

Eksogeeniset ketonit (tai ketoaineet) ovat turvallisia, mutta kuinka paljon on liikaa?

Koehenkilöt testasivat eksogeenisen ketonimäärän 395 mg / kg ketoniesterinä saantia aterian yhteydessä tai ilman. Seerumin BHB-tasot mitattiin tunnin kuluttua lisäravinteen antamisesta. Seerumin BHB oli alhaisempi BHB:n aterian rinnnalla saaneilla koehenkilöillä verrattuna niihin, jotka saivat BHB:n ilman ruokaa (2,1 mM ± 0,2 mM vs. 3,1 mM ± 0,1 Mm). Nämä äärimmäiset BHB-annokset muuttuivat 31,6 grammaksi ketoniestereitä 80 kg painavalla henkilöllä. Annos siedettiin hyvin [94].

Toisessa ihmiskokeessa käytettiin suun kautta annettua annosta (R) -3-hydroksibutyyli (R) -3-hydroksibutyraattia, joka on BHB-molekyylin monoesteri, kvantifioituna 714 mg / kg. Nämä annokset muuttuivat 57,1 grammaksi ketoniestereitä 80 kg painavalla koehenkilöllä. Maksimiplasman ketonit saavutettiin 2 tunnissa (3,30 mmol/l BHB ja 1,19 mmol/l asetoasetaatti). Tätä suurta annosta annettiin viiden päivän ajan kolme kertaa päivässä, ja myös se siedettiin hyvin [95] ilman sivuvaikutuksia.

Tyypillinen 8 tunnin paasto tuottaa 0,5 mmol/l seerumin ketonipitoisuuden [95]. Seitsemän paastopäivän aikana veren kokonaisketonitasot voivat nousta 5–7 mmol/l tasolle [25, 95].

Toksisuustutkimus rotilla, jotka saivat ketoaineita 12 ja 15 g / kg, tukee myös β-hydroksibutyraatin annostelun turvallisuutta [96].

Suun kautta annettu natrium D, L-β-hydroksibutyraatti (1000 mg / kg päivässä) on annettu alle 2-vuotiaille lapsille, joilla on kardiomyopatia ja leukodystrofia asyyli-CoA-dehydrogenaasipuutoksesta. Viikon kuluessa hoidon aloittamisesta havaittiin lasten toipumista täydellisestä halvauksesta. Kahden vuoden jälkeen todettiin neurologisen toiminnan huomattavaa parantumista. Lapset kävelivät ja aivojen MRI-kuvat osoitti selkeää toipumista.

Kaksi muuta samaa tilaa sairastavaa lasta, jotka eivät reagoineet tyypilliseen hoitoon, paranivat progressiivisesti edellä kuvatulla hoidolla [97]. Pikkulasten hyperinsulinemisessa hypoglykemiassa kahta kuuden kuukauden ikäistä lasta hoidettiin ja seurattiin viiden ja seitsemän kuukauden ajan. Lapsille annettiin neljän ja kahdeksan gramman ketoniannoksia, ja ne siedettiin hyvin [60].

On kuitenkin huomattava, että tällainen äärimmäinen terapeuttinen annostelu vaatii lääketieteellistä seurantaa.

7. Butyraatin terveyshyödyt

Lyhytketjuiset rasvahapot, joita kutsutaan myös haihtuviksi (volatile) rasvahapoiksi, ovat tyypillisesti suolen mikrobiomin tuottamia. Näitä rasvahappoja ovat butyraatti, propionaatti ja asetaatti, jotka syntyvät suolen symbioottisten mikrobien ravintokuidun käymisen sivutuotteina [98].

Suolistomikrobien tiedetään edistävän terveyttä ja hyvinvointia, vaikka ne vaikuttavat tavoilla, jotka ylittävät monimutkaisuudessaan immuunijärjestelmän toiminnan.

Nykyään tiedetään, että kommensaalibakteerit (normaalimikrobiston mikrobit, josta ei koidu isännälle hyötyä eikä haittaa) osallistuvat vitamiinien [99] synteesiin, ja tuottavat tärkeän energialähteen lyhytketjuisten rasvahappojen muodossa [100].

Lyhytketjuiset rasvahapot kiertävät takaisin säätääkseen ja ylläpitääkseen terveellistä suolistomikrobipopulaatiota siivoamalla luminaalisen (onteloon liittyvän) ympäristön patogeeneistä tyhjäksi [101, 102].

Luminaalibutyraatti lisää suoliston mikrobiomin hyvinvointia. Patogeenisiin bakteereihin, kuten koli-bakteereihin (Escherichia coli), salmonellaan (Salmonella spp.) ja kampylobakteereihin (Campylobacter spp.) luminaalibutyraatilla on negatiivinen vaikutus [103].

Butyraatin vaikutus ulottuu kuitenkin paksusuolen ulkopuolelle, jossa sitä syntyy. Butyraatti parantaa insuliiniherkkyyttä systeemisesti [102].

Suun kautta nautitun butyraatin on osoitettu indusoivan GLP-1:n eritystä [104]. Tämän hormonin tiedetään tukevan glukoositoleranssin ja ruokahalun hallintaa. Aivoissa GLP-1 tuottaa syvällisiä vaikutuksia, joiden mekanismit eivät ole aina selkeitä. Sen on osoitettu stimuloivan iskeemisten, eli paikalliseen verenpuutteeseen liittyvien vaurioiden neurogeneesiä aivopohjaisen neurotrofisen tekijän (BDNF) ylisääntelyn kautta [105]. Sillä on masennuslääkkeiden kaltaisia vaikutuksia [106].

Tutkimukset osoittavat, että butyraattia saaneet hiiret pysyvät hoikkina (ruokavalion kalorimäärästä huolimatta) [107]. Butyraatti on lisännyt hiirten energiankulutusta kehon lämmöntuotannon muodossa ja tehnyt hiiristä yleensä fyysisesti aktiivisempia [108, 109].

Butyraatilla on osoitettu olevan merkittävä sydän- ja verisuonitauteja ennaltaehkäisevä vaikutus [110, 111]. Tutkimuksissa butyraatti vähensi seerumin triglyseridejä peräti 50% verrokkeihin nähden [112]. Se myös vähentää endogeenisen kolesterolin tuotantoa [112].

Butyraatin ja asetaatin on todettu suojaavan ruokavalion aiheuttamalta lihavuudelta [107, 113]. Butyraatin antamisen on havaittu parantavan ruokahalua ja ravinteiden aineenvaihduntaa [114]. Butyraatti on avainpolttoaine suoliston epiteelisoluille ja se parantaa suolinukan eheyttä [115].

Aivan kuten BHB, butyraatti on histonideasetylaasien (HDAC) estäjä (inhibiittori), joka säätelee oksidatiivisen stressin vastustuskykyä koodaavien geenien transkriptiota [116].

HDAC-modulointi liittyy myös pitkäkestoiseen muistiin, oppimiseen ja neuronien välisten synaptisten yhteyksien plastisuuteen (neuroplastisuuteen) [117]. Aihe, johon täytyy pikimmiten tutustua!

Geenitranskription säätely johtaa myös parempaan suojaan vapailta happiradikaaleilta ja oksidatiivisen stressin aiheuttamilta kudosvaurioilta, joita voivat aiheuttaa äärimmäinen metabolinen stressi ja ympäristömyrkyt.


Butyraatin geenisäätely vaikuttaa neuroprotektiivisesti (aivosoluja suojaten) ja parantaen siten muistia esimerkiksi dementiassa [118]. Butyraatti estää NF-kB:tä ja lisääntyneitä I-kB-tasoja ja parantaa pitkäaikaista tulehduksen hallintaa [119].

Oraalisesti annettu natriumbutyraatti heikentää kokeellisesti indusoitua koliittia [120]. Suun kautta annetulla butyraatilla on myös tulehduksia estävä anti-inflammatorinen vaikutus. Se voi johtaa Crohnin taudin remissioon vähentämällä NF-kB: n ja IL-1β: n tasoa [121].

Suonensisäisesti annetun butyraatin on osoitettu tukevan suoraan ruoansulatuskanavan vuorauksen ja suolinukan terveyttä [103]. Sillä on vaikutuksia suoliston solujen lisääntymiseen ja solujen troofiseen ravinnonottoon 122].

Butyraatti on voimakas suoliston immuunipuolustusta säätelevien T-solujen promoottori [123]. Se luo immuunijärjestelmää säätelevän mekanismin, joka edistää parempaa tulehduksen hallintaa limakalvon vuorauksessa ja suolinukassa, sekä mekanismin suolistosyövän estämiseksi [124].

Butyraatti vähentää tai estää mikrobiomipopulaatiota, joka tuottaa propionihappoa [125]. Propionihappo on osallisena autismikirjon häiriöissä (ASD) [126]. On spekuloitu, että voihapon propionihappoa tuottavien suolistobakteerien säätelyvaikutus on mekanismi kognitiivisen tilan parantamiseksi [127].

70% lapsista, joilla on autismi tai ASD, on ruoansulatuskanavan häiriöitä ja muuttunut geenien ilmentyminen aivoissa. Sen on arveltu johtuvan lyhytketjuisten rasvahappojen epätasapainosta [128]. Butyraatin ja muiden lyhytketjuisten rasvahappojen oraalisten antoon liittyvien terveysetujen luettelo on pitkä (taulukko 1). β-hydroksibutyraatin antamisen yhteydessä butyraatti-lisä on suositeltava näiden yhteisvaikutusten vuoksi.

Taulukko1

Veden passiivinen imeytyminen paksusuolessa riippuu lyhytketjuisten rasvahappojen saatavuudesta [129–131]. Butyraatilla on rooli terveessä peristaltiikassa, joka auttaa normalisoimaan suolessa liikkuvan massan liikettä ummetuksessa tai ripulissa [132, 133]. Butyraatti tukee optimaalista nesteytystä ja optimaalista suolen eliminointitoimintoa [134].

Tämä farmakologinen vaikutus auttaa torjumaan BHB-lisäravinteisiin liittyviä mahdollisia haittatapahtumia.

Yhteenveto butyraatin terveydellisistä hyödyistä, joita on raportoitu in vitro– ja in vivo -malleilla sekä ihmiskokeilla tehdyissä tutkimuksissa

Butyraattia saa runsaasti meijerituotteista. Voi, joka sisältää luonnostaan 3-4 % voihappoa, on itse asiassa yksi parhaimmista voihapon lähteistä. Yksi ruokalusikallinen voita (~14 g) sisältää ~560 mg voihappoa. Butyraatit ovat voihapon suoloja ja estereitä. Suolistossa esiintyvä voihappo näyttää hillitsevän tulehdusta ja syöpäsolujen kasvua sekä vähentävän happiradikaalien syntyä. Ihminen kuluttaa päivässä yli 1000 mg butyraattia ulkoisista lähteistä. Tämä saadaan ruokavalion rasvoista.

Ihmisillä, jotka noudattavat ketogeenistä ja / tai kaloreita rajoittavaa ruokavaliota, mutta eivät syö meijerituotteita (voita, kermaa ja juustoja), ja joiden kuitujen saanti ravinnosta on vähäistä, voihapon saanti ja synteesi suolistossa on kehon tarpeisiin nähden liian vähäistä. Butyraatin ottaminen lisäravinteena on perusteltua myös, koska se yhdistää ketogeenisen ruokavalion ja butyraattilisän edut synergisesti.

Butyraatti lisää FGF21:n pitoisuutta seerumissa, maksassa ja rasvasoluissa, mikä puolestaan stimuloi rasvahappojen β-hapettumista ja maksan ketonituotantoa [135, 136]. Tämä on butyraattifarmakologian keskeinen piirre, joka synergisoi suoraan sen aktiivisuuden ketogeeniseen aineenvaihduntaan ja tukee sen terveydellisiä vaikutuksia. Butyraatti itsessään voi myös toimia substraattina β-hapettumiselle [137].

8. Butyraatin (lyhytketjuisen rasvahapon) ja BHB: n yhdistämisen edut

Butyraatti toimii merkittävänä ketoosin induktiota kiihdyttävänä synergistisenä tekijänä, joka parantaa:

  • BHB-ligandivuorovaikutuksia ja farmakologiaa

  • yleistä terveydentilaa

  • kuntoa ja suorituskykyä

Ketonien, kuten BHB-suolan eksogeeninen saanti lisäravinteena tarjoaa aivosolujen ATP-tuotannolle välittömän vaihtoehtoisen energiasubstraatin kalori- tai hiilihydraattirajoituksen aikana.

Samanaikainen butyraattilisäys natriumin, kalsiumin tai kaliumbutyraatin (tai sen estereiden) muodossa:

  • indusoi elimistön endogeeniseen ketonisynteesin

  • toimii ligandina stimuloimalla reseptoreita, joihin ketonit vaikuttavat

  • myötävaikuttaa insuliinin ja aineenvaihdunnan yleisen terveyden parantamiseen

  • tukee tulehduksellista ja yleistä immuunijärjestelmän terveyttä

  • tukee neurologista terveyttä

  • tukee ruoansulatuskanavan terveyttä ja eheyttä

  • toimii suoraan ATP:n muodostamisen energiasubstraattina

Kaikki nämä toteutuvat rinnakkain niiden etujen kanssa, joita sisarketoaineen (BHB) samanaikainen lisäys tuottaa. Tämän synergistisen järjestelmän arvo ketogeenisen ruokavalion yhteydessä on hyvin perusteltu ja järkevä.

On kuitenkin muistettava, että ketogeeniselle elämäntavalle on ominaista vähäinen hiilihydraattien saanti, mikä johtaa heikentyneeseen sulamattoman kuidun ja resistentin tärkkelyksen saantiin. Sillä on negatiivinen vaikutus suoliston mikrobiomiin ja sen kykyyn tuottaa lyhytketjuisia rasvahappoja, kuten voihappoa.

Suoliston mikrobiomi on säännöllisesti kovan paineen alla ympäristötekijöiden, kuten ruokavalion ja lääkkeiden (esim. antibioottien) vaikutuksesta [138, 139]. Butyraatin ottaminen lisäravinteena suojaa  suoliston mikrobiomia, etenkin jos sulamattomien kuitujen ja resistentin tärkkelyksen saanti on vähäistä.

9. Voihappo ja ketogeeninen painonpudotusstrategiaa

Lisäravinteena otetun BHB:n vaikutusta painonpudotuksessa on tutkittu hyvin paljon. Erityisen paljon huomiota on kiinnitetty lisäravinteisiin, jotka sisältävät BHB:n lisäksi keskipitkäketjuisia triglyseridejä (MCT). Ketoaineet ja MCT sisältävät energiaa ja lisäävät siten päivittäistä energiansaantia.

Tutkimuksissa on havaittu, että seerumin ketonipitoisuuden kasvu ei lisää, vaan estää lipolyysiä. Siltä kannalta lisäravinteena otetut ketoaineet ja MCT itse asiassa estävät rasvasolujen purkamista vapaiksi rasvahapoiksi, ketonien synteesiä ja laihtumista [53, 140]. Toisaalta butyraatti tukee ruokahalun hallintaa ja parantaa kehon rasva-lihas-koostumusta [107, 112–114].

On olemassa näyttöä, jonka mukaan butyraatti vaikuttaa suotuisasti sydän- ja verisuoniterveyteen ja ehkäisee sydän- ja verisuonitauteja [112]. Tasapaino eksogeenisten ja endogeenisten ketoaineiden välillä on oleellista aivojen ja kognitiivisen terveyden silloitustekijänä ja neuroniin liittyvien signaaliligandien riittävän saannin kannalta. Aktivointisignaali, kuten voihaposta peräisin oleva signaali rasvahappojen β-oksidaation käynnistämiseksi aivosoluissa, on neuronien toiminnan kannalta tärkeää.

Lisäravinteena otetutun butyraatin ja beta-hydroksibutyraatin käyttö on perusteltua ruokavalion siirtymäajalla sekä solujen energia-aineenvaihdunnan tehostajana monissa metabolisissa ja neurodegeneratiivisissa sairauksissa, mutta laihtumisen suhteen tällaisesta lisäravinnecocktailista ei ole hyötyä. Sen sijaan lisäaineina syiötävien butyraatin ja beta-hydroksibutyraatin hyödyntäminen paastolla tapahtuvan liikunnan energiabuusterina ja rasvahappojen hapettumisen tehostajana on perusteltua.

Ruokavalion tuottama ketoosi vähentää laktaatin tuotantoa ja parantaa suorituskykyä erityisesti kestävyyttä vaativissa lajeissa, kuten pyöräilyssä [141]. Sen on osoitettu estävän lihaskatoa (kataboliaa) ja suojaavan aivoja ja muita kudoksia hapettumiselta [142].

10. Kurkistus ketoaineiden solunsisäiseen farmakologiaan

BHB-BA-kompleksin farmakologiasta vastaavien mekanismien kartoittamiseksi ravintolisien yhteydessä on tehty useita tutkimuksia. Tutkimukset osoittavat, että erilaiset G-proteiiniin kytketyt HCA-reseptorit toimivat kohteina endogeenisille ketonille ja ketoaineiden ligandeille [143].

Tämä reseptoriperhe luokitellaan useisiin alatyyppeihin, joilla on erillisiä piirteitä, kuten ligandispesifisyys. Vaikka BHB toimii tehokkaana agonistina esimerkiksi HCA2-reseptoreille, se ei kykene toimimaan agonistina muille HCA-reseptoreille. Sekä BA että BHB ovat signalointiligandeja erilaisille reseptoreille, jotka osallistuvat neuroinflammatoriseen säätelyyn, mukaan lukien HCA2-reseptori [144].

Muut ligandit, kuten muut ketonit, voivat toimia agonisteina vaihtamalla HCA-reseptoreita, mutta ne eivät välttämättä pysty käynnistämään HCA2 reseptorista transduktiokaskadia. HCA-reseptoreita voi esiintyä erilaisissa kudos- ja solutyypeissä, kuten rasvasoluissa ja makrofageissa [143].

Näiden reseptorien ilmentyminen voidaan myös indusoida immuunisoluissa, kuten makrofageissa, erilaisilla sytokiineilla ligandiensa solunsisäisen vaikutuksen säätelemiseksi. Vapaat rasvahappo- (FFAR) ja HCA-reseptorit voivat hyvinkin olla keskeisiä kohteita tyypin 2 diabeteksen, lihavuuden ja inflammaation ehkäisyssä ja hoidossa [145].

Ravinnetasapainoa ylläpitävät rasvahapporeseptorit, jotka säätelevät kolekystokiniiniä, peptidiä YY ja leptiiniä ovat kasvavan kiinnostuksen kohteena diabeteksen hoidossa.

Luonnossa esiintyvät ligandit, BHB ja BA moduloivat jo tehokkaasti näitä terapeuttisia kohteita. Kaikki kolme HCA-reseptoria ekspressoidaan rasvasoluissa. HCA1-reseptori aktivoidaan esimerkiksi hydroksipropaanihapolla (laktaatilla), kun taas HCA2:n agonisti on β-hydroksibutyraatti (BHB), ja HCA3 aktivoidaan toisella β-hapetusvälituotteella [146].

Näiden kahden luonnollisen butyraatin säätelyvaikutukset tulehduksellista kaskadia ja immuunijärjestelmän aktiivisuutta säätelevien sytokiinien transkriptiotekijöihin liittyvät läheisesti NF-kB-modulointiin.

Tumatekijä erytroidiin 2 liittyvä tekijä 2 (Nrf2) on ensisijainen transkriptiotekijä, joka käynnistää vasteen oksidatiiviseen stressiin. Ketogeeninen ruokavalio indusoi systemaattisesti Nrf2:ta lievän oksidatiivisen ja elektrofiilisen stressin kautta [147, 148].

Nrf2:n transkriptio avaa sarjan endogeenisiä antioksidanttisia puolustusjärjestelmiä. Transkriptiotekijä siirtyy tumaan ja sitoo antioksidanttivaste-elementin (ARE) transkriptoimaan solua suojaavat sytoprotektiiviset geenit [149].

Nrf2 transkriptoi endogeeniset antioksidanttipeptidit: hemeoksigenaasi-1, katalaasi (CAT), superoksididismutaasi (SOD) ja glutationiperoksidaasi (GSH / GPx) [150-152] oksidatiivisen stressin suojamekanismina. Viime aikoina tätä mekanismia on kohdennettu kemopreventiivisesti, millä on haluttu stimuloida endogeenista antioksidanttisaturaatiota, joka estää syöpä- ja kemoterapialääkkeiden aiheuttamat vahingot isäntäsolun terveessä DNA:ssa [153, 154].

Nrf2 lisää solujen puolustusmekanismeja. Se välittää mitokondrioille hermosuojauksen toksiinin aiheuttaman stressin aikana ja ehkäisee vaurioiden (leesioiden) muodostumista [155, 156].

Tätä solusuojausta nähdään myös kemoterapian yhteydessä, jossa Nrf2-induktio suojaa terveitä soluja [157]. Nrf2-induktio suojaa soluja LPS:n aiheuttamalta tulehdukselliselta aktiivisuudelta ja kuolleisuudelta [158].

Nrf2-signalointireitit ovat lupaavia Parkinsonin taudin mitokondrioiden toimintahäiriöiden vastatoimena [159]. Nrf2-induktion välittää myös puolustuksen sydänlihassolujen kohonneesta seerumin-glukoosin aiheuttamasta oksidatiivisesta vahingosta [160].

Diabeettinen tila liittyy Nrf2-aktiivisuuden alasregulaatioon ERK:n kautta. Tämän uskotaan vaikuttavan stressin aiheuttamaan insuliiniresistenssiin sydämen soluissa [161]. Tutkimukset osoittavat, että Nrf2-aktivaatiota voidaan käyttää terapeuttisena sovelluksena diabeteksen ”metabolisen häiriön parantamiseen ja munuaisvaurioiden lievittämiseen” [162].

Nrf2:n rooli solujen suojauksessa antioksidanttisen puolustuksen pääregulaattorina tekevät siitä kiinnostavan kohteen kudosten ja solujen suojaamisessa hapettavilta ja toksisilta tekijöiltä [163, 164]. Nrf2:lla on huomattava merkitys antioksidanttipuolustusmekanismissa muiden yleisten endogeenisten antioksidanttien rinnalla. Se tukee myös vammoista, toksisuudesta ja hypoksiasta palautumista [165, 166].

Iskemia (paikallinen hapenpuute) on yleinen solun toimintahäiriön ja solukuoleman syy. Iskemia johtuuu verenkierron keskeytymisestä tai hapen saatavuuden heikkenemisestä kudoksissa, mikä johtaa soluvaurioihin. Sen tiedetään olevan keskeinen tekijä aivohalvauksen patologiassa ja yksi yleisimmistä pysyvien solu- ja kudosvaurioiden aiheuttajista sydänsairauksissa [167].

Hemeoksigenaasi-1-induktio suojaa neuroneja [168] ja sydänkudosta [169] iskemialta ja sen aiheuttamilta vaurioilta. Myös glutationiperoksidaasin yliekspressio suojaa sydänlihasta iskeemisiltä reperfuusiovaurioilta [170, 171].

Butyraatti aktivoi Nrf2:ta [172, 173]. Tutkimuskirjallisuudessa on viitteitä siitä, että käsittely butyraatilla tai sen suoloilla (natriumbutyraatilla) lievittää oksidatiivista stressiä [174] ja parantaa katalaasiaktiivisuutta [175]. Esikäsittely BA-annoksella suojaa iskemiaan liittyviä sydänlihaksen vaurioita estämällä tulehduksellisten sytokiinien ilmentymistä [174].

Se myös suojaa keuhkovaltimon sileän lihaksen soluja hyperoksiaan liittyvältä hapettumiselta [175] ja parantaa ikääntymiseen liittyvää aineenvaihduntaa ja lihasten surkastumista [176].

11. Opittavaa on paljon

Monet voivat hyötyä ketogeenisestä ruokavaliosta tai suun kautta otettavista ketoaineista ja niiden tuottamasta ketoositilasta.

Ketoosi ylläpitää parempaa ruokahalun hallintaa, fyysistä kuntoa, aivojen tehostunutta energiansaantia, neuroplastisuutta, neurogeneesiä, oppimiskykyä ja parempaa muistia. Ketoosin aiheuttama beta-oksidaatio ylläpitää tasaista eenergiavirtaa, joka lisää kestävyyttä ja polttaa tehokkaasti rasvaa.

Solutasolla ketonit vaikuttavat neuro- ja sytoprotektiivisesti suojaten soluja ja hillitsevät vapaiden happiradikaalien ja oksidatiivisen stressin aiheuttamia solu- ja kudosvaurioita. Tutkimuskirjallisuuden meta-analyysin perusteella ketoosin hyötyjä ovat:

  • tulehduksen (inflammaation) lievittäminen

  • neurologiseen sairauteen liittyvä kognitiivisen heikentymisen korjaantuminen

  • parantunut ruoansulatuskanavan terveys

  • nopeampi palautuminen liikunnan tai intensiivisen harjoituksen lihasrasituksesta

Lisää työtä ja kliinisiä tutkimuksia tarvitaan, jotta tiedämme tarkemmin, miten näitä strategioita voidaan käyttää potilaiden terapiana.

12. Keskustelua

Tutkimuskirjallisuuden tämänhetkisen näytön perusteella lisäravinteena otetun eksogeenisen ketonin käyttö näyttää olevan toteuttamiskelpoinen strategia, joka tukee ketogeenisen ruokavalion siirtymävaihetta, jossa keho totutetaan glukoosin sijaan uuteen energiasubstraattiin. Butyraatinn on raportoitu antavan positiivisia tuloksia kunto-, painonhallinta-, kognitio- ja suorituskyvyn parantamisen tueksi joko ruokavalion rajoituksilla tai ilman.

Laboratoriomme nykyinen tutkimushanke on suunniteltu tutkimaan edelleen BHB:n ja BHB-BA:n solunsisäisiä vaikutuksia immuunijärjestelmän tärkeimpiin soluihin seerumipitoisuuksilla, jotka voimme saavuttaa suositellulla vähimmäisannoksella.

Eksogeeninen BHB-BA-ravintolisä voi olla toiminnallinen strategia, joka indusoi β-hapettumista ja auttaa nostamaan seerumin ketonitasoja, jotka tuottavat ketoosin (> 0,2 mmol) metaboliset hyödyt ilman makroravinteiden ankaraa säätelyä. BHB:n samanaikainen antaminen siihen liittyvän BA-molekyylin kanssa näyttää olevan tehokas tapa saavuttaa tämä tavoite käyttämällä erittäin pieniä ja turvallisia oraalisia annoksia. Vaikka ketoosin metabolisia hyötyjä saatetaan saavuttaa lisäravinteilla, on todennäköistä, että ketogeeninen ruokavalio yhdessä lisäravinteina otettavien butyraatin ja beta-hydroksibutyraatin kanssa toimii terapiana etenkin kognitiivisten häiriöiden ja painonhallinnan yhteydessä paremmin kuin lisäravinteet yksin.

Ruokavalion täydentäminen BHB-BA-lisäravinteella tukee ketoosissa pysymistä pienistä ruokavaliolipsahduksista huolimatta.

Huomio: Ota yhteys lääkäriin ennenBHB-BA-lisäravinteiden käyttöä. Älä käytä, jos olet raskaana tai imetät. Ei suositella tyypin I diabeetikoille.

Ps. Pahoittelut kirjoitus- ja/tai asiavirheistä. Nppäilyvirheille tulee jotenkin sokeaksi.

Conflicts of Interest

Franco Cavaleri is the owner of a biomedical research group, Biologic Nutrigenomics Health Research Corp., and Biologic Pharmamedical Research that funds and executes research on the pharmacology of nutritional, nutraceutical, and pharmaceutical agents that are studied in the context of disease pathology including characteristics that have been associated with inflammation and dementias. Franco Cavaleri is also the owner of ketone-based and other related intellectual properties. Emran Bashar is an employee of the Biologic Pharmamedical Research.Authors’ ContributionsFranco Cavaleri was responsible for background research and preparation and editing of the manuscript. Emran Bashar was responsible for conducting research and preparation and editing of the manuscript. Franco Cavaleri and Emran Bashar generated research plans.


References

  1. A. Gjedde and C. Crone, “Induction processes in blood-brain transfer of ketone bodies during starvation,” American Journal of Physiology–Legacy Content, vol. 229, no. 5, pp. 1165–1169, 1975. View at: Publisher Site | Google Scholar
  2. M. Pollay and F. Alan Stevens, “Starvation-induced changes in transport of ketone bodies across the blood-brain barrier,” Journal of Neuroscience Research, vol. 5, no. 2, pp. 163–172, 1980. View at: Publisher Site | Google Scholar
  3. S. Cunnane, S. Nugent, M. Roy et al., “Brain fuel metabolism, aging, and Alzheimer’s disease,” Nutrition, vol. 27, no. 1, pp. 3–20, 2011. View at: Publisher Site | Google Scholar
  4. M. A. Reger, S. T. Henderson, C. Hale et al., “Effects of β-hydroxybutyrate on cognition in memory-impaired adults,” Neurobiology of Aging, vol. 25, no. 3, pp. 311–314, 2004. View at: Publisher Site | Google Scholar
  5. L. C. Costantini, L. J. Barr, J. L. Vogel, and S. T. Henderson, “Hypometabolism as a therapeutic target in Alzheimer’s disease,” BMC Neuroscience, vol. 9, no. 2, p. S16, 2008. View at: Publisher Site | Google Scholar
  6. W. R. Leonard, “Dietary change was a driving force in human evolution,” Scientific American, vol. 287, no. 6, pp. 106–116, 2002. View at: Publisher Site | Google Scholar
  7. S. M. Innis, “Dietary (n−3) fatty acids and brain development,” Journal of Nutrition, vol. 137, no. 4, pp. 855–859, 2007. View at: Publisher Site | Google Scholar
  8. E. Cohen, M. Cragg, A. Hite, M. Rosenberg, and B. Zhou, “Statistical review of US macronutrient consumption data, 1965–2011: Americans have been following dietary guidelines, coincident with the rise in obesity,” Nutrition, vol. 31, no. 5, pp. 727–732, 2015. View at: Publisher Site | Google Scholar
  9. J. Scholl, “Traditional dietary recommendations for the prevention of cardiovascular disease: do they meet the needs of our patients?” Cholesterol, vol. 2012, pp. 1–9, 2012. View at: Publisher Site | Google Scholar
  10. G. Mullins, C. Hallam, and I. Broom, “Ketosis, ketoacidosis and very-low-calorie diets: putting the record straight,” Nutrition Bulletin, vol. 36, no. 3, pp. 397–402, 2011. View at: Publisher Site | Google Scholar
  11. D. K. Layman and D. A. Walker, “Potential importance of leucine in treatment of obesity and the metabolic syndrome,” Journal of Nutrition, vol. 136, no. 1, pp. 319S–323S, 2006. View at: Publisher Site | Google Scholar
  12. M. Lawson and V. Shaw, “Ketogenic diet for epilepsy,” in Clinical Paediatric Dietetics, pp. 222–232, Blackwell Science Ltd., Oxford, UK, 2nd edition, 2001. View at: Google Scholar
  13. R. Krikorian, M. D. Shidler, K. Dangelo, S. C. Couch, S. C. Benoit, and D. J. Clegg, “Dietary ketosis enhances memory in mild cognitive impairment,” Neurobiology of Aging, vol. 33, no. 2, pp. 425. e19–425. e27, 2012. View at: Publisher Site | Google Scholar
  14. K. W. Barañano and A. L. Hartman, “The ketogenic diet: uses in epilepsy and other neurologic illnesses,” Current Treatment Options in Neurology, vol. 10, no. 6, pp. 410–419, 2008. View at: Publisher Site | Google Scholar
  15. P. G. Sullivan, N. A. Rippy, K. Dorenbos, R. C. Concepcion, A. K. Agarwal, and J. M. Rho, “The ketogenic diet increases mitochondrial uncoupling protein levels and activity,” Annals of Neurology, vol. 55, no. 4, pp. 576–580, 2004. View at: Publisher Site | Google Scholar
  16. E. C. Westman, J. Mavropoulos, W. S. Yancy Jr., and J. S. Volek, “A review of low-carbohydrate ketogenic diets,” Current Atherosclerosis Reports, vol. 5, no. 6, pp. 476–483, 2003. View at: Publisher Site | Google Scholar
  17. K. M. Maruschak, Impact of a Low-Carbohydrate, High-Fat Modified Ketogenic Diet on Anthropometrics, Biochemical Values, and Gastrointestinal Symptoms in Adult Patients with Epilepsy, Rush University, Chicago, IL, USA, 2016.
  18. S. R. Send, The Impact of a Low-Carbohydrate, High-Fat Modified Ketogenic Diet on Seizure Severity, Seizure Frequency, and Quality of Life in Adult Patients with Epilepsy, Rush University, Chicago, IL, USA, 2016.
  19. C. Dudick, “Carb”(not “Keto”) is a Four Letter Word, 2016.
  20. M. Schmidt, N. Pfetzer, M. Schwab, I. Strauss, and U. Kämmerer, “Effects of a ketogenic diet on the quality of life in 16 patients with advanced cancer: a pilot trial,” Nutrition and Metabolism, vol. 8, no. 1, p. 54, 2011. View at: Publisher Site | Google Scholar
  21. D. K. Layman and J. I. Baum, “Dietary protein impact on glycemic control during weight loss,” Journal of Nutrition, vol. 134, no. 4, pp. 968S–973S, 2004. View at: Publisher Site | Google Scholar
  22. C. Remesy, P. Fafournoux, and C. Demigne, “Control of hepatic utilization of serine, glycine and threonine in fed and starved rats,” Journal of Nutrition, vol. 113, no. 1, pp. 28–39, 1983. View at: Publisher Site | Google Scholar
  23. N. J. Krilanovich, “Benefits of ketogenic diets,” American Journal of Clinical Nutrition, vol. 85, no. 1, pp. 238-239, 2007. View at: Publisher Site | Google Scholar
  24. D. W. Kim, H. C. Kang, J. C. Park, and H. D. Kim, “Benefits of the nonfasting ketogenic diet compared with the initial fasting ketogenic diet,” Pediatrics, vol. 114, no. 6, pp. 1627–1630, 2004. View at: Publisher Site | Google Scholar
  25. R. L. Veech, “The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism,” Prostaglandins, Leukotrienes and Essential Fatty Acids, vol. 70, no. 3, pp. 309–319, 2004. View at: Publisher Site | Google Scholar
  26. J. D. McGarry, “Disordered metabolism in diabetes: have we underemphasized the fat component?” Journal of Cellular Biochemistry, vol. 55, no. S1994A, pp. 29–38, 1994. View at: Publisher Site | Google Scholar
  27. J. C. Newman and E. Verdin, “Ketone bodies as signaling metabolites,” Trends in Endocrinology and Metabolism, vol. 25, no. 1, pp. 42–52, 2014. View at: Publisher Site | Google Scholar
  28. O. Owen, G. Reichard Jr., H. Markus, G. Boden, M. Mozzoli, and C. Shuman, “Rapid intravenous sodium acetoacetate infusion in man metabolic and kinetic responses,” Journal of Clinical Investigation, vol. 52, no. 10, pp. 2606–2616, 1973. View at: Publisher Site | Google Scholar
  29. E. O. Balasse and F. Féry, “Ketone body production and disposal: effects of fasting, diabetes, and exercise,” Diabetes/Metabolism Reviews, vol. 5, no. 3, pp. 247–270, 1989. View at: Publisher Site | Google Scholar
  30. R. Wilson and W. Reeves, “Neutrophil phagocytosis and killing in insulin-dependent diabetes,” Clinical and Experimental Immunology, vol. 63, no. 2, p. 478, 1986. View at: Google Scholar
  31. M. Brownlee, H. Vlassara, A. Kooney, P. Ulrich, and A. Cerami, “Aminoguanidine prevents diabetes-induced arterial wall protein cross-linking,” Science, vol. 232, no. 4758, pp. 1629–1632, 1986. View at: Publisher Site | Google Scholar
  32. N. Ahmed, “Advanced glycation endproducts—role in pathology of diabetic complications,” Diabetes Research and Clinical Practice, vol. 67, no. 1, pp. 3–21, 2005. View at: Publisher Site | Google Scholar
  33. P. Marceau, S. Biron, F. S. Hould et al., “Liver pathology and the metabolic syndrome X in severe obesity,” Journal of Clinical Endocrinology and Metabolism, vol. 84, no. 5, pp. 1513–1517, 1999. View at: Publisher Site | Google Scholar
  34. M. Y. Donath and S. E. Shoelson, “Type 2 diabetes as an inflammatory disease,” Nature Reviews Immunology, vol. 11, no. 2, pp. 98–107, 2011. View at: Publisher Site | Google Scholar
  35. K. Moley, M. Y. Chi, C. Knudson, S. Korsmeyer, and M. Mueckler, “Hyperglycemia induces apoptosis in pre-implantation embryos through cell death effector pathways,” Nature Medicine, vol. 4, no. 12, pp. 1421–1424, 1998. View at: Publisher Site | Google Scholar
  36. S. P. Hays, E. B. Smith, and A. L. Sunehag, “Hyperglycemia is a risk factor for early death and morbidity in extremely low birth-weight infants,” Pediatrics, vol. 118, no. 5, pp. 1811–1818, 2006. View at: Publisher Site | Google Scholar
  37. H. Vlassara, “Advanced glycation end-products and atherosclerosis,” Annals of Medicine, vol. 28, no. 5, pp. 419–426, 1996. View at: Publisher Site | Google Scholar
  38. H. Yki-Jarvinen, “Glucose Toxicity,” Endocrine Reviews, vol. 13, no. 3, pp. 415–431, 1992. View at: Publisher Site | Google Scholar
  39. L. L. Madison, D. Mebane, R. H. Unger, and A. Lochner, “The hypoglycemic action of ketones. II. Evidence for a stimulatory feedback of ketones on the pancreatic beta cells,” Journal of Clinical Investigation, vol. 43, no. 3, pp. 408–415, 1964. View at: Publisher Site | Google Scholar
  40. A. Baron, G. Brechtel, and S. Edelman, “Effects of free fatty acids and ketone bodies on in vivo non-insulin-mediated glucose utilization and production in humans,” Metabolism, vol. 38, no. 11, pp. 1056–1061, 1989. View at: Publisher Site | Google Scholar
  41. T. A. Hussain, T. C. Mathew, A. A. Dashti, S. Asfar, N. Al-Zaid, and H. M. Dashti, “Effect of low-calorie versus low-carbohydrate ketogenic diet in type 2 diabetes,” Nutrition, vol. 28, no. 10, pp. 1016–1021, 2012. View at: Publisher Site | Google Scholar
  42. T. D. Noakes, “Low-carbohydrate and high-fat intake can manage obesity and associated conditions: occasional survey,” South African Medical Journal, vol. 103, no. 11, pp. 826–830, 2013. View at: Publisher Site | Google Scholar
  43. J. Ratliff, G. Mutungi, M. J. Puglisi, J. S. Volek, and M. L. Fernandez, “Carbohydrate restriction (with or without additional dietary cholesterol provided by eggs) reduces insulin resistance and plasma leptin without modifying appetite hormones in adult men,” Nutrition Research, vol. 29, no. 4, pp. 262–268, 2009. View at: Publisher Site | Google Scholar
  44. J. S. Volek, M. J. Sharman, D. M. Love, N. G. Avery, T. P. Scheett, and W. J. Kraemer, “Body composition and hormonal responses to a carbohydrate-restricted diet,” Metabolism, vol. 51, no. 7, pp. 864–870, 2002. View at: Publisher Site | Google Scholar
  45. C. A. Major, M. J. Henry, M. de Veciana, and M. A. Morgan, “The effects of carbohydrate restriction in patients with diet-controlled gestational diabetes,” Obstetrics and Gynecology, vol. 91, no. 4, pp. 600–604, 1998. View at: Publisher Site | Google Scholar
  46. A. Accurso, R. K. Bernstein, A. Dahlqvist et al., “Dietary carbohydrate restriction in type 2 diabetes mellitus and metabolic syndrome: time for a critical appraisal,” Nutrition and Metabolism, vol. 5, no. 1, p. 9, 2008. View at: Publisher Site | Google Scholar
  47. R. D. Feinman, W. K. Pogozelski, A. Astrup et al., “Dietary carbohydrate restriction as the first approach in diabetes management: critical review and evidence base,” Nutrition, vol. 31, no. 1, pp. 1–13, 2015. View at: Publisher Site | Google Scholar
  48. M. K. Badman, A. R. Kennedy, A. C. Adams, P. Pissios, and E. Maratos-Flier, “A very low carbohydrate ketogenic diet improves glucose tolerance in ob/ob mice independently of weight loss,” American Journal of Physiology-Endocrinology and Metabolism, vol. 297, no. 5, pp. E1197–E1204, 2009. View at: Publisher Site | Google Scholar
  49. K. Xu, X. Sun, B. O. Eroku, C. P. Tsipis, M. A. Puchowicz, and J. C. LaManna, “Diet-induced ketosis improves cognitive performance in aged rats,” in Advances in Experimental Medicine and Biology, pp. 71–75, Springer, Berlin, Germany, 2010. View at: Google Scholar
  50. K. D. Ballard, E. E. Quann, B. R. Kupchak et al., “Dietary carbohydrate restriction improves insulin sensitivity, blood pressure, microvascular function, and cellular adhesion markers in individuals taking statins,” Nutrition Research, vol. 33, no. 11, pp. 905–912, 2013. View at: Publisher Site | Google Scholar
  51. R. A. Hawkins, A. M. Mans, and D. W. Davis, “Regional ketone body utilization by rat brain in starvation and diabetes,” American Journal of Physiology-Endocrinology and Metabolism, vol. 250, no. 2, pp. E169–E178, 1986. View at: Publisher Site | Google Scholar
  52. T. N. Seyfried and P. Mukherjee, “Targeting energy metabolism in brain cancer: review and hypothesis,” Nutrition and Metabolism, vol. 2, no. 1, p. 30, 2005. View at: Publisher Site | Google Scholar
  53. L. Laffel, “Ketone bodies: a review of physiology, pathophysiology and application of monitoring to diabetes,” Diabetes/Metabolism Research and Reviews, vol. 15, no. 6, pp. 412–426, 1999. View at: Publisher Site | Google Scholar
  54. H. Krebs, “The regulation of the release of ketone bodies by the liver,” Advances in Enzyme Regulation, vol. 4, pp. 339–353, 1966. View at: Publisher Site | Google Scholar
  55. J. McGarry and D. Foster, “Regulation of hepatic fatty acid oxidation and ketone body production,” Annual Review of Biochemistry, vol. 49, no. 1, pp. 395–420, 1980. View at: Publisher Site | Google Scholar
  56. M. T. Newport, T. B. VanItallie, Y. Kashiwaya, M. T. King, and R. L. Veech, “A new way to produce hyperketonemia: use of ketone ester in a case of Alzheimer’s disease,” Alzheimer’s and Dementia, vol. 11, no. 1, pp. 99–103, 2015. View at: Publisher Site | Google Scholar
  57. E. C. Westman, R. D. Feinman, J. C. Mavropoulos et al., “Low-carbohydrate nutrition and metabolism,” American Journal of Clinical Nutrition, vol. 86, no. 2, pp. 276–284, 2007. View at: Publisher Site | Google Scholar
  58. C. Harvey, What is Nutritional Ketosis? 2015.
  59. I. F. Kodde, J. van der Stok, R. T. Smolenski, and J. W. de Jong, “Metabolic and genetic regulation of cardiac energy substrate preference,” Comparative Biochemistry and Physiology Part A: Molecular and Integrative Physiology, vol. 146, no. 1, pp. 26–39, 2007. View at: Publisher Site | Google Scholar
  60. B. Plecko, S. Stoeckler-Ipsiroglu, E. Schober et al., “Oral β-hydroxybutyrate supplementation in two patients with hyperinsulinemic hypoglycemia: monitoring of β-hydroxybutyrate levels in blood and cerebrospinal fluid, and in the brain by in vivo magnetic resonance spectroscopy,” Pediatric Research, vol. 52, no. 2, pp. 301–306, 2002. View at: Publisher Site | Google Scholar
  61. H. White and B. Venkatesh, “Clinical review: ketones and brain injury,” Critical Care, vol. 15, no. 2, p. 219, 2011. View at: Publisher Site | Google Scholar
  62. E. P. Vining, “Clinical efficacy of the ketogenic diet,” Epilepsy Research, vol. 37, no. 3, pp. 181–190, 1999. View at: Publisher Site | Google Scholar
  63. E. H. Kossoff, B. A. Zupec-Kania, and J. M. Rho, “Ketogenic diets: an update for child neurologists,” Journal of Child Neurology, vol. 24, no. 8, pp. 979–988, 2009. View at: Publisher Site | Google Scholar
  64. G. F. Cahill Jr., “Fuel metabolism in starvation,” Annual Review of Nutrition, vol. 26, no. 1, pp. 1–22, 2006. View at: Publisher Site | Google Scholar
  65. M. Gasior, M. A. Rogawski, and A. L. Hartman, “Neuroprotective and disease-modifying effects of the ketogenic diet,” Behavioural Pharmacology, vol. 17, no. 5-6, pp. 431–439, 2006. View at: Publisher Site | Google Scholar
  66. R. de Oliveira Caminhotto and F. B. Lima, “Low carbohydrate high fat diets: when models do not match reality,” Archives of Endocrinology and Metabolism, vol. 60, no. 4, pp. 405-406, 2016. View at: Publisher Site | Google Scholar
  67. M. G. Abdelwahab, S. H. Lee, D. O’Neill et al., “Ketones prevent oxidative impairment of hippocampal synaptic integrity through K ATP channels,” PLoS One, vol. 10, no. 4, Article ID e0119316, 2015. View at: Publisher Site | Google Scholar
  68. J. X. Yin, M. Maalouf, P. Han et al., “Ketones block amyloid entry and improve cognition in an Alzheimer’s model,” Neurobiology of Aging, vol. 39, pp. 25–37, 2016. View at: Publisher Site | Google Scholar
  69. J. Zhang, Q. Cao, S. Li et al., “3-Hydroxybutyrate methyl ester as a potential drug against Alzheimer’s disease via mitochondria protection mechanism,” Biomaterials, vol. 34, no. 30, pp. 7552–7562, 2013. View at: Publisher Site | Google Scholar
  70. L. Siegel, N. I. Robin, and L. J. McDonald, “New approach to determination of total ketone bodies in serum,” Clinical Chemistry, vol. 23, no. 1, pp. 46–49, 1977. View at: Google Scholar
  71. D. J. Angus, M. Hargreaves, J. Dancey, and M. A. Febbraio, “Effect of carbohydrate or carbohydrate plus medium-chain triglyceride ingestion on cycling time trial performance,” Journal of Applied Physiology, vol. 88, no. 1, pp. 113–119, 2000. View at: Publisher Site | Google Scholar
  72. L. Misell, N. Lagomarcino, V. Schuster, and M. Kern, “Chronic medium-chain triacylglycerol consumption and endurance performance in trained runners,” Journal of Sports Medicine and Physical Fitness, vol. 41, no. 2, p. 210, 2001. View at: Google Scholar
  73. V. Ööpik, S. Timpmann, L. Medijainen, and H. Lemberg, “Effects of daily medium-chain triglyceride ingestion on energy metabolism and endurance performance capacity in well-trained runners,” Nutrition Research, vol. 21, no. 8, pp. 1125–1135, 2001. View at: Publisher Site | Google Scholar
  74. Y. M. C. Liu, “Medium-chain triglyceride (MCT) ketogenic therapy,” Epilepsia, vol. 49, no. s8, pp. 33–36, 2008. View at: Publisher Site | Google Scholar
  75. A. E. Jeukendrup, W. Saris, P. Schrauwen, F. Brouns, and A. Wagenmakers, “Metabolic availability of medium-chain triglycerides coingested with carbohydrates during prolonged exercise,” Journal of Applied Physiology, vol. 79, no. 3, pp. 756–762, 1995. View at: Publisher Site | Google Scholar
  76. A. Poff, C. Ari, P. Arnold, T. Seyfried, and D. D’Agostino, “Ketone supplementation decreases tumor cell viability and prolongs survival of mice with metastatic cancer,” International Journal of Cancer, vol. 135, no. 7, pp. 1711–1720, 2014. View at: Publisher Site | Google Scholar
  77. Y. H. Youm, K. Y. Nguyen, R. W. Grant et al., “The ketone metabolite [beta]-hydroxybutyrate blocks NLRP3 inflammasome-mediated inflammatory disease,” Nature Medicine, vol. 21, no. 3, pp. 263–269, 2015. View at: Publisher Site | Google Scholar
  78. D. P. D’Agostino, R. Pilla, H. E. Held et al., “Therapeutic ketosis with ketone ester delays central nervous system oxygen toxicity seizures in rats,” American Journal of Physiology-Regulatory, Integrative and Comparative Physiology, vol. 304, no. 10, pp. R829–R836, 2013. View at: Publisher Site | Google Scholar
  79. L. C. Gormsen, M. Svart, H. H. Thomsen et al., “Ketone body infusion with 3-hydroxybutyrate reduces myocardial glucose uptake and increases blood flow in humans: a positron emission tomography study,” Journal of the American Heart Association, vol. 6, no. 3, p. e005066, 2017. View at: Publisher Site | Google Scholar
  80. S. T. Henderson, J. L. Vogel, L. J. Barr, F. Garvin, J. J. Jones, and L. C. Costantini, “Study of the ketogenic agent AC-1202 in mild to moderate Alzheimer’s disease: a randomized, double-blind, placebo-controlled, multicenter trial,” Nutrition and Metabolism, vol. 6, no. 1, p. 31, 2009. View at: Publisher Site | Google Scholar
  81. E. Arnaiz, V. Jelic, O. Almkvist et al., “Impaired cerebral glucose metabolism and cognitive functioning predict deterioration in mild cognitive impairment,” Neuroreport, vol. 12, no. 4, pp. 851–855, 2001. View at: Publisher Site | Google Scholar
  82. C. X. Gong, F. Liu, and K. Iqbal, “Impaired brain glucose metabolism leads to Alzheimer neurofibrillary degeneration through a decrease in tau O-GlcNAcylation,” Journal of Alzheimer’s Disease, vol. 9, no. 1, pp. 1–12, 2006. View at: Publisher Site | Google Scholar
  83. C. Messier, “Impact of impaired glucose tolerance and type 2 diabetes on cognitive aging,” Neurobiology of Aging, vol. 26, no. 1, pp. 26–30, 2005. View at: Publisher Site | Google Scholar
  84. S. T. Henderson, “Ketone bodies as a therapeutic for Alzheimer’s disease,” Neurotherapeutics, vol. 5, no. 3, pp. 470–480, 2008. View at: Publisher Site | Google Scholar
  85. T. B. VanItallie and T. H. Nufert, “Ketones: metabolism’s ugly duckling,” Nutrition Reviews, vol. 61, no. 10, pp. 327–341, 2003. View at: Publisher Site | Google Scholar
  86. M. Maalouf, P. G. Sullivan, L. Davis, D. Y. Kim, and J. M. Rho, “Ketones inhibit mitochondrial production of reactive oxygen species production following glutamate excitotoxicity by increasing NADH oxidation,” Neuroscience, vol. 145, no. 1, pp. 256–264, 2007. View at: Publisher Site | Google Scholar
  87. C. B. Henderson, F. M. Filloux, S. C. Alder, J. L. Lyon, and D. A. Caplin, “Efficacy of the ketogenic diet as a treatment option for epilepsy: meta-analysis,” Journal of Child Neurology, vol. 21, no. 3, pp. 193–198, 2006. View at: Publisher Site | Google Scholar
  88. J. Sirven, B. Whedon, D. Caplan et al., “The ketogenic diet for intractable epilepsy in adults: preliminary results,” Epilepsia, vol. 40, no. 12, pp. 1721–1726, 1999. View at: Publisher Site | Google Scholar
  89. M. A. McNally and A. L. Hartman, “Ketone bodies in epilepsy,” Journal of Neurochemistry, vol. 121, no. 1, pp. 28–35, 2012. View at: Publisher Site | Google Scholar
  90. A. J. Murray, N. S. Knight, M. A. Cole et al., “Novel ketone diet enhances physical and cognitive performance,” Federation of American Societies for Experimental Biology Journal, vol. 30, no. 12, pp. 4021–4032, 2016. View at: Publisher Site | Google Scholar
  91. P. J. Pinckaers, T. A. Churchward-Venne, D. Bailey, and L. J. van Loon, “Ketone bodies and exercise performance: the next magic bullet or merely hype?” Sports Medicine, vol. 47, no. 3, pp. 383–391, 2017. View at: Publisher Site | Google Scholar
  92. T. Larsen and N. I. Nielsen, “Fluorometric determination of β-hydroxybutyrate in milk and blood plasma,” Journal of Dairy Science, vol. 88, no. 6, pp. 2004–2009, 2005. View at: Publisher Site | Google Scholar
  93. N. I. Nielsen, T. Larsen, M. Bjerring, and K. L. Ingvartsen, “Quarter health, milking interval, and sampling time during milking affect the concentration of milk constituents,” Journal of Dairy Science, vol. 88, no. 9, pp. 3186–3200, 2005. View at: Publisher Site | Google Scholar
  94. B. Stubbs, K. Willerton, S. Hiyama, K. Clarke, and P. Cox, Concomitant Meal Ingestion Alters Levels of Circulating Ketone Bodies following a Ketone Ester Drink, The Physiological Society, London, UK, 2015.
  95. K. Clarke, K. Tchabanenko, R. Pawlosky et al., “Kinetics, safety and tolerability of (R)-3-hydroxybutyl (R)-3-hydroxybutyrate in healthy adult subjects,” Regulatory Toxicology and Pharmacology, vol. 63, no. 3, pp. 401–408, 2012. View at: Publisher Site | Google Scholar
  96. K. Clarke, K. Tchabanenko, R. Pawlosky et al., “Oral 28-day and developmental toxicity studies of (R)-3-hydroxybutyl (R)-3-hydroxybutyrate,” Regulatory Toxicology and Pharmacology, vol. 63, no. 2, pp. 196–208, 2012. View at: Publisher Site | Google Scholar
  97. J. L. Van Hove, S. Grünewald, J. Jaeken et al., “D, L-3-hydroxybutyrate treatment of multiple acyl-CoA dehydrogenase deficiency (MADD),” The Lancet, vol. 361, no. 9367, pp. 1433–1435, 2003. View at: Publisher Site | Google Scholar
  98. H. Endo, M. Niioka, N. Kobayashi, M. Tanaka, and T. Watanabe, “Butyrate-producing probiotics reduce nonalcoholic fatty liver disease progression in rats: new insight into the probiotics for the gut-liver axis,” PLoS One, vol. 8, no. 5, Article ID e63388, 2013. View at: Publisher Site | Google Scholar
  99. K. M. Maslowski and C. R. Mackay, “Diet, gut microbiota and immune responses,” Nature Immunology, vol. 12, no. 1, pp. 5–9, 2011. View at: Publisher Site | Google Scholar
  100. K. M. Tuohy, L. Conterno, M. Gasperotti, and R. Viola, “Up-regulating the human intestinal microbiome using whole plant foods, polyphenols, and/or fiber,” Journal of Agricultural and Food Chemistry, vol. 60, no. 36, pp. 8776–8782, 2012. View at: Publisher Site | Google Scholar
  101. J. M. Wong, R. De Souza, C. W. Kendall, A. Emam, and D. J. Jenkins, “Colonic health: fermentation and short chain fatty acids,” Journal of Clinical Gastroenterology, vol. 40, no. 3, pp. 235–243, 2006. View at: Publisher Site | Google Scholar
  102. M. Velasquez-Manoff, “Gut microbiome: the peacekeepers,” Nature, vol. 518, no. 7540, pp. S3–S11, 2015. View at: Publisher Site | Google Scholar
  103. O. Kanauchi, T. Iwanaga, K. Mitsuyama et al., “Butyrate from bacterial fermentation of germinated barley foodstuff preserves intestinal barrier function in experimental colitis in the rat model,” Journal of Gastroenterology and Hepatology, vol. 14, no. 9, pp. 880–888, 1999. View at: Publisher Site | Google Scholar
  104. H. Yadav, J. H. Lee, J. Lloyd, P. Walter, and S. G. Rane, “Beneficial metabolic effects of a probiotic via butyrate-induced GLP-1 hormone secretion,” Journal of Biological Chemistry, vol. 288, no. 35, pp. 25088–25097, 2013. View at: Publisher Site | Google Scholar
  105. H. J. Kim, P. Leeds, and D. M. Chuang, “The HDAC inhibitor, sodium butyrate, stimulates neurogenesis in the ischemic brain,” Journal of Neurochemistry, vol. 110, no. 4, pp. 1226–1240, 2009. View at: Publisher Site | Google Scholar
  106. Y. Yamawaki, M. Fuchikami, S. Morinobu, M. Segawa, T. Matsumoto, and S. Yamawaki, “Antidepressant-like effect of sodium butyrate (HDAC inhibitor) and its molecular mechanism of action in the rat hippocampus,” World Journal of Biological Psychiatry, vol. 13, no. 6, pp. 458–467, 2012. View at: Publisher Site | Google Scholar
  107. H. V. Lin, A. Frassetto, E. J. Kowalik Jr. et al., “Butyrate and propionate protect against diet-induced obesity and regulate gut hormones via free fatty acid receptor 3-independent mechanisms,” PLoS One, vol. 7, no. 4, Article ID e35240, 2012. View at: Publisher Site | Google Scholar
  108. Z. Gao, J. Yin, J. Zhang et al., “Butyrate improves insulin sensitivity and increases energy expenditure in mice,” Diabetes, vol. 58, no. 7, pp. 1509–1517, 2009. View at: Publisher Site | Google Scholar
  109. K. M. Tuohy, H. M. Probert, C. W. Smejkal, and G. R. Gibson, “Using probiotics and prebiotics to improve gut health,” Drug Discovery Today, vol. 8, no. 15, pp. 692–700, 2003. View at: Publisher Site | Google Scholar
  110. R. B. Canani, M. Di Costanzo, and L. Leone, “The epigenetic effects of butyrate: potential therapeutic implications for clinical practice,” Clinical Epigenetics, vol. 4, no. 1, p. 4, 2012. View at: Publisher Site | Google Scholar
  111. A. Alvaro, R. Sola, R. Rosales et al., “Gene expression analysis of a human enterocyte cell line reveals downregulation of cholesterol biosynthesis in response to short-chain fatty acids,” IUBMB Life, vol. 60, no. 11, pp. 757–764, 2008. View at: Publisher Site | Google Scholar
  112. J. W. Finley, J. B. Burrell, and P. G. Reeves, “Pinto bean consumption changes SCFA profiles in fecal fermentations, bacterial populations of the lower bowel, and lipid profiles in blood of humans,” Journal of Nutrition, vol. 137, no. 11, pp. 2391–2398, 2007. View at: Publisher Site | Google Scholar
  113. E. E. Canfora, J. W. Jocken, and E. E. Blaak, “Short-chain fatty acids in control of body weight and insulin sensitivity,” Nature Reviews Endocrinology, vol. 11, no. 10, pp. 577–591, 2015. View at: Publisher Site | Google Scholar
  114. J. Darzi, G. S. Frost, and M. D. Robertson, “Do SCFA have a role in appetite regulation?” Proceedings of the Nutrition Society, vol. 70, no. 1, pp. 119–128, 2011. View at: Publisher Site | Google Scholar
  115. A. Hague, B. Singh, and C. Paraskeva, “Butyrate acts as a survival factor for colonic epithelial cells: further fuel for the in vivo versus in vitro debate,” Gastroenterology, vol. 112, no. 3, pp. 1036–1040, 1997. View at: Publisher Site | Google Scholar
  116. J. R. Davie, “Inhibition of histone deacetylase activity by butyrate,” Journal of Nutrition, vol. 133, no. 7, pp. 2485S–2493S, 2003. View at: Publisher Site | Google Scholar
  117. D. P. Stefanko, R. M. Barrett, A. R. Ly, G. K. Reolon, and M. A. Wood, “Modulation of long-term memory for object recognition via HDAC inhibition,” Proceedings of the National Academy of Sciences, vol. 106, no. 23, pp. 9447–9452, 2009. View at: Publisher Site | Google Scholar
  118. S. G. Gray, “Epigenetic treatment of neurological disease,” Epigenomics, vol. 3, no. 4, pp. 431–450, 2011. View at: Google Scholar
  119. J. Segain, D. R. De La Blétiere, A. Bourreille et al., “Butyrate inhibits inflammatory responses through NFkappa B inhibition: implications for Crohn’s disease,” Gut, vol. 47, no. 3, pp. 397–403, 2000. View at: Publisher Site | Google Scholar
  120. E. L. Vieira, A. J. Leonel, A. P. Sad et al., “Oral administration of sodium butyrate attenuates inflammation and mucosal lesion in experimental acute ulcerative colitis,” Journal of Nutritional Biochemistry, vol. 23, no. 5, pp. 430–436, 2012. View at: Publisher Site | Google Scholar
  121. A. Sabatino, R. Morera, R. Ciccocioppo et al., “Oral butyrate for mildly to moderately active Crohn’s disease,” Alimentary Pharmacology and Therapeutics, vol. 22, no. 9, pp. 789–794, 2005. View at: Publisher Site | Google Scholar
  122. A. Kotunia, J. Wolinski, D. Laubitz et al., “Effect of sodium butyrate on the small intestine,” Journal of Physiology and Pharmacology, vol. 55, no. 2, pp. 59–68, 2004. View at: Google Scholar
  123. Y. Furusawa, Y. Obata, S. Fukuda et al., “Commensal microbe-derived butyrate induces the differentiation of colonic regulatory T cells,” Nature, vol. 504, no. 7480, pp. 446–450, 2013. View at: Publisher Site | Google Scholar
  124. H. M. Hamer, D. Jonkers, K. Venema, S. Vanhoutvin, F. Troost, and R. J. Brummer, “Review article: the role of butyrate on colonic function,” Alimentary Pharmacology and Therapeutics, vol. 27, no. 2, pp. 104–119, 2008. View at: Publisher Site | Google Scholar
  125. D. F. MacFabe, N. E. Cain, F. Boon, K. P. Ossenkopp, and D. P. Cain, “Effects of the enteric bacterial metabolic product propionic acid on object-directed behavior, social behavior, cognition, and neuroinflammation in adolescent rats: relevance to autism spectrum disorder,” Behavioural Brain Research, vol. 217, no. 1, pp. 47–54, 2011. View at: Publisher Site | Google Scholar
  126. D. F. MacFabe, D. P. Cain, K. Rodriguez-Capote et al., “Neurobiological effects of intraventricular propionic acid in rats: possible role of short chain fatty acids on the pathogenesis and characteristics of autism spectrum disorders,” Behavioural Brain Research, vol. 176, no. 1, pp. 149–169, 2007. View at: Publisher Site | Google Scholar
  127. N. Kratsman, D. Getselter, and E. Elliott, “Sodium butyrate attenuates social behavior deficits and modifies the transcription of inhibitory/excitatory genes in the frontal cortex of an autism model,” Neuropharmacology, vol. 102, pp. 136–145, 2016. View at: Publisher Site | Google Scholar
  128. M. W. Bourassa, I. Alim, S. J. Bultman, and R. R. Ratan, “Butyrate, neuroepigenetics and the gut microbiome,” Physiological Reviews, vol. 81, pp. 1031–1064, 2001. View at: Google Scholar
  129. N. I. McNeil, J. Cummings, and W. James, “Short chain fatty acid absorption by the human large intestine,” Gut, vol. 19, no. 9, pp. 819–822, 1978. View at: Publisher Site | Google Scholar
  130. O. C. Velazquez, H. M. Lederer, and J. L. Rombeau, Butyrate and the Colonocyte. Dietary Fiber in Health and Disease, Springer, Berlin, Germany, 1997.
  131. G. Sandle, “Salt and water absorption in the human colon: a modern appraisal,” Gut, vol. 43, no. 2, pp. 294–299, 1998. View at: Publisher Site | Google Scholar
  132. R. Havenaar, “Intestinal health functions of colonic microbial metabolites: a review,” Beneficial Microbes, vol. 2, no. 2, pp. 103–114, 2011. View at: Publisher Site | Google Scholar
  133. R. B. Canani, G. Terrin, P. Cirillo et al., “Butyrate as an effective treatment of congenital chloride diarrhea,” Gastroenterology, vol. 127, no. 2, pp. 630–634, 2004. View at: Publisher Site | Google Scholar
  134. J. Butzner, R. Parmar, C. Bell, and V. Dalal, “Butyrate enema therapy stimulates mucosal repair in experimental colitis in the rat,” Gut, vol. 38, no. 4, pp. 568–573, 1996. View at: Publisher Site | Google Scholar
  135. H. Li, Z. Gao, J. Zhang et al., “Sodium butyrate stimulates expression of fibroblast growth factor 21 in liver by inhibition of histone deacetylase 3,” Diabetes, vol. 61, no. 4, pp. 797–806, 2012. View at: Publisher Site | Google Scholar
  136. X. Zhang, D. C. Yeung, M. Karpisek et al., “Serum FGF21 levels are increased in obesity and are independently associated with the metabolic syndrome in humans,” Diabetes, vol. 57, no. 5, pp. 1246–1253, 2008. View at: Publisher Site | Google Scholar
  137. F. Hird and R. Symons, “The mechanism of ketone-body formation from butyrate in rat liver,” Biochemical Journal, vol. 84, no. 1, pp. 212–216, 1962. View at: Publisher Site | Google Scholar
  138. R. Linskens, X. Huijsdens, P. Savelkoul, C. Vandenbroucke-Grauls, and S. Meuwissen, “The bacterial flora in inflammatory bowel disease: current insights in pathogenesis and the influence of antibiotics and probiotics,” Scandinavian Journal of Gastroenterology, vol. 36, no. 234, pp. 29–40, 2001. View at: Publisher Site | Google Scholar
  139. R. B. Sartor, “Therapeutic manipulation of the enteric microflora in inflammatory bowel diseases: antibiotics, probiotics, and prebiotics,” Gastroenterology, vol. 126, no. 6, pp. 1620–1633, 2004. View at: Publisher Site | Google Scholar
  140. A. K. Taggart, J. Kero, X. Gan et al., “(D)-β-hydroxybutyrate inhibits adipocyte lipolysis via the nicotinic acid receptor PUMA-G,” Journal of Biological Chemistry, vol. 280, no. 29, pp. 26649–26652, 2005. View at: Publisher Site | Google Scholar
  141. B. Egan and D. P. D’Agostino, “Fueling performance: ketones enter the mix,” Cell Metabolism, vol. 24, no. 3, pp. 373–375, 2016. View at: Publisher Site | Google Scholar
  142. A. J. Murray and H. E. Montgomery, “How wasting is saving: Weight loss at altitude might result from an evolutionary adaptation,” Bioessays, vol. 36, pp. 721–729, 2014. View at: Google Scholar
  143. C. C. Blad, K. Ahmed, A. P. Ijzerman, and S. Offermanns, “Biological and pharmacological roles of HCA receptors,” Advances in Pharmacology, vol. 62, pp. 219–250, 2014. View at: Publisher Site | Google Scholar
  144. S. Offermanns and M. Schwaninger, “Nutritional or pharmacological activation of HCA 2 ameliorates neuroinflammation,” Trends in Molecular Medicine, vol. 21, no. 4, pp. 245–255, 2015. View at: Publisher Site | Google Scholar
  145. S. Offermanns, “Free fatty acid (FFA) and hydroxy carboxylic acid (HCA) receptors,” Annual Review of Pharmacology and Toxicology, vol. 54, no. 1, pp. 407–434, 2014. View at: Publisher Site | Google Scholar
  146. S. Offermanns, S. L. Colletti, T. W. Lovenberg, G. Semple, A. Wise, and A. P. Ijzerman, “International union of basic and clinical pharmacology. LXXXII: nomenclature and classification of hydroxy-carboxylic acid receptors (GPR81, GPR109A, and GPR109B),” Pharmacological Reviews, vol. 63, no. 2, pp. 269–290, 2011. View at: Publisher Site | Google Scholar
  147. J. B. Milder, L. P. Liang, and M. Patel, “Acute oxidative stress and systemic Nrf2 activation by the ketogenic diet,” Neurobiology of Disease, vol. 40, no. 1, pp. 238–244, 2010. View at: Publisher Site | Google Scholar
  148. M. Storoni and G. T. Plant, “The therapeutic potential of the ketogenic diet in treating progressive multiple sclerosis,” Multiple Sclerosis International, vol. 2015, Article ID 681289, 9 pages, 2015. View at: Publisher Site | Google Scholar
  149. M. Sandberg, J. Patil, B. D’angelo, S. G. Weber, and C. Mallard, “NRF2-regulation in brain health and disease: implication of cerebral inflammation,” Neuropharmacology, vol. 79, pp. 298–306, 2014. View at: Publisher Site | Google Scholar
  150. H. C. Huang, T. Nguyen, and C. B. Pickett, “Phosphorylation of Nrf2 at Ser-40 by protein kinase C regulates antioxidant response element-mediated transcription,” Journal of Biological Chemistry, vol. 277, no. 45, pp. 42769–42774, 2002. View at: Publisher Site | Google Scholar
  151. J. Vriend and R. J. Reiter, “The Keap1-Nrf2-antioxidant response element pathway: a review of its regulation by melatonin and the proteasome,” Molecular and Cellular Endocrinology, vol. 401, pp. 213–220, 2015. View at: Publisher Site | Google Scholar
  152. N. Wei, D. Yuan, H. B. He et al., “Saponins from Panax japonicas reduces myocardial infarction induced reactive oxygen species production and cardiomyocyte apoptosis via activation of the Nrf-2 pathway,” Advanced Materials Research, vol. 881–883, pp. 339–346, 2014. View at: Publisher Site | Google Scholar
  153. J. S. Lee and Y. J. Surh, “Nrf2 as a novel molecular target for chemoprevention,” Cancer Letters, vol. 224, no. 2, pp. 171–184, 2005. View at: Publisher Site | Google Scholar
  154. S. Braun, C. Hanselmann, M. G. Gassmann et al., “Nrf2 transcription factor, a novel target of keratinocyte growth factor action which regulates gene expression and inflammation in the healing skin wound,” Molecular and Cellular Biology, vol. 22, no. 15, pp. 5492–5505, 2002. View at: Publisher Site | Google Scholar
  155. A. Y. Shih, S. Imbeault, V. Barakauskas et al., “Induction of the Nrf2-driven antioxidant response confers neuroprotection during mitochondrial stress in vivo,” Journal of Biological Chemistry, vol. 280, no. 24, pp. 22925–22936, 2005. View at: Publisher Site | Google Scholar
  156. J. M. Lee, A. Y. Shih, T. H. Murphy, and J. A. Johnson, “NF-E2-related factor-2 mediates neuroprotection against mitochondrial complex I inhibitors and increased concentrations of intracellular calcium in primary cortical neurons,” Journal of Biological Chemistry, vol. 278, no. 39, pp. 37948–37956, 2003. View at: Publisher Site | Google Scholar
  157. R. K. Thimmulappa, K. H. Mai, S. Srisuma, T. W. Kensler, M. Yamamoto, and S. Biswal, “Identification of Nrf2-regulated genes induced by the chemopreventive agent sulforaphane by oligonucleotide microarray,” Cancer Research, vol. 62, no. 18, pp. 5196–5203, 2002. View at: Google Scholar
  158. R. K. Thimmulappa, C. Scollick, K. Traore et al., “Nrf2-dependent protection from LPS induced inflammatory response and mortality by CDDO-Imidazolide,” Biochemical and Biophysical Research Communications, vol. 351, no. 4, pp. 883–889, 2006. View at: Publisher Site | Google Scholar
  159. K. U. Tufekci, E. Civi Bayin, S. Genc, and K. Genc, “The Nrf2/ARE pathway: a promising target to counteract mitochondrial dysfunction in Parkinson’s disease,” Parkinson’s Disease, vol. 2011, p. 314082, 2011. View at: Publisher Site | Google Scholar
  160. X. He, H. Kan, L. Cai, and Q. Ma, “Nrf2 is critical in defense against high glucose-induced oxidative damage in cardiomyocytes,” Journal of Molecular and Cellular Cardiology, vol. 46, no. 1, pp. 47–58, 2009. View at: Publisher Site | Google Scholar
  161. Y. Tan, T. Ichikawa, J. Li et al., “Diabetic downregulation of Nrf2 activity via ERK contributes to oxidative stress–induced insulin resistance in cardiac cells in vitro and in vivo,” Diabetes, vol. 60, no. 2, pp. 625–633, 2011. View at: Publisher Site | Google Scholar
  162. H. Zheng, S. A. Whitman, W. Wu et al., “Therapeutic potential of Nrf2 activators in streptozotocin-induced diabetic nephropathy,” Diabetes, vol. 60, no. 11, pp. 3055–3066, 2011. View at: Publisher Site | Google Scholar
  163. J. M. Lee, J. Li, D. A. Johnson et al., “Nrf2, a multi-organ protector?” Federation of American Societies for Experimental Biology, vol. 19, no. 9, pp. 1061–1066, 2005. View at: Publisher Site | Google Scholar
  164. A. Neymotin, N. Y. Calingasan, E. Wille et al., “Neuroprotective effect of Nrf2/ARE activators, CDDO ethylamide and CDDO trifluoroethylamide, in a mouse model of amyotrophic lateral sclerosis,” Free Radical Biology and Medicine, vol. 51, no. 1, pp. 88–96, 2011. View at: Publisher Site | Google Scholar
  165. S. Yu, T. O. Khor, K. L. Cheung et al., “Nrf2 expression is regulated by epigenetic mechanisms in prostate cancer of TRAMP mice,” PLoS One, vol. 5, no. 1, Article ID e8579, 2010. View at: Publisher Site | Google Scholar
  166. H. Nagatomo, Y. Morimoto, A. Ogami et al., “Change of heme oxygenase-1 expression in lung injury induced by chrysotile asbestos in vivo and in vitro,” Inhalation Toxicology, vol. 19, no. 4, pp. 317–323, 2007. View at: Publisher Site | Google Scholar
  167. S. Suzuki, L. Toledo-Pereyra, F. Rodriguez, and D. Cejalvo, “Neutrophil infiltration as an important factor in liver ischemia and reperfusion injury,” Transplantation, vol. 55, no. 6, pp. 1265–1272, 1993. View at: Publisher Site | Google Scholar
  168. P. Bowman, Amelioration of Ischemia/Reperfusion Injury During Resuscitation from Hemorrhage by Induction of Heme Oxygenase-1 (HO-1) in a Conscious Mouse Model of Uncontrolled Hemorrhage, DTIC Document, 2012.
  169. R. Hinkel, B. Petersen, M. Thormann et al., “hHO-1 overexpression in transgenic pigs is cardioprotective after acute myocardial ischemia and reperfsuion,” Circulation, vol. 120, no. 18, p. S1042, 2009. View at: Google Scholar
  170. T. Yoshida, M. Watanabe, D. T. Engelman et al., “Transgenic mice overexpressing glutathione peroxidase are resistant to myocardial ischemia reperfusion injury,” Journal of Molecular and Cellular Cardiology, vol. 28, no. 8, pp. 1759–1767, 1996. View at: Publisher Site | Google Scholar
  171. N. S. Dhalla, A. B. Elmoselhi, T. Hata, and N. Makino, “Status of myocardial antioxidants in ischemia–reperfusion injury,” Cardiovascular Research, vol. 47, no. 3, pp. 446–456, 2000. View at: Publisher Site | Google Scholar
  172. W. Dong, Y. Jia, X. Liu et al., “Sodium butyrate activates NRF2 to ameliorate diabetic nephropathy possibly via inhibition of HDAC,” Journal of Endocrinology, vol. 232, no. 1, pp. 71–83, 2017. View at: Publisher Site | Google Scholar
  173. X. Chen, W. Su, T. Wan et al., “Sodium butyrate regulates Th17/Treg cell balance to ameliorate uveitis via the Nrf2/HO-1 pathway,” Biochemical Pharmacology, vol. 142, pp. 111–119, 2017. View at: Publisher Site | Google Scholar
  174. X. Hu, K. Zhang, C. Xu, Z. Chen, and H. Jiang, “Anti-inflammatory effect of sodium butyrate preconditioning during myocardial ischemia/reperfusion,” Experimental and Therapeutic Medicine, vol. 8, no. 1, pp. 229–232, 2014. View at: Publisher Site | Google Scholar
  175. S. Yano and D. F. Tierney, “Butyrate increases catalase activity and protects rat pulmonary artery smooth muscle cells against hyperoxia,” Biochemical and Biophysical Research Communications, vol. 164, no. 3, pp. 1143–1148, 1989. View at: Publisher Site | Google Scholar
  176. M. E. Walsh, A. Bhattacharya, K. Sataranatarajan et al., “The histone deacetylase inhibitor butyrate improves metabolism and reduces muscle atrophy during aging,” Aging Cell, vol. 14, no. 6, pp. 957–970, 2015. View at: Publisher Site | Google Scholar

Copyright

Copyright © 2018 Franco Cavaleri and Emran Bashar. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.



Ketogeeninen ruokavalio: neuromuskulaarisiset ja neurodegeneratiiviset taudit

Neuromuskulaariset sairaudet ovat joukko sairauksia, jotka vaikuttavat lihaksia sääteleviin hermoihin tai heikentävät itse lihaksia. Esimerkiksi ALS.

Neurodegeneratiivinen sairaus on yleistermi useille sairauksille, jotka rappeuttavat aivojen ja keskushermoston soluja, kuten neuroneja. Neuronit eivät yleensä uusiudu tai korjaa itseään, joten jos ne surkastuvat ja kuolevat, elimistö ei voi korvata niitä. Neurodegeneratiivisia sairauksista ovat mm. Parkinsonin tauti, Alzheimerin tauti ja Huntingtonin tauti.

Johdanto

Päivä päivältä useammat tutkimukset osoittavat ketogeenisten ruokavalioiden kiistattomat hyödyt metabolisten sairauksien, kuten lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoidossa.

Olen ketoillut puolivallattomasti joulukuun alusta alkaen. Joulukuun 2. päivän ja tämän päivän väliin mahtuu useita horjahduksia olut-, makeis- ja burgeriseikkailuineen. Paino on laskenut ~13 kiloa. Verensokeri pysyy KD:llä optimaalisena ja verenpaine hyvällä tasolla. Oloni on hyvin motivoitunut ja aktiivinen. Arkista huuhailua ei haittaa nälkä tai aivosumu.

Neurologisten häiriöiden osalta ketogeeninen ruokavalio hyväksytään tehokkaaksi terapiaksi farmakoresistentin epilepsian hoidossa, mutta uudet tutkimukset viittaavat siihen, että ketogeeninen ruokavalio voi olla hyödyllinen myös amyotrofisen lateraaliskleroosin (ALS), Alzheimerin- ja Parkinsonin taudin sekä eräiden mitokondriopatioiden yhteydessä.

Esittelin Ruokasodassa aimmin tutkimuskatsauksen, jonka mukaan ketogeeninen ruokavalio voi hidastaa myös multippeliskleroosin etenemistä.

Vaikka näillä sairauksilla on erilaiset patogeneesit, on olemassa eräitä yleisiä mekanismeja, jotka voivat selittää ketogeenisten ruokavalioiden hyötyjä:

  1. ketogeenisen ruokavalion metaboliset mekanismit tarjoavat tehokkaan energianlähteen sellaisten neurodegeneratiivisten sairauksien hoidossa, joille on tunnusomaista fokaalinen aivojen hypometabolia, eli solujen energiansaannin heikkeneminen
  2. ketogeeninen ruokavalio vähentää erityyppisiin metabolisiin stresseihin liittyviä oksidatiivisia vaurioita ja inflammaatiota
  3. ketogeeninen ruokavalio lisää mitokondrioiden biogeneesireittejä
  4. ketonit ohittavat joihinkin neurologisiin sairauksiin liittyvän kompleksin I aktiivisuuteen liittyvän vian

Tässä katsauksessa tutustutaan ketogeenisen ruokavalion neuroprotektiivisiin aineenvaihduntamekanismeihin

Yksittäisillä ravintoaineilla voi olla positiivisia vaikutuksia luurankolihasten terveyteen. Lisäksi ravintoaineiden yhdistelmät voivat vaimentaa joidenkin hermo-lihassairauksien oireita. Toisaalta tiedetään myös, että laihduttamisen vaikutukset terveyteen liittyvät eri makro- ja hivenravinteiden keskinäiseen saantisuhteeseen, eikä niinkään yksittäisin ravintoaineeseen.

Ketogeeninen ruokavalio (KD) on viime vuosina herättänyt suurta kiinnostusta. 1900-luvun kolmannelta vuosikymmeneltä lähtien ketogeenistä ruokavaliota on käytetty farmakologisesti resistentin epilepsian hoitoon [1–3]. Viime aikoina KD:n on havaittu olevan toimiva terapia myös monissa täysin erilaisissa sairauksissa, kuten lihavuus [4], PCOS [5], syöpä [1, 6, 7], diabetes [8] ja muut patologiset tilat [9– 11].

Vaikka monet tutkimukset ovat osoittaneet KD:n potentiaaliset positiiviset vaikutukset moniin neurologisiin ja hermo-lihassairauksiin, vain harvat tutkimukset ovat tutkineet tämän lupaavan ravitsemuksellisen lähestymistavan mekanismeja [12].

Tämän katsauksen tarkoituksena on tarkastella KD:n roolia hermostoon ja lihasten toimintaan vaikuttavissa sairauksissa.

Ketogeenisessä ruokavaliossa

Muutaman päivän paastoamisen tai hiilihydraattien huomattavan rajoittamisen (alle 20 g päivässä) seurauksena glukoosivarastot eivät riitä:

  1. normaaliin rasvan hapettumiseen oksaloasetaatin syöttämisen kautta sitruunahappokierrossa (Krebsin syklissä, TCA-sykli) ja
  2. keskushermoston glukoositarpeen tyydyttämiseen [13, 14] (kuva 1)

Keskushermostossa glukoosia tarvitaan energia lähteeksi, sekä tuottamaan pyruvaatteja, jotka voidaan edelleen muuntaa oksaloasetaatiksi.

Oksaloasetaatin määrän tulisi pysyä tasolla, joka on riittävä sitruunahappokierron toiminnan (ts. asetyyli-CoA:n ja oksaloasetaatin välinen kondensaatio) mahdollistamiseksi.

Oksaloasetaatti on epävakaa ja se on uudelleenkoottava (tällaisia reaktioita kutsutaan anaplerooteiksi). Elimistölle helpoin tapa tuottaa oksaloasetaattia on pyruvaatista, joka saadaan glukoosista.

Oksaloetikkahappo (oksaloasetaatti) on ketodikarboksyylihappoihin kuuluva orgaaninen yhdiste. Oksaloetikkahappo on välituote useissa biokemiallisesti tärkeissä reaktioissa.

Sitruunahappokierron ensimmäisessä vaiheessa oksaloetikkahappo ja asetyylikoentsyymi-A reagoivat sitraattisyntaasientsyymin katalysoimana muodostaen sitruunahappoa. Reaktiossa asetyyliryhmä siirretään oksaloetikkahapon ketonihiileen ja karbonyyliryhmä pelkistetään hydroksyyliryhmäksi.

Oksaloetikkahappoa muodostuu sitruunahappokierron kymmenennessä vaiheessa, kun omenahappo dehydrataan malaattidehydrogenaasientsyymin avulla.

Glukoneogeneesin ensimmäisessä vaiheessa palorypälehappo muutetaan oksaloetikkahapoksi. Reaktio kuluttaa ATP-molekyylin ja sitä katalysoi pyruvaattikarboksylaasientsyymi.

Glukoneogeneesin toisessa vaiheessa oksaloetikkahappo muutetaan fosfoenolipalorypälehapoksi. Reaktiossa tarvittava energia saadaan hydrolysoimalla yksi gyanosiinitrifosfaatin korkeaenergiainen fosfaattiryhmä. Reaktiossa muodostuu lisäksi hiilidioksidia ja guanosiinidifosfaattia. Reaktiota katalysoi fosfoenolipyruvaattikarboksikinaasi.

Eliöt voivat tuottaa aminohappo asparagiinihappoa oksaloetikkahaposta. Asparagiinihappoa syntyy, kun oksaloetikkahappo ja glutamiinihappo reagoivat. Reaktio on transaminaatioreaktio ja sitä katalysoi eräs transaminaasien luokkaan kuuluva entsyymi, aspartaattiaminotransferaasi. Koentsyyminä toimii pyridoksaalifosfaatti. – Wikipedia

Nisäkkäillä pyruvaattia ei voida tuottaa asetyylikoentsyymi-A:sta, kuten kuvassa on esitetty.

(1) Oksaloasetaatti on ruumiin normaalilämmössä melko epävakaa molekyyli. Sitä ei voi varastoida mitokondrioiden matriksiin. Tässä ”glukoosinpuutos” -tilassa tarvitaan oksaloasetaattia trikarboksyylihapposyklin tehokkaan toiminnan varmistamiseksi. Oksaloasetaatti toimitetaan anapleroottisyklin kautta, joka syntetisoi oksaloasetaatin glukoosista pyruviinihapon ATP-riippuvaisen karboksyloinnin kautta pyruvaattikarboksylaasilla [15].

(2) Koska keskushermosto ei voi käyttää vapaita rasvahappoja (FFA) betaoksidaatiossa suoraan energialähteenä (vapaat rasvahapot eivät läpäise veri-aivoestettä), keskushermosto käyttää yleensä solujen energiasubstraattina glukoosia.

3-4 päivän kuluttua hiilihydraattien saannin rajoittamisesta, keskushermoston on löydettävä soluille vaihtoehtoinen energialähde, kuten Felig et al. [13, 14, 16, 17] ovat osoittaneet. Vaihtoehtoisen energianlähteen soluille tarjoavat maksan tuottamat ketoaineet (KB): asetoasetaatti (AcAc), 3-hydroksibutyraatti (3HB, beta-hydroksibutyraatti) ja asetoni [18], joita saadaan asetyylikoentsyymi-A:n ylituotannosta ilman oksaloasetaatin samanaikaista tuotantoa. Energiasubstraateiksi kelpaavia ketoaineita sytyy ketogeneesissä. Ketogeneesiä tapahtuu pääasiassa maksan mitokondrioiden matriksissa [19].

Maksa tuottaa ketoaineita, mutta ei pysty käyttämään niitä, koska maksassa ei ole sukkinyyli-CoA: 3-CoA transferaasi (SCOT) -entsyymiä, jota tarvitaan asetoasetaatin muuttamiseksi asetyylikoentsyymi-A:ksi [18]. maksan ketogeneesissä syntetisoidaan asetoasetaattia, mutta ensisijainen verenkierrossa kiertävä ketoaine on 3-hydroksibutyraatti, eli beta-hydroksibutyraatti.

Normaaleissa olosuhteissa vapaan asetoasetaatin tuotanto on vähäistä ja se voi metaboloitua useissa kudoksissa, kuten luurankolihaksessa ja sydämessä. Asetoasetaatin ylituotanto-olosuhteissa sitä syntyy normaalia enemmän, mutta osa siitä syntetisoidaan kahdeksi muuksi ketoaineeksi.

Korkea ketoaineiden taso veressä ja niiden eliminaatio virtsan kautta aiheuttaa ketonemiaa ja ketonuriaa. Normaaleissa olosuhteissa ketoaineiden pitoisuus on yleensä hyvin matala (<0,3 mmol / l) verrattuna glukoosiin (noin 4-5 mmol / l) [20, 21].

Kun ketoaineet ovat saavuttaneet noin 4 mmol / l konsentraation, keskushermosto alkaa käyttää niitä energialähteenä [21]. Kudokset käyttävät ketoaineita energialähteenä [19, 21, 23] aineenvaihduntareitin kautta, joka muuntaa ensin beta-hydroksibutyraatin (3HB) takaisin asetyyliasetaatiksi, joka sitten muutetaan asetoasetyylikoentsyymi-A:ksi. Jälkimmäinen jaetaan lopulta kahteen asetyylkoentsyymi-A-molekyyliksi, joita käytetään myöhemmin sitruunahappokierrossa (kuva 2).

On mielenkiintoista huomata, että verensokeriin verrattuna ketoaineet pystyvät tuottamaan suuremman energiamäärän johtuen niiden aiheuttamista mitokondrioiden ATP-tuotannon muutoksista [21, 24, 25].

Ruokavalion hiilihydraattien vähentynyt saatavuus johtaa lisääntyneeseen ketoaineiden tuotantoon maksassa. Maksa ei voi käyttää ketoaineita, koska siitä puuttuu mitokondrioiden tarvitsema entsyymi sukkinyyli-CoA: 3-ketohappo (oksohappo) CoA-transferaasi (SCOT), jota tarvitaan asetoasetaatin aktivaatioon asetoasetyyli-CoA:ksi. Ketoaineita hyödyntävät kudokset, erityisesti aivot. Ketoaineet siirtyvät sitruunahappokiertoon muututtuaan asetyylikoentsyymi-A:ksi sukkinyyli-CoA: 3-CoA-transferaasin (SCOT) ja metyyliasetoasetyyli-CoA-tiolaasin (MAT) avulla. Vaikka glukoosi on vähentynyt, se pysyy fysiologisilla tasoilla [26, 27] johtuen kahdesta päälähteestä:

(1) glukogeenisista aminohapoista ja
(2) triglyserideistä hajotuksen kautta vapautuneesta glyserolista [28, 29]

Fysiologisen ketoosin (nopea tai erittäin vähäkalorinen ketogeeninen ruokavalio) aikana ketonemia saavuttaa maksimiarvot 7/8 mmol / l ilman pH:n muutoksia, kun taas hallitsemattomassa diabeettisessa ketoasidoosissa ketoaineiden pitoisuus voi ylittää 20 mmol / l, kun veren pH laskee samanaikaisesti.

Terveiden ihmisten veren ketoaineiden pitoisuudet eivät ylitä 8 mmol / l, koska keskushermosto (CNS) käyttää näitä molekyylejä tehokkaasti energiasubstraatteina glukoosin sijasta [16]. Taulukossa veren ketoaineiden tasot normaalin ruokavalion ja ketogeenisen ruokavalion aikana (ts. 20 grammaa hiilihydraatteja päivässä) sekä diabeettinen ketoasidoosi [10] .

Ketogeeninen ruokavalio imitoi paastoa ja sen aineenvaihduntamekanismeja

Perinteisesti lääkärit vierastavat ketoosia, koska he yhdistävät ketoosin insuliinin puutteesta johtuvaan vaikeaan hyperketonemiaan, joka voi aiheuttaa vakavan ketoasidoosin ja kuoleman tyypin 1 diabetesta sairastavilla henkilöillä.

Hans Krebs oli ensimmäinen, joka käytti termiä ”fysiologinen ketoosi” erottaakseen paaston ja ketogeenisen ruokavalion aiheuttaman lievän (8 mmol / l ketonipitoisuuden) ketoosin metabolisesti epätasapainoisen diabeteksen ”patologisesta ketoasidoosista” [31].

Paaston tai aliravitsemuksen jaksot ovat siinä mielessä ketogeenisiä [23], että insuliinin ja glukoosin pitoisuudet laskevat, kun taas glukagonin pitoisuudet kasvavat normaalia verensokeritason ylläpitämiseksi. Kun keho siirtyy ravinnon runsauden tilasta ravinnon puutteen tilaan (ketoosiin esimerkiksi ketogeenisen ruokavalion simuloidun ravinnon puutteen kautta), veren vapaiden rasvahappojen (FFA) ja ketoaineiden pitoisuus kasvaa pienellä viiveellä.

Tästä näkökulmasta tarkasteltuna ketogeenistä ruokavaliota voidaan verrata kalorirajoitukseen, aliravitsemukseen tai paastoamiseen. Tämä ravinteiden saannin metabolisen vasteen manipulointi, sekä määrällisesti että laadullisesti, vaikuttaa sekä verensokeriin että ketoaineisiin. Sillä on myös kyky edistää aineenvaihduntareittien ja soluprosessien, kuten stressiresistenssin ja autofagian muutoksia.

Ketogeeniset ruokavaliot voivat toimia myös samalla tavalla kuin kalorirajoitus (CR) AMPK:lla ja SIRT-1:llä [33]. Jotta ymmärtäisimme ketogeenisen ruokavalion monimutkaiset vaikutukset ja mekanismit elimistössä, meidän on otettava huomioon nämä solunsisäiset molekyylitason aineenvaihduntareitit.

PGC1α aktivoituu fosforyloidussa tilassa. Fosforyloitu PGC1α siirtyy sytosolista solun tumaan, jossa se edistää rasvahappojen kuljetusta, rasvan hapettumista ja oksidatiivista fosforylaatiota sekä osallistuvien geenien transkriptiota [34].

PGC1α voidaan fosforyloida useiden eri aineenvaihduntareittien kautta, kuten AMPK, kalsium-kalmoduliinista riippuvainen proteiinikinaasi ja p38-mitogeeniaktivoitunut proteiinikinaasireitti [35]. PGC1α voidaan aktivoida myös SIRT1-välitteisellä deasetylaatiolla [36]. AMPK voi toimia joko PGC1α:n fosforyloimalla tai suoraan.

AMPK-aktivointi estää myös mTOR-signaloinnin. Vaikuttaa kuitenkin epäjohdonmukaiselta estää tärkeä kasvuvälitteinen reitti (mTOR), joka säätelee lihasmassaa, jotta luurankolihakset voivat kasvaa.

Ravinteiden manipulointi vaikuttaa näihin aineenvaihduntareitteihin; esim. hiilihydraattien puutteellinen saanti stimuloi in vivo AMPK:n ja SIRT-1:n aktivaatiota, lisäämällä AMPK:n fosforylaatiota ja PGC1α:n deasetylointia luurankolihaksissa vaikuttamatta AMPK:n, PGC1α:n tai SIRT 1: n kokonaismäärään.

Nämä mekanismit näyttävät aktivoituvan muutaman tunnin (5 tunnin) paaston jälkeen hiirillä [39]. Aktivoiduttuaan SIRT1 ja AMPK tuottavat hyödyllisiä vaikutuksia glukoosin homeostaasissa ja insuliinimetaboliassa [40].

Askel vaikeampaan: mikä helvetin AMPK?


Tämä on teknisempää settiä. 5′-AMP-aktivoitu proteiinikinaasi, AMPK tai 5′-adenosiinimonofosfaatilla aktivoitu proteiinikinaasi on entsyymi, jolla on suuri vaikutus soluenergian homeostaasissa.

AMPK vaikuttaa erityisesti aktivoimalla glukoosin ja rasvahappojen imeytymistä ja hapettumista, kun solujen energiataso on matala. AMPK:ta ei tule sekoittaa cAMP-aktivoituun proteiinikinaasiin.

AMPK koostuu kolmesta proteiinista (α, β, γ -alayksiköistä), jotka yhdessä muodostavat toiminnallisen entsyymin. AMPK ilmentyy useissa kudoksissa, kuten maksassa, aivoissa ja luurankolihaksissa.

AMPK-aktivaation nettovaikutus vasteena AMP:n ja ADP:n sitoutumiselle on maksan rasvahappojen hapettumisen stimulointi, ketogeneesi, luustolihasten rasvahappojen hapettumisen stimulointi ja glukoosin imeytymisen tehostaminen, kolesterolisynteesin esto, lipogeneesin ja triglyseridisynteesin esto sekä, rasvasolujen lipogeneesin ja lipolyysin esto ja insuliinin erityksen modulointi haiman beetasoluista.

Kullakin AMPK:n kolmella alayksiköllää on erityinen rooli AMPK:n vakaudessa ja aktiivisuudessa. Vaikka AMPK:N yleisimmät isoformit, jotka ilmentyvät useimmissa soluissa, ovat α1-, β1- ja γ1-isoformeja, on osoitettu, että α2-, β2-, γ2- ja γ3-isoformit ilmentyvät myös sydämen ja luuston lihaksissa.
Johtuen AMPK:n komponenttien isoformeista, nisäkkäillä on 12 versiota AMPK:sta, joista jokaisella voi olla erilainen kudospaikannus ja erilaiset toiminnot eri olosuhteissa. AMPK:ta säännellään allosterisesti ja translaation jälkeisillä muokkauksilla, jotka toimivat yhdessä. Jos AMPK:n alfa-alayksikön tähde T172 fosforyloidaan, AMPK aktivoituu; fosfataasien pääsy tähän jäännökseen estetään, jos AMP tai ADP voivat estää pääsyn ja ATP voi syrjäyttää AMP:n ja ADP:n.

AMPK:ta säätelee allosterisesti enimmäkseen kilpaileva sitoutuminen gamma-alayksikköön ATP:n (joka sallii fosfataasipääsyn T172: een) ja AMP:n tai ADP:n (joista kukin estää pääsyn fosfataaseihin) välillä.

Näin ollen näyttää siltä, että AMPK on AMP / ATP- tai ADP / ATP-suhteiden ja siten solujen energiatason anturi.

On eräitä aineenvaihduntamekanismeja, joilla insuliini, leptiini ja diasyyliglyseroli estävät AMPK: ta indusoimalla erilaisia muita fosforylaatioita. AMPK:ta voidaan estää tai aktivoida erilaisilla kudosspesifisillä ubikitinaatioilla. Sitä säätelevät myös useat proteiini-proteiini-vuorovaikutukset, ja hapettavat tekijät voivat joko aktivoida tai estää niitä. Kun AMPK fosforyloi asetyyli-CoA-karboksylaasi 1: tä (ACC1) tai sterolia säätelevää elementtiä sitovaa proteiinia 1c (SREBP1c), se estää rasvahappojen, kolesterolin ja triglyseridien synteesiä ja aktivoi rasvahappojen saannin ja β-oksidaation. AMPK stimuloi glukoosinottoa luurankolihassa fosforyloimalla Rab-GTPaasia aktivoivan proteiinin TBC1D1, joka lopulta indusoi GLUT1-rakkuloiden fuusion plasmamembraaniin. AMPK stimuloi glykolyysiä aktivoimalla 6-fosfofrukto-2-kinaasi / fruktoosi-2,6-bisfosfataasi 2/3: n fosforylaation ja aktivoimalla glykogeenifosforylaasin fosforylaation, ja se estää glykogeenisynteesiä estävän fosforyylin kautta

Monet luurankolihasten biokemialliset muutokset, jotka tapahtuvat yhden harjoittelun tai pitkittyneen harjoittelun aikana, kuten lisääntynyt mitokondrioiden biogeneesi ja kapasiteetti, lisääntynyt lihasten glykogeeni ja lisääntynyt entsyymien erikoistuminen glukoosinottoon soluissa, kuten GLUT4 ja heksokinaasi II, ovat todennäköisesti ainakin osittain AMPK:n aktivaation välittämiä tapahtumia.

AMPK:lla on keskeinen rooli liikunnan / treenattujen lihassolujen verenkierron lisäämisessä stimuloimalla ja vakauttamalla sekä vaskulogeneesiä että angiogeneesiä.

Yhdessä nämä muutokset ilmenevät todennäköisesti sekä väliaikaisen että ylläpidetyn AMPK-aktiivisuuden lisääntymisen seurauksena, jonka AMP : ATP-suhteen nousu aiheuttaa yksittäisten liikuntajaksojen ja pitkäaikaisen harjoittelun aikana.

Yhden akuutin harjoittelun aikana AMPK antaa supistuvien lihassolujen sopeutua energiahaasteisiin lisäämällä heksokinaasi II: n ilmentymistä, GLUT4:n translokaatiota plasmakalvoon, glukoosinottoa ja stimuloimalla glykolyysiä. Jos liikunta jatkuu pitkitettynä harjoituksena, AMPK ja muut signaalit helpottavat lihasten adaptoitumista sopeuttamalla lihassolujen aktiivisuuden aineenvaihdunnan muutokseen, mikä johtaa rasvahappojen hapettumisen kautta muodostuvaaan ATP:hen glykolyysin sijaan.

AMPK saavuttaa siirtymisen oksidatiiviseen metaboliaan säätelemällä ja aktivoimalla oksidatiivisia entsyymejä, kuten heksokinaasi II, PPARalpha, PPARdelta, PGC-1, UCP-3, sytokromi C ja TFAM. AMPK-aktiivisuus kasvaa liikunnan seurauksena ja LKB1 / MO25 / STRAD-kompleksia pidetään 5′-AMP-aktivoidun proteiinikinaasin tärkeimpänä ylävirran AMPKK:na. Tämä on hämmentävä ilmiö, kun otetaan huomioon, että vaikka AMPK-proteiinien määrä kasvaa luukudoksessa kestävyysharjoittelun vaikutuksesta, niiden aktiivisuus vastaavasti laskee kestävyysharjoittelun seurauksena.

On mahdollista, että on olemassa suora yhteys kestävyysharjoitettujen luurankolihasten havaitun AMPK-aktiivisuuden vähenemisen ja kestävyysharjoitteluun liittyvän AMPK-vasteen ilmeisen vähenemisen välillä.

Yksi keskeisistä reiteistä AMPK:n rasvahappojen hapettumisen säätelyssä on asetyyli-CoA-karboksylaasin fosforylaatio ja inaktivaatio. Asetyyli-CoA-karboksylaasi (ACC) muuntaa asetyyli-CoA n malonyyli-CoA:ksi, joka on karnitiinipalmmityylitransferaasi 1:n (CPT-1) estäjä. CPT-1 kuljettaa rasvahapot mitokondrioihin hapetusta varten. ACC: n inaktivointi johtaa siis lisääntyneeseen rasvahappokuljetukseen ja sitä seuraavaan hapettumiseen.

Todennäköisesti malonyyli-CoA:n väheneminen tapahtuu malonyyli-CoA-dekarboksylaasin (MCD) vaikutuksesta, jota AMPK voi säätää. MCD on ACC:n antagonisti dekarboksyloimalla malonyyli-CoA:ta asetyyli-CoA:ksi, mikä johtaa vähentyneeseen malonyyli-CoA:han ja lisääntyneeseen CPT-1:een ja rasvahappojen hapettumiseen.

AMPK: lla on myös tärkeä rooli maksan lipidien aineenvaihdunnassa. On pitkään tiedetty, että maksan ACC:tä on säännelty maksassa fosforylaatiolla. AMPK fosforyloi ja inaktivoi myös 3-hydroksi-3-metyyliglutaryyli-CoA-reduktaasin (HMGCR), joka on kolesterolisynteesin avainentsyymi. HMGR muuntaa 3-hydroksi-3-metyyliglutaryyli-CoA:n, joka on valmistettu asetyylikoentsyymi-A:sta, mevalonihapoksi, joka sitten kulkee useita muita metabolisia vaiheita kolesteroliksi.

AMPK auttaa säätelemään rasvahappojen hapettumista ja kolesterolisynteesiä. Insuliini on hormoni, joka auttaa säätelemään elimistön glukoosipitoisuutta. Kun verensokeri on korkea, insuliinia vapautuu Langerhansin saarekkeiden beetasoluista. Insuliini muun muassa helpottaa glukoosin imeytymistä soluihin lisäämällä glukoosinkuljettaja GLUT-4:n ilmentymistä ja siirtymistä.

AMPK ja kilpirauhashormoni säätelevät eräitä samanlaisia prosesseja. Nämä yhtäläisyydet tuntien Winder ja Hardie et al. suunnittelivat kokeen selvittääkseen, vaikuttiko kilpirauhashormoni AMPK: hon. He havaitsivat, että kaikki AMPK:n alayksiköt lisääntyivät luurankolihaksissa kilpirauhashormonihoidolla. Myös fosfo-ACC: n, AMPK-aktiivisuuden markkerin, määrä lisääntyi.

AMPK:n häviämisen on raportoitu muuttavan glukoosia tunnistavien solujen herkkyyttä huonosti tunnettujen mekanismien kautta. AMPKα2-alayksikön menetys haiman beetasoluissa ja hypotalamuksen neuroneissa vähentää näiden solujen herkkyyttä solunulkoisen glukoosipitoisuuden muutoksille.

Altistuminen toistuville insuliinin aiheuttamille hypoglykemioille laski AMPK:n aktivaatiota hypotalamuksessa ja samalla esti hypoglykemian vasta-ainevasteen rottakokeissa.

AMPK säätyy lysosomeissa useiden kliinisesti merkittävien järjestelmien kautta. Näihin sisältyy AXIN – LKB1 -kompleksi, joka toimii vasteena AMP-tunnistuksesta riippumatta toimiviin glukoosirajoituksiin, joka tunnistavat matalan glukoosin fruktoosi-1,6-bisfosfaatin puuttumisena dynaamisen vuorovaikutussarjan kautta kosketuksissa olevien lysosomaalisesti lokalisoidun V-ATPaasi-aldolaasin välillä.

Toinen lysosomeihin lokalisoitu AMPK-ohjausjärjestelmä riippuu Galectin-9-TAK1-järjestelmästä ja ubikvitinaatiovasteista kontrolloiduilla deubikitinoivilla entsyymeillä, kuten USP9X, mikä johtaa AMPK:n aktivaatioon vasteena lysosomaalisille vaurioille.

Nämä lysosomaaliset vauriot voivat ilmentyä biokemiallisesti ja fyysisesti proteiiniaggregaattien, kuten proteopaattisten tau-proteiinien kautta Alzheimerin taudissa, kiteisinä piidioksideina, jotka aiheuttavat silikoosia, kolesterolikiteinä, jotka aiheuttavat inflammaatiota NLRP3-tulehduksen kautta ja kihtiin liittyvinä uraattikiteinä, tai mikrobien hyökkäyksen aikana, kuten Mycobacterium tuberculosis-infektiossa ja koronavirus-infektiossa.

[62] Molemmat yllä mainitut lysosomaalisesti lokalisoidut AMPK:ta säätelevät järjestelmät aktivoivat vasteena metformiinille, laajalti määrätylle diabeteslääkkeelle. Jotkut todisteet osoittavat, että AMPK:lla voi olla rooli kasvaimen tukahduttamisessa. Tutkimukset ovat osoittaneet, että AMPK voi käyttää suurinta osaa tai jopa kaikkia maksakinaasi B1:n (LKB1) tuumoria tukahduttavista ominaisuuksista. Lisäksi tutkimuksissa, joissa AMPK-aktivaattori metformiinia käytettiin diabeteksen hoitoon, havaittiin korrelaatio vähentyneeseen syöpäriskiin verrattuna muihin lääkkeisiin.

Hiirillä, joilla ei ollut AMPK:ta ilmentävää geeniä, oli kasvanut riski lymfoomien kehittymiselle. Toisaalta jotkut tutkimukset ovat tulkinneet AMPK:n kasvaimen promoottorina, joka suojaa pahanlaatuisia syöpäsoluja. Vaikuttaa siltä, että AMPK voi kääntää takkia syöpäsolujen kohdalla. Kun syöpäsolut ovat muodostuneet organismiin, AMPK alkaakin suojaamaan organismin solujen sijaan pahanlaatuisia syöpäsoluja.

Ei ole suoraa näyttöä siitä, että AMPK:n estäminen olisi tehokas syöpähoito ihmisillä. AMPK:n näennäisesti paradoksaalinen rooli syövän puolustajana/promoottorina toteutuu, kun tarkastelemme lähemmin energiaa tunnistavaa entsyymiä suhteessa liikuntaan ja pitkäaikaiseen harjoitteluun.

Lyhytaikaisen akuutin harjoitusasteikon tavoin pitkäaikaiset kestävyysharjoittelututkimukset paljastavat myös oksidatiivisten metabolisten entsyymien, GLUT-4:n, mitokondrioiden koon ja määrän lisääntymisen ja lisääntyneen riippuvuuden rasvahappojen hapettumisesta. – Wikipedia

4. Ketogeeninen ruokavalio ja amyotrofinen lateraaliskleroosi

Amyotrofinen lateraaliskleroosi, ALS ( sclerosis lateralis amyotrophica) eli Lou Gehrigin tauti tai motoneuronitauti (engl. Motor neuron disease, MND) on etenevä motoneuronisairaus, joka rappeuttaa sekä ylempiä että alempia liikehermoja.

ALS aiheuttaa etenevää rappeutumista liikehermosoluissa, jotka ohjaavat tahdosta riippuvien lihasten toimintaa. ALS:n pääasiallisia oireita ovat lihasten jäykkyys, lihasnykäykset ja asteittain pahentuva lihasten heikentyminen niiden koon pienentyessä.

Tämä johtaa vaikeuksiin puhumisessa, nielemisessä, liikkumisessa ja lopulta hengittämisessä. Sairaus ei vaikuta näköön tai kuuloon eikä haju-, maku- tai tuntoaisteihin. Myös sydän, verenkierto sekä ruoansulatus ja eritysjärjestelmät säilyvät vahingoittumattomina.

Kun sairaus on pitkälle edennyt, potilas ei kykene tekemään juuri mitään ilman ulkopuolista apua; jossain vaiheessa joudutaan tukeutumaan hengityskoneeseen, tarjoamaan potilaalle pillillä imettävää nestemäistä ruokaa tai antamaan ruoka PEG-letkun kautta ja auttamaan tätä kaikissa arkipäivän toimissa. Kuoleman aiheuttaa hengityslihasten heikkous.

Sairaus on harvinainen ja parantumaton. Sairauden aiheuttajaa ei toistaiseksi tunneta. Sairausprosessia on todennäköisesti käynnistämässä usean tekijän vuorovaikutus. – Wikipedia

ALS

Amyotrofinen lateraaliskleroosi (ALS) on progressiivinen neurodegeneratiivinen sairaus, joka vaikuttaa selkärangan ja aivokuoren motorisiin hermosoluihin, mikä johtaa lihasten progressiiviseen heikkenemiseen ja luurankolihasten toimintakyvyn menetykseen.

Tautiin sairastuvat henkilöt kuolevat keskimäärin 2–5 vuoden kuluessa oireiden ilmaantumisesta. Kuolema tapahtuu yleensä hengityshalvauksesta. Tällä hetkellä ALS:lle ei tunneta tehokasta hoitoa.

Ainoa Yhdysvaltain FDA:n hyväksymä farmakologinen hoito rajoittuu rilutsoliin, joka vaikuttaa vain vähän taudin etenemisen ja pidentää elinaikaa vain 2-3 kuukaudella [41]. ALS:n syyt ovat monimutkaisia ja monitekijäisiä. Niihin sisältyy geneettiset tekijät ja ympäristömuuttujat:

  • elimistön oksidatiiviset vauriot,
  • neurofilamenttien kertyminen soluihin,
  • eksitotoksisuus, joka liittyy glutamaattimetabolian häiriöön ja
  • mitokondrioiden kalvojen toimintahäiriöt

ovat eräitä oletettuja taudin kehittymiseen vaikuttavia tekijöitä [42–44]. Muiden hermosoluja rappeuttavien neurodegeneratiivisten häiriöiden tapaan mitokondrioiden todennäköinen vaikutus ALS:n patogeneesiin tekee ketogeenisestä ruokavaliosta lupaavan synergisen työkalun ALS: n hoitoon [45].

Mitokondrioiden yhteys

Noin 10%:lla ALS-potilaista sairaus on perinnöllinen (familiaalinen amyotrofinen skleroosi FALS) ja joka viidennellä FALSia sairastavalla on mutaatio geenissä, joka koodaa entsyymiä Cu / Zn superoksididismutaasi 1 (SOD1) [46]. Tämä mutaatio liittyy mitokondrioiden aktiivisuuteen; itse asiassa juuri mutantti SOD1 on lokalisoitu mitokondrioita sitovaan bcl2:een (solun antiapoptoottinen proteiini) [47].

Lisäksi mitokondrioiden kompleksin I aktiivisuuden heikkeneminen on mitattu ALS-potilaiden luurankolihaksissa ja selkäytimissä [48]. Tulokset osoittavat, että ketoaineet voivat vaikuttaa mitokondrioiden toimintaan palauttamalla esimerkiksi kompleksin I toiminnan farmakologisen eston jälkeen. Lisäksi viljellyissä hermosoluissa, joita hoidetaan farmakologisilla aineilla, jotka estävät kompleksin I, ketoaineiden lisäys palauttaa kompleksin toiminnan [49].

Tutkijat osoittivat hiljattain, että ALS-hiirimallissa ketogeeninen ruokavalio johti korkeampaan motoristen hermosolujen eloonjäämiseen ja parempaan motoriseen toimintaan verrattuna hiiriin, jotka eivät saaneet KD-ruokaa [50]. Tutkimuksissa on myös havaittu, että ketoaineiden lisäys (kapryylihappo) paransi mitokondrioiden toimintaa ja motoristen hermosolujen määrää ALS-hiirimallissa [51].

Tutkijat selittivät nämä tulokset DHB:n neuroprotektiivisella vaikutuksella. Lisäksi he arvelivat, että hyperketonemia saattaa parantaa mitokondrioiden vikoja lisäämällä mitokondrioiden energian ja ATP-molekyylien tuotantoa (mitattuna puhdistetuissa mitokondrioissa ALS-hiirimallista). On huomattava, että kummassakaan tutkimuksessa hiirien eloonjääminen ei lisääntynyt merkittävästi.

Ketogeenisen ruokavalion aikana ruokavalion rasvojen prosenttiosuus oli erittäin korkea (60%). Tämä voi selittää energia-aineenvaihdunnan havaitut ja mitatut parannukset.

Kolesteroli ja fosfolipidit ovat välttämättömiä aksonikalvojen terveydelle ja perifeeristen hermokalvojen vamman korjauksille. Erityisen tärkeitä ovat pienitiheyksiset lipoproteiinit [52].

Eräät epidemiologiset havainnot viittaavat siihen, että hyperlipidemia on merkittävä ALS-potilaiden elinajanodotetta lisäävä tekijä [53]. Paganoni et al. [54], osoitti kuitenkin UI-muotoisen yhteyden painoindeksin ja kuolleisuuden välillä, sekä suuremman eloonjäämistodennäköisyyden potilailla, joilla oli korkeampi painoindeksi (BMI: 30–35). Tässä tutkimuksessa dyslipidemia ei osoittanut riippumattomasti potilaan parempaa ennustetta.

Wills et al. [55] osoittivat äskettäin, että potilailla, jotka saivat runsaasti energiaa / runsaasti hiilihydraatteja sisältävää ravintoa, oli vähemmän haittatapahtumia ja kuolemantapauksia kuin runsaasti rasvaa / paljon kaloreita sisältävässä ryhmässä tai kontrolliryhmässä.

Nämä ilmeisen ristiriitaiset tulokset kuvaavat ALS:n monimutkaista luonnetta. Taudin ennusteessa on tosin joitain yhteisiä piirteitä: suurempi kalorien saanti näyttää parantavan selviytymistä ALS-potilailla, vaikka kolesterolin ja parempien olosuhteiden välillä ei ole löydetty täsmällisiä suhteita.

Insuliini lisää ndogeenisen kolesterolin tuotantoa, mikä vähentää eksogeenistä kolesterolia [4]. Siten runsaasti hiilihydraatteja sisältävä ruokavalio voi olla hyödyllinen kolesterolin tuotannon lisäämiseksi. Korkean energiapitoisuuden hiilihydraattipainotteisen ruokavalion positiivisia vaikutuksia voitaisiin soveltaa vuorotellen korkean rasvapitoisuuden (runsaasti voita [56]) ketogeenisen ruokavalion kanssa joissakin ALS-tyypeissä (SOD1), mutta ei RNA-prosessointihäiriöihin liittyvissä. (TDP43, FUS ja C9orf72).

Lisää kontrolloituja satunnaistettuja tutkimuksia tarvitaan ravitsemuksen ja ketogeenisen ruokavalion täsmällisempien menetelmien tutkimiseksi ALS-terapiana.

5. Mitokondrioiden häiriöt ja ketogeeninen ruokavalio

Edellisessä osassa viittasimme mitokondrioiden rooliin neurologisessa sairaudessa, kuten ALS. On yhä enemmän todisteita siitä, että ketogeeninen ruokavalio voi parantaa mitokondrioiden toimintaa ja stimuloida mitokondriogeneesiä [57–60].

Kuten Wallace ja hänen kollegansa ovat todenneet,

”Ironista kyllä, yksi vanhimmista terapeuttisista lähestymistavoista – paasto ja ketogeeninen ruokavalio – on edelleen lupaavin hoito mitokondrioiden häiriöissä” [61].

Itse asiassa, vaikka ketogeeninen ruokavalio on terapeuttinen työkalu, joka tunnetaan 20-luvulta lähtien, sen vaikutukset mitokondrioihin ovat suhteellisen tuore tutkimushavainto.

Jotkut mitokondrioiden häiriöt voivat aiheuttaa kohtauksia, joilla on erilaisia epileptisia fenotyyppejä [62]. Ketogeenisen ruokavalion vaikutuksista mitokondriopatioihin on joitain rohkaisevia tietoja.

Kang et al. [63] osoitti, että ketogeeninen ruokavalio voisi olla turvallinen ja tehokas hoito, joka vähentää kohtauksia lapsilla, joilla on vaikeasti hoidettava epilepsia ja erilaisia hengityskompleksihäiriöitä (kompleksi I, II, IV tai yhdistetty).

Ahola-Erkkilä ym. [64] ovat hoitaneet ketogeenisellä ruokavaliolla myöhään alkavan mitokondrioiden myopatian hiirimallia. Mitokondrioiden myopatian tiedetään aiheuttavan ihmisillä autosomaalisesti hallitsevaa progressiivista oftalmoplegiaa, lisäävän lihasheikkoutta ja mitokondrioiden mtDNA-vaurioita sekä sytokromi c-oksidaasi-negatiivisia lihaskuiduituja.

Ketogeeninen ruokavalio vähensi sytokromi c-oksidaasi-negatiivisten lihaskuitujen määrää ja esti mitokondrioiden ultrastruktuuristen poikkeavuuksien muodostumisen lihaksessa. Ruokavalio paransi suurimman osan metabolisista ja lipidoomisista poikkeavuuksista, mutta ei vaikuttamalla mtDNA:han, vaan lisäämällä mitokondrioiden biogeneesiä.

Kolikolla on kaksi puolta

Vaikka ketogeeninen ruokavalio voi olla terapeuttinen työkalu monissa mitokondriopohjaisissa sairauksissa, se on kontraindikatorinen (vasta-aiheinen; kontraindikatorinen menetelmä estää jonkin hoidon tai tutkimuksen soveltamisen, koska voi laukaista toisen häiriön tai sairauden).

Rasva-aineenvaihduntasairaudesta kärsivät potilaat saattavat kokea ketogeenisellä ruokavaliolla vakavan katabolisen kriisin. Synnynnäiset virheet lipidien aineenvaihduntaan liittyvissä entsyymeissä: mitokondrioiden kalvon pitkäketjuisten rasvahappojen kuljetusmekanismista beeta-hapetukseen ja Krebsin sykliin voivat olla kohtalokkaita paaston tai ketogeenisen ruokavalion aikana. Potilaan karnitiinipuutos, karnitiinipalmitoyylitransferaasin (CPT) I tai II puutos, karnitiinitransokaasipuutos, beta-oksidaation virheet tai pyruvaattikarboksylaasipuutos tulisi seuloa ennen ketogeenisen ruokavalio-terapian aloittamista. Ketogeeninen ruokavalio voi pahentaa myös akuuttia ajoittaista porfyriaa sairastavien potilaiden tilaa [65].

6. Alzheimerin tauti (AD) ja ketogeeninen ruokavalio

Alzheimerin tauti (AD) on yleisin neurodegeneratiivinen sairaus ja ikääntyneen väestön johtava dementian syy. AD-oireet ovat yleensä kognitiivisia häiriöitä, joihin liittyy progressiivisia muistivajeita ja persoonallisuuden muutoksia.

Alzheimer-potilaiden kognitiivisen taantumisen syyt johtuvat etenevästä synaptisesta toimintahäiriöstä ja sen aiheuttamasta hermosolujen surkastumisesta. Hermosolujen atrofiaa tapahtuu monilla aivojen alueilla: lähinnä neokorteksissa, limbisessä järjestelmässä ja aivokuoren alapuolisilla alueilla [66].

Hippokampus on ketogeenisen ruokavalion spesifinen kohde

McDaniel et al. osoitti, että kainihappo-indusoidussa status epilepticus -rottamallissa ketogeeninen ruokavalio esti mTOR-reitin signalointia aivoissa estäen hippokampuksen myöhäisen mTOR-aktivaation kainihappo-indusoidun status epilepticuksen jälkeen [59].

Kaiinihappo on voimakas neurotoksinen aminohapon agonisti , joka toimii aktivoimalla glutamaatti-reseptoreita. Glutamaatti on pääasiallinen eksitatorinen välittäjäaine keskushermostossa. Glutamaattireseptoreihin on neljä pääluokkaa:

– NMDA-reseptorit,
– AMPA-reseptorit,
– kainaattireseptorit ja
– metabotrooppiset glutamaattireseptorit

Kainiinihappo on kainaattireseptoreiden agonisti. Kainaattireseptorit kontrolloivat todennäköisesti natriumkanavaa, joka tuottaa viritystä aiheuttavia postsynaptisia potentiaaleja (EPSP), kun glutamaatti sitoutuu.

Hippokampuksen neuroneilla on kriittinen rooli oppimisessa ja muistin toiminnassa. Ne ovat erityisen alttiita Alzheimerin taudin aiheuttamille häiriöille ja rappeutumiselle.

AD on luokiteltu kahteen päämuotoon: familiaalinen AD (FAD) ja satunnainen AD (SAD) tai myöhään alkava ikääntymiseen liittyvä AD (LOAD); jälkimmäinen on dementian johtava syy, joka selittää yli puolet kaikista tapauksista. Melkein kaikki FAD-tapaukset johtuvat mutaatiosta kolmessa geenissä (amyloidin esiasteproteiini APP, preseniliini 1 PSEN1 ja preseniliini 2 PSEN2 [67]),

SAD:n tarkkaa etiologiaa ei ymmärretä vielä täysin. Tiedetään, että ikä on suurin riskitekijä. Alzheimerin taudin riski kasvaa eksponentiaalisesti iän myötä 65-vuotiailla tai sitä vanhemmilla ihmisillä [68].

Ikääntymisen tiedetään vaikuttavan yhdessä muiden tekijöiden kanssa. Näitä ovat:

(1) apolipoproteiini E:n (Apo E) alleelivaihtelut
(2) anatomisten reittien rappeutuminen,
(3) mitokondrioiden toimintahäiriöt,
(4) vaurioitunut veri-aivoeste,
(5) immuunijärjestelmän toimintahäiriöt,
(6) tartuntataudit ja muut ympäristötekijät, kuten altistuminen alumiinille,
(7) toistuvaT pään vammat ja
(8) aliravitsemus [69]

Kuten monissa muissakin kroonisissa sairauksissa, myös Alzheimerin taudissa hoidot voidaan jakaa kahteen luokkaan:

(A) oireenmukaiset hoidot (jotka tarjoavat tilapäistä oireiden lieventämistä muuttamatta taudin etenemistä) ja

(B) hoidot, jotka voivat mahdollisesti muuttaa taudin patogeneesiä (hidastaa tai pysäyttää taudin etenemiseen liittyviä neurologisia vaurioita)

Huolimatta joistakin FDA:n hyväksymistä lääkkeistä, kuten asetyylikoliiniesteraasin estäjistä ja memantiinista (glutamaattiantagonisti, jota käytetään käyttäytymisoireiden lieventämiseen taudin kohtalaisessa vaiheessa), tällä hetkellä ei ole olemassa tehokasta hoitoa AD:n estämiseksi, hidastamiseksi tai parantamiseksi. Suurin osa hyväksytyistä lääkkeistä tarjoaa vain kohtalaisen oireellisen vaikutuksen [70, 71].

Muiden sairauksien osalta tehokkaiden hoitojen kehittämistä vaikeuttaa AD-etiologian puutteellinen tuntemus [71] siitäkin huolimatta, että ”amyloidikaskadin” hypoteesia on tutkittu laajasti. Tämä patogeneettinen hypoteesi perustuu β-amyloidin (Aβ) neurotoksisiin ominaisuuksiin ja sen soluihin kumuloitumiseen liittyvään neurotoksisten tapahtumien kaskadin käynnistämiseen. Neurodegeneratiiviseen prosessiin lukeutuvat tunnettujen neurofibrillaaristen vyyhtien (NFT) muodostumisen lisäksi myös krooniset tulehdusreaktiot, oksidatiivisen stressin lisääntyminen ja lopuksi mitokondrioiden toimintahäiriö [71].

Alzheimerin taudin kaksi päätyyppiä johtuvat erillisistä proteiineista: tau neurofibrillaaristen vyyhtien aiheuttajana on tau-proteiini ja amyloidiplakkien tapauksessa aiheuttajana on amyloidi-β-proteiini.

Kuten edellä mainittiin, FAD:lle ja SAD:lle ei tunneta yhtenäistä etiopatogeenista mekanismia. Jälkimmäisestä on saatu havaintoja, jotka viittaavat siihen, että amyloidi-β-proteiinin ja NFT:n väheneminen toimivat yhdessä aiheuttaen mitokondrioiden toiminnan heikkenemistä ja muuttaen aivojen metabolista aktiivisuutta ikääntymisprosesseihin liittyen.

Ottaen huomioon ikääntymisprosessin ja Alzheimerin taudin välisen vahvan yhteyden ja ketogeenisen ruokavalion positiiviset vaikutukset ikääntyvissä aivoissa [72], sekä Alzheimerin taudin monitekijäisen luonteen (mitokondrioiden ja aineenvaihdunnan toimintahäiriöt), on vakuuttavaa näyttöä hypoteesille, jonka mukaan ketogeenisen ruokavalion noudattaminen AD-terapiana tuottaa myönteisiä fysiologisia, metabolisia ja kognitiivisa hoitovasteita potilailla [73, 74].
Esimerkiksi in vitro -tutkimus on osoittanut, että beeta-hydroksibutyraatin (ketoaine) lisääminen suojaa hippokampuksen hermosoluja Aβ -toksisuudelta. Tämä viittaa ketogeenisen ruokavalion mahdollisiin terapeuttisiin hyötyihin Alzheimerin tautiin liittyvissä mitokondrioiden toimintahäiriöissä [75].

Toisaalta eläinkokeet ovat antaneet osin ristiriitaisia tuloksia:

Van der Auwera et al. [76] osoitti Aβ: n vähenemistä nuorten 1,5 kk KD:lla syötettyjen siirtogeenisten AD-hiirten aivoissa, kun taas ikääntyneille koirille KD:n vaikutus näytti rajoittuneen aivojen parietaaliseen lohkoon [77].

Eläinkokeissa ketoniestereitä sisältävä pitkäaikainen (8 kuukautta) ruokinta keski-ikäisillä (8,5 kuukauden ikäisillä) hiirillä paransi hiirten kognitiota ja Aβ- ja tau-patologiaa [75]. Beckett et al. [78] osoitti, että AD-hiirimalli, jossa hiiriä ruokittiin runsaasti rasvaa ja vähän hiilihydraatteja sisältävällä ketogeenisellä ruokavaliolla, johti AD-hiirten parantuneisiin motorisin toimintoihin ilman muutoksia Aβ:ssä.

Eläinkokeiden keskenään ristiriitaiset tulokset voivat johtua eläinten iästä: hiiret ovat useimmiten nuoria tai keski-ikäisiä, mutta aineenvaihdunnan muutoksia esiintyy toistuvasti pääasiassa vanhuksilla.

Alzheimerin tauti liittyy myös metaboliseen dysregulaatioon ja insuliiniresistenssiin [79]. Monet tutkijat ovat osoittaneet, että ketogeeninen ruokavalio voi merkittävästi parantaa glukoosin homeostaasia vähentämällä aineenvaihdunnan häiriöitä ja insuliiniresistenssiä [80–82].

AD:ssä on toinen patofysiologinen mekanismi, joka johtuu muuttuneesta mitokondrioiden toiminnasta ja glukoosimetaboliasta: edistyneiden glykaation lopputuotteiden (AGE) kertyminen [83].

Huolimatta siitä, että AGE:n kertyminen soluihin ja kudoksiin on normaali ikääntymisen ominaisuus, tämä prosessi kiihtyy Alzheimerin taudissa. Glykaation lopputuotteita löytyy myös amyloidiplakeista ja neurofibrillaarisista punoksista. AGE-arvojen nousu voi selittää Alzheimerin taudin monia neuropatologisia muutoksia (proteiinien silloittuminen, oksidatiivisen stressin gliaalinen induktio ja hermosolujen surkastuminen ja kuolema).

Voidaan spekuloida, että ketogeenisen ruokavalion hermosoluja suojaavat neuroprotektiiviset vaikutukset ja ketogeeniseen ruokavalioon liittyvä glykeemisen kuorman väheneminen vaikuttavat suotuisasti Alzheimerin taudissa. Toinen mielenkiintoinen hypoteesi on ketogeenisen ruokavalion arvioidut vaikutukset mitokondriogeneesiin yhdessä mitokondriokoneiston parantamisen kanssa [61, 72, 74, 84–86].

Kuten aiemmin todettiin, mitokondrioiden toimintahäiriöiden uskotaan liittyvän Alzheimerin taudin etiologiaan [72]. Iäkkäillä potilailla on havaittu selvää hermo- ja gliasolujen mitokondrioiden metabolian heikkenemistä verrattuna terveisiin nuoriin koehenkilöihin [87]. Tämä toimintahäiriö, joka liittyy mitokondrioiden glukoosi / pyruvaattihapetuksen heikentyneeseen energiantuotantoon, voi parantaa Aβ :n ja tau:n patologista kerrostumista. Heikentynyttä mitokondrioiden toimintaa voi edustaa lisääntynyt superoksidituotanto hapettumisvaurioiden vasteena, oksidatiivisen fosforylaation väheneminen ja näin ollen mitokondrioiden elektronikuljetusketjun heikkeneminen.

Muut AD: lle ominaiset glukoosimetaboliset häiriöt aivojen tietyissä osissa liittyvät mitokondrioiden toimintahäiriöihin [88]. On mielenkiintoista huomata, että aikaisempi vähentynyt glukoosin hyödyntäminen energiasubstraattina voidaan havaita FDG-PET:llä kognitioon liittyvissä kokeissa henkilöillä, joilla on tunnettu AD-historia [89].

On luultavaa, että alentunut aivojen glukoosin käyttö (hermosolujen heikentynyt glukoosinotto) edistää AD-neuropatologian kehittymistä. Aivojen glukoosimetabolian varhainen heikkeneminen voidaan havaita ennen mitattavissa olevaa kognitiivista heikkenemistä [90]. Muut todisteet tukevat tätä teoriaa, kuten alentunut pitoisuus glukoosin kuljettajia (GLUT 1 ja 2, mutta myös hermosolujen glukoosi kuljettaja GLUT 3). Alzheimerin taudissa aivoissa todettava tau-taudin hyperfosforylaatio liittyy tähän ilmiöön [91].

Aivojen aineenvaihdunnan muutos glukoosista ketogeenisen ruokavalion tuottamiin ketoaineisiin [17] on tehokas hoitomuoto tyypin I glukoosinkuljettajapuutosoireyhtymässä [92]. Ketogeeninen ruokavalio voi olla toimiva terapiavaihtoehto myös GLUT-kuljettajien puutteen aiheuttamaan hermosolujen rappeutumiseen Alzheimerin taudissa [73].

Lopuksi: vaikka suoraa näyttöä ketogeenisen ruokavalion terapeuttisista hyödyistä Alzheimerin taudin hoidossa ei ole, tämä ravitsemuksellinen lähestymistapa näyttää lupaavalta ja ansaitsee siten laajemmat kliiniset tutkimukset.


7. Parkinsonin tauti ja ketogeeninen ruokavalio


Sporadisen Parkinsonin taudin (PD) patogeneesi on yhä ratkaisematta. Tutkimukset viittaavat siihen, että ensisijainen syy on dopaminergisten* hermosolujen eksitotoksinen rappeutuminen
substantia nigrassa, mikä johtaa motoriikan heikentymiseen ja lisääntyvässä määrin kognition alentumiseen sekä muihin kortikaalisen toiminnan häiriöihin.

*Dopaminerginen: autonomisen hermoston hermosoluista dopamiinia erittävä tai sen välityksellä stimuloituva; 2. (aineista) dopamiinin tavoin vaikuttava

Dopamiinia sisältäviä neuroneja on runsaasti erityisesti keskiaivoissa substantia nigran ja tegmentumin tienoilla. Näiden aksonit haarautuvat laajalle alueelle. Aivoissa on neljä dopaminergista päärataa: mesokortikaalinen, mesolimbinen, nigrostriataalinen ja tuberoinfundibulaarinen.

Nigrostriataalisen radan tuhoutuessa ilmentyy Parkinsonin tauti. Skitsofrenian ajatellaan johtuvan mesokortikaalisen ja mesolimbisen radan dopamiinin D2-reseptorien ylistimuloitumisesta.

Mitokondrioiden toiminnan heikentymisellä, johon liittyy substantia nigra (mustatumake), on merkittävä rooli Parkinsonin taudin kehittymisessä ja etenemisessä [94].

Kashiwaya et al. käytti heroiinianalogia 1-metyyli-4-fenyylipyridiniumia, MPP (+), joka tuottaa dopaminergisten substantia nigran eli mustatumakkeen -solujen kuoleman estämällä mitokondrioiden NADH-dehydrogenaasien monientsyymikompleksin. Tämä aiheuttaa samanlaisen oireyhtymän kuin Parkinsonin tauti viljellyissä mesenkefaalisissa neuroneissa. β-hydroksibutyraatti suojasi näitä hermosoluja MPP (+) – toksisuuden aiheuttamalta neurodegeneraatiolta [74].

Eläinmalleissa 1-metyyli-4-fenoli-1,2,5,6-tetrahydropyridiiniä (MPTP) käytetään tuottamaan ihmisen Parkinsonin taudin kaltaista oireyhtymää jäljittelevä dopaminergisten hermosolujen selektiivinen tuhoaminen mustatumakkeessa. Kuten edellä mainituissa sairauksissa, ketogeenisen ruokavalion positiiviset vaikutukset mitokondrioiden toimintaan voivat olla avaintekijä tällaisen ruokavalion terapiakäytössä, koska ketonit voivat ohittaa Parkinsonin taudin aiheuttaman kompleksin I aktiivisuuden puutteen.

Hiirikokeissa β-hydroksibutyraatin infuusio suojasi hiiriä MPTP:n aiheuttamalta dopaminergiseltä hermoston rappeutumiselta ja motorisilta häiriöiltä [49]. Lisäksi ketogeeninen ruokavalio suojasi mustatumakkeen dopaminergisiä neuroneja 6-hydroksidopamiinin neurotoksisuudelta Parkinsonin taudin rottamallissa [95].

VanItaille et al. [96] osoitti, että ihmisillä, jotka pystyvät valmistamaan ”hyperketogeenisen” ruokavalion kotona ja noudattamaan sitä 28 päivän ajan, korkea ketoaineiden pitoisuus assosioitui taudin oireiden paranemiseen yhtenäisellä Parkinsonin taudin luokitusasteikolla Unified Parkinson’s Disease Rating Scale).

8. Glykogenoosit ja ketogeeninen ruokavalio

Glykogenoosit (glykogeenin varastointisairaudet, GSD) ovat entsyymivirheistä johtuvia perinnöllisiä häiriöitä, jotka vaikuttavat glykogeenimetaboliaan ja johtavat normaalin tai epänormaalin rakenteen glykogeenin solunsisäiseen kertymiseen erilaisiin solutyyppeihin.

Klassisesti GSD numeroitiin I – VIII niiden löytämisen ja erityisen entsyymivian mukaan [97]. Viime vuosina on tunnistettu muita primaarisia glykogenooseja (GSD 0, GSD IX – XV) [98].

GSD välittyy autosomaalisena resessiivisenä, lukuun ottamatta GSD VIII, joka on X-kytketty. Toiminnallisesta näkökulmasta GSD I, III, IV, VI ja VIII / IXa voidaan ryhmitellä maksan GSD:ksi [99], koska puutteelliset entsyymit ilmentyvät enimmäkseen maksasoluissa. Kun otetaan huomioon maksan keskeinen rooli glykemian säätelyssä glykogenolyysin avulla, ei ole yllättävää, että hypoglykemia on maksan GSD:n pääasiallinen ilmenemismuoto [97, 100]. Tämä puolestaan aiheuttaa neurologisia oireita, jotka vaihtelevat kouristuksista kohtauksiin, varsinkin sairauden alkuvaiheessa. Pitkällä aikavälillä uusiutuva vaikea hypoglykemia voi aiheuttaa aivovaurioita erityisesti GSD I:ssä (von Gierken tauti, G-6-P-fosfataasin puutos), joka on yleisin maksan GSD.

GSD-hoito perustuu ruokavaliohoitoon hypoglykemian estämiseksi. Potilaita ruokitaan tärkkelyspitoisilla elintarvikkeilla ympäri vuorokauden [100, 101]. Tieteellinen perustelu ketogeenisen ruokavalion (KD) mahdolliselle käytölle johtuu varhaisesta havainnosta, jonka mukaan hypoglykemiaan liittyvät oireet paranivat iän myötä GSD:ssä [102] sekä GSD III:ssa [100].
On tunnettua, että tämä sopeutuminen tapahtuu aivoissa sekä paastotilassa että kuumeen aikana [102]. Tämä havainto tulkittiin klassisesti aivoissa tapahtuvien sopeutumisten seurauksena, joka sallii ketoaineiden lisääntyneen käytön polttoainesubstraateina glukoosin sijasta. Sama mekanismi selittää kalorirajoituksen [100] vaikutusta, joka johtaa myös mataliin verensokeritasoihin.

Mekanistinen tulkinta olisi se, että ketogeeninen ruokavalio lisää aivojen energia-aineenvaihdunnan reittien käyttöä riippumatta glykogeenin hajoamisesta. Näiden näkökohtien perusteella ketogeenistä ruokavaliota on käytetty tehokkaasti lihassolujen GSD V:n (McArdlen tauti) hoidossa [103, 104].

Ketogeenisen ruokavalion kouristuksia estävät vaikutukset ovat tunnustetaan yleisesti, vaikka mekanismeja ei ole vielä täysin selvitetty [105]. Ketogeenisen ruokavalion mahdollista käyttöä patologisissa olosuhteissa, joille on tunnusomaista krooninen hypoglykemia, tukee edelleen se, että ketogeeninen ruokavalio on standardi GLUT1-puutosoireyhtymän hoidossa [106]. Tätä voidaan pitää maksan GSD:n metabolisena fenokopiana, koska siinä verensokeria ei voida kuljettaa hermosoluihin.

Tuore tutkimus [107] arveli, että ketogeenistä ruokavaliota voidaan käyttää menestyksekkäästi vakavan GSD III:een liittyvän kardiomyopatian hoidossa. Kaiken kaikkiaan nämä havainnot saattavat kannustaa jatkotutkimuksiin ketogeenisen ruokavalion käytöstä valittujen GSD-muotojen hoidossa.

9. Loppupäätelmä

Ketogeenisen ruokavalion aiheuttamaa erikoista metabolista tilaa on tutkittu laajalti viime vuosina. Ketoaineiden pitoisuuden nousu, verensokerin aleneminen yhdessä monien tärkeiden aineenvaihduntareittien (esim. IGF-1 / AKT / mTor, AMPK / PGC1α) kanssa on osoittautunut potentiaaliseksi terapeuttiseksi aseeksi monia neurologisia ja neuromuskulaarisia sairauksia vastaan.

Nämä tutkimukset tarjoavat teoreettisen perustan ketogeenisen ruokavalion vaikutukselle useissa hermo-lihassairauksissa. Monia korkeita esteitä on kavuttava, ennen kuin näitä löydöksiä voidaan soveltaa laajasti kliiniseen käytäntöön tai kansanterveyden parantamiseen.

Ensinnäkin ketogeenisen ruokavalion tarkasta mekanismista hermo-lihassairauksien terapiana tiedetään edelleen liian vähän, ja toiseksi tällaisen ruokavalion pitkäaikaisia vaikutuksia tulisi tutkia näillä potilailla, huolimatta siitä, että meillä on vain alustavia todisteita ja todisteita, jotka perustuvat lähinnä eläinmalleihin. Saatavilla olevat tiedot osoittavat, että KD:n aineenvaihduntamekanismi joillakin neurologisilla ja hermo-lihassairauksilla voisi olla seuraava:

(1) Tehokas energialähde tietyntyyppisten hermostoa rappeuttavien sairauksien hoidolle, joille on tunnusomaista aivojen fokaalinen hypometabolia. Tällaisia ovat esimerkiksi Parkinsonin ja Alzheimerin taudit. Neuronaaliset solut pystyvät metabolisoimaan ketoaineita glukoosipuutoksen aikana.

(2) Ketonit voivat lisätä ATP-hydrolyysin vaikutusta ja korvata asetyyli-CoA:lla Alzheimerin taudille ominaisen asetyylikoliinin vähenemisen. Glukoosimetaboliaan verrattuna ketonit tuottavat alhaisempia oksidatiivisen stressin tasoja aivoissa yhdessä suuremman soluenergiantuoton ja antioksidanttikapasiteetin kanssa. Lisäksi ketoosi voi lisätä glutationiperoksidaasia hippokampussoluissa ja yleensä vähentää mitokondrioiden ROS-tuotantoa.

(3) Lisää mitokondrioiden biogeneesireittejä (AMPK:n ja PGC1a-reitin aktivoinnin kautta). Mitokondrioiden reittien parantaminen voi auttaa parantamaan aivojen ja hermosolujen aineenvaihduntaa.

(4) Ketoaineet ohittavat ALS:n luurankolihakseen ja selkäytimeen perustuvan mitokondrioiden kompleksin I aktiivisuuden vian. Viljellyissä hermosoluissa, joita hoidetaan farmakologisilla aineilla, jotka estävät kompleksin I, ketoaineiden lisäys palauttaa kompleksin toiminnan.

(5) Vähentää sytokromi-c-oksidaasi-negatiivisten lihassyiden määrää joissakin mitokondrioiden myopatioissa ja estää mitokondrioiden ultrastruktuuristen poikkeavuuksien muodostumisen.

Lopuksi uskomme, että ketogeenistä ruokavaliota tulisi tutkia syvällisemmin sen rohkaisevan potentiaalisen terapiavaikutuksen vuoksi monien hermo-lihas- ja neurodegeneratiivisten sairauksien hoidossa.

Tutkimuskatsauksen irjoittajat toteavat, ettei heillä ole omia lehmiä ojassa tai mitään taloudellisia intressejä. Minulla ketofiilistelevänä multippelisklerootikkona on, mutta tässä toimin lähinnä editorina. Artikkelin julkaisu voi tuottaa mainostuloja joitain senttejä.

Ketogeeninen ruokavalio ei paranna syntyneitä neurologisia ja neuromotorisia vaurioita, mutta on perusteltua uskoa, että se ainakin hidastaa, ellei jopa ehkäise, uusien vaurioiden syntyä. KD ei lupaa ihmettä, mutta se lupaa parempaa kuin mitä tähän asti on ollut tarjolla. Tieto lisääntyy koko ajan. Ketogeenisen ruokavalion stimuloima autofagosytoosi yhdessä neurogeneesin ja neuroplastisuuden kanssa voi ehkä korjata joitain syntyneitä vaurioita pitkällä aikavälillä. Näín toivon.

Viitteet

  1. N. N. Danial, A. L. Hartman, C. E. Stafstrom, and L. L. Thio, “How does the ketogenic diet work? Four potential mechanisms,” Journal of Child Neurology, vol. 28, no. 8, pp. 1027–1033, 2013. View at: Publisher Site | Google Scholar
  2. E. Kossoff, “The fat is in the fire: ketogenic diet for refractory status epilepticus,” Epilepsy Currents, vol. 11, no. 3, pp. 88–89, 2011. View at: Publisher Site | Google Scholar
  3. R. G. Levy, P. N. Cooper, and P. Giri, “Ketogenic diet and other dietary treatments for epilepsy,” Cochrane Database of Systematic Reviews, vol. 3, 2012. View at: Google Scholar
  4. A. Paoli, “Ketogenic diet for obesity: friend or foe?” International Journal of Environmental Research and Public Health, vol. 11, pp. 2092–2107, 2014. View at: Google Scholar
  5. J. C. Mavropoulos, W. S. Yancy, J. Hepburn, and E. C. Westman, “The effects of a low-carbohydrate, ketogenic diet on the polycystic ovary syndrome: a pilot study,” Nutrition and Metabolism, vol. 2, article 35, 2005. View at: Publisher Site | Google Scholar
  6. R. J. Klement and U. Kämmerer, “Is there a role for carbohydrate restriction in the treatment and prevention of cancer?” Nutrition & Metabolism, vol. 8, article 75, 2011. View at: Publisher Site | Google Scholar
  7. T. N. Seyfried, J. Marsh, L. M. Shelton, L. C. Huysentruyt, and P. Mukherjee, “Is the restricted ketogenic diet a viable alternative to the standard of care for managing malignant brain cancer?” Epilepsy Research, vol. 100, no. 3, pp. 310–326, 2012. View at: Publisher Site | Google Scholar
  8. A. Accurso, R. K. Bernstein, A. Dahlqvist et al., “Dietary carbohydrate restriction in type 2 diabetes mellitus and metabolic syndrome: time for a critical appraisal,” Nutrition and Metabolism, vol. 5, no. 1, article 9, 2008. View at: Publisher Site | Google Scholar
  9. A. Paoli, A. Rubini, J. S. Volek, and K. A. Grimaldi, “Beyond weight loss: a review of the therapeutic uses of very-low-carbohydrate (ketogenic) diets,” European Journal of Clinical Nutrition, vol. 67, no. 8, pp. 789–796, 2013. View at: Publisher Site | Google Scholar
  10. A. Paoli, K. Grimaldi, L. Toniolo, M. Canato, A. Bianco, and A. Fratter, “Nutrition and acne: therapeutic potential of ketogenic diets,” Skin Pharmacology and Physiology, vol. 25, no. 3, pp. 111–117, 2012. View at: Publisher Site | Google Scholar
  11. A. Paoli, M. Canato, L. Toniolo et al., “The ketogenic diet: an underappreciated therapeutic option?” La Clinica Terapeutica, vol. 162, no. 5, pp. e145–e153, 2011. View at: Google Scholar
  12. C. E. Stafstrom and J. M. Rho, “The ketogenic diet as a treatment paradigm for diverse neurological disorders,” Frontiers in Pharmacology, vol. 3, article 59, 2012. View at: Publisher Site | Google Scholar
  13. P. Felig, O. E. Owen, J. Wahren, and G. F. Cahill Jr., “Amino acid metabolism during prolonged starvation,” Journal of Clinical Investigation, vol. 48, no. 3, pp. 584–594, 1969. View at: Publisher Site | Google Scholar
  14. O. E. Owen, P. Felig, A. P. Morgan, J. Wahren, and G. F. Cahill Jr., “Liver and kidney metabolism during prolonged starvation,” The Journal of Clinical Investigation, vol. 48, no. 3, pp. 574–583, 1969. View at: Publisher Site | Google Scholar
  15. S. Jitrapakdee, A. Vidal-Puig, and J. C. Wallace, “Anaplerotic roles of pyruvate carboxylase in mammalian tissues,” Cellular and Molecular Life Sciences, vol. 63, no. 7-8, pp. 843–854, 2006. View at: Publisher Site | Google Scholar
  16. F. C. George, “Fuel metabolism in starvation,” Annual Review of Nutrition, vol. 26, pp. 1–22, 2006. View at: Publisher Site | Google Scholar
  17. O. E. Owen, A. P. Morgan, H. G. Kemp, J. M. Sullivan, M. G. Herrera, and G. F. Cahill Jr., “Brain metabolism during fasting,” Journal of Clinical Investigation, vol. 46, no. 10, pp. 1589–1595, 1967. View at: Publisher Site | Google Scholar
  18. T. Fukao, G. Mitchell, J. O. Sass, T. Hori, K. Orii, and Y. Aoyama, “Ketone body metabolism and its defects,” Journal of Inherited Metabolic Disease, 2014. View at: Publisher Site | Google Scholar
  19. T. Fukao, G. D. Lopaschuk, and G. A. Mitchell, “Pathways and control of ketone body metabolism: on the fringe of lipid biochemistry,” Prostaglandins Leukotrienes and Essential Fatty Acids, vol. 70, no. 3, pp. 243–251, 2004. View at: Publisher Site | Google Scholar
  20. A. Paoli, L. Cenci, M. Fancelli et al., “Ketogenic diet and phytoextracts comparison of the efficacy of mediterranean, zone and tisanoreica diet on some health risk factors,” Agro Food Industry Hi-Tech, vol. 21, no. 4, pp. 24–29, 2010. View at: Google Scholar
  21. R. L. Veech, “The therapeutic implications of ketone bodies: the effects of ketone bodies in pathological conditions: ketosis, ketogenic diet, redox states, insulin resistance, and mitochondrial metabolism,” Prostaglandins Leukotrienes and Essential Fatty Acids, vol. 70, no. 3, pp. 309–319, 2004. View at: Publisher Site | Google Scholar
  22. R. L. Leino, D. Z. Gerhart, R. Duelli, B. E. Enerson, and L. R. Drewes, “Diet-induced ketosis increases monocarboxylate transporter (MCT1) levels in rat brain,” Neurochemistry International, vol. 38, no. 6, pp. 519–527, 2001. View at: Publisher Site | Google Scholar
  23. M. D. McCue, “Starvation physiology: reviewing the different strategies animals use to survive a common challenge,” Comparative Biochemistry and Physiology A: Molecular & Integrative Physiology, vol. 156, no. 1, pp. 1–18, 2010. View at: Publisher Site | Google Scholar
  24. K. Sato, Y. Kashiwaya, C. A. Keon et al., “Insulin, ketone bodies, and mitochondrial energy transduction,” The FASEB Journal, vol. 9, no. 8, pp. 651–658, 1995. View at: Google Scholar
  25. Y. Kashiwaya, K. Sato, N. Tsuchiya et al., “Control of glucose utilization in working perfused rat heart,” The Journal of Biological Chemistry, vol. 269, no. 41, pp. 25502–25514, 1994. View at: Google Scholar
  26. A. Paoli, L. Cenci, and K. A. Grimaldi, “Effect of ketogenic mediterranean diet with phytoextracts and low carbohydrates/high-protein meals on weight, cardiovascular risk factors, body composition and diet compliance in Italian council employees,” Nutrition Journal, vol. 10, no. 1, article 112, 2011. View at: Publisher Site | Google Scholar
  27. T. N. Seyfried and P. Mukherjee, “Targeting energy metabolism in brain cancer: review and hypothesis,” Nutrition and Metabolism, vol. 2, article 30, 2005. View at: Publisher Site | Google Scholar
  28. J. A. Vazquez and U. Kazi, “Lipolysis and gluconeogenesis from glycerol during weight reduction with very-low-calorie diets,” Metabolism: Clinical and Experimental, vol. 43, no. 10, pp. 1293–1299, 1994. View at: Publisher Site | Google Scholar
  29. M. A. B. Veldhorst, M. S. Westerterp-Plantenga, and K. R. Westerterp, “Gluconeogenesis and energy expenditure after a high-protein, carbohydrate-free diet,” The American Journal of Clinical Nutrition, vol. 90, no. 3, pp. 519–526, 2009. View at: Publisher Site | Google Scholar
  30. A. M. Robinson and D. H. Williamson, “Physiological roles of ketone bodies as substrates and signals in mammalian tissues,” Physiological Reviews, vol. 60, no. 1, pp. 143–187, 1980. View at: Google Scholar
  31. H. A. Krebs, “The regulation of the release of ketone bodies by the liver,” Advances in Enzyme Regulation, vol. 4, pp. 339–353, 1966. View at: Publisher Site | Google Scholar
  32. N. Amen-Ra, “Humans are evolutionarily adapted to caloric restriction resulting from ecologically dictated dietary deprivation imposed during the Plio-Pleistocene period,” Medical Hypotheses, vol. 66, no. 5, pp. 978–984, 2006. View at: Publisher Site | Google Scholar
  33. J. C. Newman and E. Verdin, “Ketone bodies as signaling metabolites,” Trends in Endocrinology and Metabolism, vol. 25, no. 1, pp. 42–52, 2014. View at: Publisher Site | Google Scholar
  34. S. Jäer, C. Handschin, J. St-Pierre, and B. M. Spiegelman, “AMP-activated protein kinase (AMPK) action in skeletal muscle via direct phosphorylation of PGC-1α,” Proceedings of the National Academy of Sciences of the United States of America, vol. 104, no. 29, pp. 12017–12022, 2007. View at: Publisher Site | Google Scholar
  35. C. R. Benton, D. C. Wright, and A. Bonen, “PGC-1alpha-mediated regulation of gene expression and metabolism: implications for nutrition and exercise prescriptions,” Applied Physiology, Nutrition and Metabolism, vol. 33, no. 5, pp. 843–862, 2008. View at: Publisher Site | Google Scholar
  36. J. Yu and J. Auwerx, “Protein deacetylation by SIRT1: an emerging key post-translational modification in metabolic regulation,” Pharmacological Research, vol. 62, no. 1, pp. 35–41, 2010. View at: Publisher Site | Google Scholar
  37. D. L. Williamson, “Normalizing a hyperactive mTOR initiates muscle growth during obesity,” Aging, vol. 3, no. 2, pp. 83–84, 2011. View at: Google Scholar
  38. B. Draznin, C. Wang, R. Adochio, J. W. Leitner, and M.-A. Cornier, “Effect of dietary macronutrient composition on AMPK and SIRT1 expression and activity in human skeletal muscle,” Hormone and Metabolic Research, vol. 44, no. 9, pp. 650–655, 2012. View at: Publisher Site | Google Scholar
  39. J. C. Yoon, P. Puigserver, G. Chen et al., “Control of hepatic gluconeogenesis through the transcriptional coaotivator PGC-1,” Nature, vol. 413, no. 6852, pp. 131–138, 2001. View at: Publisher Site | Google Scholar
  40. N. B. Ruderman, X. J. Xu, L. Nelson et al., “AMPK and SIRT1: a long-standing partnership?” The American Journal of Physiology: Endocrinology and Metabolism, vol. 298, no. 4, pp. E751–E760, 2010. View at: Publisher Site | Google Scholar
  41. R. G. Miller, J. D. Mitchell, M. Lyon, and D. H. Moore, “Riluzole for amyotrophic lateral sclerosis (ALS)/motor neuron disease (MND),” Cochrane Database of Systematic Reviews, no. 2, Article ID CD001447, 2002. View at: Google Scholar
  42. L. I. Bruijn, T. M. Miller, and D. W. Cleveland, “Unraveling the mechanisms involved in motor neuron degeneration in ALS,” Annual Review of Neuroscience, vol. 27, pp. 723–749, 2004. View at: Publisher Site | Google Scholar
  43. L. P. Rowland and N. A. Shneider, “Amyotrophic lateral sclerosis,” The New England Journal of Medicine, vol. 344, no. 22, pp. 1688–1700, 2001. View at: Publisher Site | Google Scholar
  44. M. Strong and J. Rosenfeld, “Amyotrophic lateral sclerosis: a review of current concepts,” Amyotrophic Lateral Sclerosis and Other Motor Neuron Disorders, vol. 4, no. 3, pp. 136–143, 2003. View at: Publisher Site | Google Scholar
  45. N. Siva, “Can ketogenic diet slow progression of ALS?” The Lancet Neurology, vol. 5, no. 6, article 476, 2006. View at: Google Scholar
  46. D. R. Rosen, T. Siddique, D. Patterson et al., “Mutations in Cu/Zn superoxide dismutase gene are associated with familial amyotrophic lateral sclerosis,” Nature, vol. 362, no. 6415, pp. 59–62, 1993. View at: Publisher Site | Google Scholar
  47. P. Pasinelli, M. E. Belford, N. Lennon et al., “Amyotrophic lateral sclerosis-associated SOD1 mutant proteins bind and aggregate with Bcl-2 in spinal cord mitochondria,” Neuron, vol. 43, no. 1, pp. 19–30, 2004. View at: Publisher Site | Google Scholar
  48. S. Vielhaber, D. Kunz, K. Winkler et al., “Mitochondrial DNA abnormalities in skeletal muscle of patients with sporadic amyotrophic lateral sclerosis,” Brain, vol. 123, no. 7, pp. 1339–1348, 2000. View at: Publisher Site | Google Scholar
  49. K. Tieu, C. Perier, C. Caspersen et al., “D-β-Hydroxybutyrate rescues mitochondrial respiration and mitigates features of Parkinson disease,” Journal of Clinical Investigation, vol. 112, no. 6, pp. 892–901, 2003. View at: Publisher Site | Google Scholar
  50. Z. Zhao, D. J. Lange, A. Voustianiouk et al., “A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral sclerosis,” BMC Neuroscience, vol. 7, article 29, 2006. View at: Publisher Site | Google Scholar
  51. W. Zhao, M. Varghese, P. Vempati et al., “Caprylic triglyceride as a novel therapeutic approach to effectively improve the performance and attenuate the symptoms due to the motor neuron loss in ALS disease,” PLoS ONE, vol. 7, no. 11, Article ID e49191, 2012. View at: Publisher Site | Google Scholar
  52. E. I. Posse de Chaves, A. E. Rusinol, D. E. Vance, R. B. Campenot, and J. E. Vance, “Role of lipoproteins in the delivery of lipids to axons during axonal regeneration,” Journal of Biological Chemistry, vol. 272, no. 49, pp. 30766–30773, 1997. View at: Publisher Site | Google Scholar
  53. L. Dupuis, P. Corcia, A. Fergani et al., “Dyslipidemia is a protective factor in amyotrophic lateral sclerosis,” Neurology, vol. 70, no. 13, pp. 1004–1009, 2008. View at: Publisher Site | Google Scholar
  54. S. Paganoni, J. Deng, M. Jaffa, M. E. Cudkowicz, and A. Wills, “Body mass index, not dyslipidemia, is an independent predictor of survival in amyotrophic lateral sclerosis,” Muscle and Nerve, vol. 44, no. 1, pp. 20–24, 2011. View at: Publisher Site | Google Scholar
  55. A. M. Wills, J. Hubbard, E. A. Macklin et al., “Hypercaloric enteral nutrition in patients with amyotrophic lateral sclerosis: a randomised, double-blind, placebo-controlled phase 2 trial,” The Lancet, vol. 383, no. 9934, pp. 2065–2072, 2014. View at: Google Scholar
  56. A. Fergani, H. Oudart, J. G. De Aguilar et al., “Increased peripheral lipid clearance in an animal model of amyotrophic lateral sclerosis,” Journal of Lipid Research, vol. 48, no. 7, pp. 1571–1580, 2007. View at: Publisher Site | Google Scholar
  57. K. J. Bough, J. Wetherington, B. Hassel et al., “Mitochondrial biogenesis in the anticonvulsant mechanism of the ketogenic diet,” Annals of Neurology, vol. 60, no. 2, pp. 223–235, 2006. View at: Publisher Site | Google Scholar
  58. D. Y. Kim, J. Vallejo, and J. M. Rho, “Ketones prevent synaptic dysfunction induced by mitochondrial respiratory complex inhibitors,” Journal of Neurochemistry, vol. 114, no. 1, pp. 130–141, 2010. View at: Publisher Site | Google Scholar
  59. S. S. McDaniel, N. R. Rensing, L. L. Thio, K. A. Yamada, and M. Wong, “The ketogenic diet inhibits the mammalian target of rapamycin (mTOR) pathway,” Epilepsia, vol. 52, no. 3, pp. e7–e11, 2011. View at: Publisher Site | Google Scholar
  60. S. Srivastava, Y. Kashiwaya, M. T. King et al., “Mitochondrial biogenesis and increased uncoupling protein 1 in brown adipose tissue of mice fed a ketone ester diet,” FASEB Journal, vol. 26, no. 6, pp. 2351–2362, 2012. View at: Publisher Site | Google Scholar
  61. D. C. Wallace, W. Fan, and V. Procaccio, “Mitochondrial energetics and therapeutics,” Annual Review of Pathology, vol. 5, pp. 297–348, 2010. View at: Publisher Site | Google Scholar
  62. H. Kang, Y. Lee, and H. D. Kim, “Mitochondrial disease and epilepsy,” Brain and Development, vol. 35, no. 8, pp. 757–761, 2013. View at: Publisher Site | Google Scholar
  63. H. Kang, Y. Lee, H. D. Kim, J. S. Lee, and A. Slama, “Safe and effective use of the ketogenic diet in children with epilepsy and mitochondrial respiratory chain complex defects,” Epilepsia, vol. 48, no. 1, pp. 82–88, 2007. View at: Publisher Site | Google Scholar
  64. S. Ahola-Erkkilä, C. J. Carroll, K. Peltola-Mjösund et al., “Ketogenic diet slows down mitochondrial myopathy progression in mice,” Human Molecular Genetics, vol. 19, no. 10, Article ID ddq076, pp. 1974–1984, 2010. View at: Publisher Site | Google Scholar
  65. E. H. Kossoff, B. A. Zupec-Kania, P. E. Amark et al., “Optimal clinical management of children receiving the ketogenic diet: recommendations of the International Ketogenic Diet Study Group,” Epilepsia, vol. 50, no. 2, pp. 304–317, 2009. View at: Publisher Site | Google Scholar
  66. A. Serrano-Pozo, M. P. Frosch, E. Masliah, and B. T. Hyman, “Neuropathological alterations in Alzheimer disease,” Cold Spring Harbor perspectives in Medicine, vol. 1, no. 1, Article ID a006189, 2011. View at: Google Scholar
  67. P. G. Ridge, M. T. W. Ebbert, and J. S. K. Kauwe, “Genetics of alzheimer’s disease,” BioMed Research International, vol. 2013, Article ID 254954, 13 pages, 2013. View at: Publisher Site | Google Scholar
  68. J. Weuve, L. E. Hebert, P. A. Scherr, and D. A. Evans, “Deaths in the United States among persons with Alzheimer’s disease (2010–2050),” Alzheimer’s & Dementia, vol. 10, no. 2, pp. e40–e46, 2014. View at: Publisher Site | Google Scholar
  69. B. J. Balin and A. P. Hudson, “Etiology and pathogenesis of late-onset Alzheimer’s disease,” Current Allergy and Asthma Reports, vol. 14, article 417, 2014. View at: Publisher Site | Google Scholar
  70. D. M. Holtzman, E. Mandelkow, and D. J. Selkoe, “Alzheimer disease in 2020,” Cold Spring Harbor Perspectives in Medicine, vol. 2, no. 11, 2012. View at: Google Scholar
  71. D. Selkoe, E. Mandelkow, and D. Holtzman, “Deciphering Alzheimer disease,” Cold Spring Harbor perspectives in Medicine, vol. 2, no. 1, Article ID a011460, 2012. View at: Google Scholar
  72. J. Yao and R. D. Brinton, “Targeting mitochondrial bioenergetics for Alzheimer’s prevention and treatment,” Current Pharmaceutical Design, vol. 17, no. 31, pp. 3474–3479, 2011. View at: Publisher Site | Google Scholar
  73. S. A. Hashim and T. B. Vanitallie, “Ketone Body Therapy: from ketogenic diet to oral administration of ketone ester,” Journal of Lipid Research, 2014. View at: Publisher Site | Google Scholar
  74. Y. Kashiwaya, T. Takeshima, N. Mori, K. Nakashima, K. Clarke, and R. L. Veech, “D-beta-hydroxybutyrate protects neurons in models of Alzheimer’s and Parkinson’s disease,” Proceedings of the National Academy of Sciences of the United States of America, vol. 97, no. 10, pp. 5440–5444, 2000. View at: Publisher Site | Google Scholar
  75. Y. Kashiwaya, C. Bergman, J. Lee et al., “A ketone ester diet exhibits anxiolytic and cognition-sparing properties, and lessens amyloid and tau pathologies in a mouse model of Alzheimer’s disease,” Neurobiology of Aging, vol. 34, no. 6, pp. 1530–1539, 2013. View at: Publisher Site | Google Scholar
  76. I. Van Der Auwera, S. Wera, F. Van Leuven, and S. T. Henderson, “A ketogenic diet reduces amyloid beta 40 and 42 in a mouse model of Alzheimer’s disease,” Nutrition and Metabolism, vol. 2, article 28, 2005. View at: Publisher Site | Google Scholar
  77. C. M. Studzinski, W. A. MacKay, T. L. Beckett et al., “Induction of ketosis may improve mitochondrial function and decrease steady-state amyloid-β precursor protein (APP) levels in the aged dog,” Brain Research, vol. 1226, pp. 209–217, 2008. View at: Publisher Site | Google Scholar
  78. T. L. Beckett, C. M. Studzinski, J. N. Keller, M. Paul Murphy, and D. M. Niedowicz, “A ketogenic diet improves motor performance but does not affect β-amyloid levels in a mouse model of Alzheimer’s disease,” Brain Research, vol. 1505, pp. 61–67, 2013. View at: Publisher Site | Google Scholar
  79. K. Akter, E. A. Lanza, S. A. Martin, N. Myronyuk, M. Rua, and R. B. Raffa, “Diabetes mellitus and Alzheimer’s disease: shared pathology and treatment?” British Journal of Clinical Pharmacology, vol. 71, no. 3, pp. 365–376, 2011. View at: Publisher Site | Google Scholar
  80. H. M. Dashti, T. C. Mathew, M. Khadada et al., “Beneficial effects of ketogenic diet in obese diabetic subjects,” Molecular and Cellular Biochemistry, vol. 302, no. 1-2, pp. 249–256, 2007. View at: Publisher Site | Google Scholar
  81. A. Paoli, A. Bianco, K. A. Grimaldi, A. Lodi, and G. Bosco, “Long term successful weight loss with a combination biphasic ketogenic mediterranean diet and mediterranean diet maintenance protocol,” Nutrients, vol. 5, no. 12, pp. 5205–5217, 2013. View at: Publisher Site | Google Scholar
  82. E. C. Westman, W. S. Yancy Jr., J. C. Mavropoulos, M. Marquart, and J. R. McDuffie, “The effect of a low-carbohydrate, ketogenic diet versus a low-glycemic index diet on glycemic control in type 2 diabetes mellitus,” Nutrition and Metabolism, vol. 5, no. 1, article 36, 2008. View at: Publisher Site | Google Scholar
  83. V. Srikanth, A. Maczurek, T. Phan et al., “Advanced glycation endproducts and their receptor RAGE in Alzheimer’s disease,” Neurobiology of Aging, vol. 32, no. 5, pp. 763–777, 2011. View at: Publisher Site | Google Scholar
  84. M. Balietti, B. Giorgetti, G. Di Stefano et al., “A ketogenic diet increases succinic dehydrogenase (SDH) activity and recovers age-related decrease in numeric density of SDH-positive mitochondria in cerebellar Purkinje cells of late-adult rats,” Micron, vol. 41, no. 2, pp. 143–148, 2010. View at: Publisher Site | Google Scholar
  85. M. Balietti, P. Fattoretti, B. Giorgetti et al., “A ketogenic diet increases succinic dehydrogenase activity in aging cardiomyocytes,” Annals of the New York Academy of Sciences, vol. 1171, pp. 377–384, 2009. View at: Publisher Site | Google Scholar
  86. M. Maalouf, J. M. Rho, and M. P. Mattson, “The neuroprotective properties of calorie restriction, the ketogenic diet, and ketone bodies,” Brain Research Reviews, vol. 59, no. 2, pp. 293–315, 2009. View at: Publisher Site | Google Scholar
  87. F. Boumezbeur, G. F. Mason, R. A. de Graaf et al., “Altered brain mitochondrial metabolism in healthy aging as assessed by in vivo magnetic resonance spectroscopy,” Journal of Cerebral Blood Flow & Metabolism, vol. 30, no. 1, pp. 211–221, 2010. View at: Publisher Site | Google Scholar
  88. S. Hoyer, “Causes and consequences of disturbances of cerebral glucose metabolism in sporadic alzheimer disease: therapeutic Implications,” Advances in Experimental Medicine and Biology, vol. 541, pp. 135–152, 2003. View at: Google Scholar
  89. L. Mosconi, R. Mistur, R. Switalski et al., “Declining brain glucose metabolism in normal individuals with a maternal history of Alzheimer disease,” Neurology, vol. 72, no. 6, pp. 513–520, 2009. View at: Publisher Site | Google Scholar
  90. T. B. Vanitallie, “Preclinical sporadic Alzheimer’s disease: target for personalized diagnosis and preventive intervention,” Metabolism: Clinical and Experimental, vol. 62, supplement 1, pp. S30–S33, 2013. View at: Publisher Site | Google Scholar
  91. Y. Liu, F. Liu, K. Iqbal, I. Grundke-Iqbal, and C. Gong, “Decreased glucose transporters correlate to abnormal hyperphosphorylation of tau in Alzheimer disease,” FEBS Letters, vol. 582, no. 2, pp. 359–364, 2008. View at: Publisher Site | Google Scholar
  92. P. Veggiotti, F. Teutonico, E. Alfei et al., “Glucose transporter type 1 deficiency: Ketogenic diet in three patients with atypical phenotype,” Brain and Development, vol. 32, no. 5, pp. 404–408, 2010. View at: Publisher Site | Google Scholar
  93. M. A. Reger, S. T. Henderson, C. Hale et al., “Effects of β-hydroxybutyrate on cognition in memory-impaired adults,” Neurobiology of Aging, vol. 25, no. 3, pp. 311–314, 2004. View at: Publisher Site | Google Scholar
  94. A. Camilleri and N. Vassallo, “The centrality of mitochondria in the pathogenesis and treatment of Parkinson’s disease,” CNS Neuroscience & Therapeutics, vol. 20, no. 7, pp. 591–602, 2014. View at: Google Scholar
  95. B. Cheng, X. Yang, L. An, B. Gao, X. Liu, and S. Liu, “Ketogenic diet protects dopaminergic neurons against 6-OHDA neurotoxicity via up-regulating glutathione in a rat model of Parkinson’s disease,” Brain Research, vol. 1286, pp. 25–31, 2009. View at: Publisher Site | Google Scholar
  96. T. B. VanItallie, C. Nonas, A. Di Rocco, K. Boyar, K. Hyams, and S. B. Heymsfield, “Treatment of Parkinson disease with diet-induced hyperketonemia: a feasibility study,” Neurology, vol. 64, no. 4, pp. 728–730, 2005. View at: Publisher Site | Google Scholar
  97. Y. S. Shin, “Glycogen storage disease: clinical, biochemical, and molecular heterogeneity,” Seminars in Pediatric Neurology, vol. 13, no. 2, pp. 115–120, 2006. View at: Publisher Site | Google Scholar
  98. E. Gazzerro, A. L. Andreu, and C. Bruno, “Neuromuscular disorders of glycogen metabolism,” Current Neurology and Neuroscience Reports, vol. 13, article 333, 2013. View at: Publisher Site | Google Scholar
  99. T. Goldberg and A. E. Slonim, “Nutrition therapy for hepatic glycogen storage diseases,” Journal of the American Dietetic Association, vol. 93, no. 12, pp. 1423–1430, 1993. View at: Publisher Site | Google Scholar
  100. S. Heller, L. Worona, and A. Consuelo, “Nutritional therapy for glycogen storage diseases,” Journal of Pediatric Gastroenterology and Nutrition, vol. 47, pp. S15–S21, 2008. View at: Publisher Site | Google Scholar
  101. T. J. Triomphe, “Glycogen storage disease: a basic understanding and guide to nursing care.,” Journal of pediatric nursing, vol. 12, no. 4, pp. 238–249, 1997. View at: Publisher Site | Google Scholar
  102. J. B. Walter, General Pathology, 1987.
  103. V. Busch, K. Gempel, A. Hack et al., “Treatment of glycogenosis type V with ketogenic diet,” Annals of Neurology, vol. 58, no. 2, article 341, 2005. View at: Google Scholar
  104. M. Vorgerd and J. Zange, “Treatment of glycogenosys type V (McArdle disease) with creatine and ketogenic diet with clinical scores and with 31P-MRS on working leg muscle,” Acta Myologica, vol. 26, no. 1, pp. 61–63, 2007. View at: Google Scholar
  105. J. M. Rho and R. Sankar, “The ketogenic diet in a pill: is this possible?” Epilepsia, vol. 49, supplement 8, pp. 127–133, 2008. View at: Publisher Site | Google Scholar
  106. P. Veggiotti and V. De Giorgis, “Dietary treatments and new therapeutic perspective in GLUT1 deficiency syndrome,” Current Treatment Options in Neurology, vol. 16, no. 5, p. 291, 2014. View at: Publisher Site | Google Scholar
  107. V. Valayannopoulos, F. Bajolle, J. Arnoux et al., “Successful treatment of severe cardiomyopathy in glycogen storage disease type III with d,l-3-hydroxybutyrate, ketogenic and high-protein diet,” Pediatric Research, vol. 70, no. 6, pp. 638–641, 2011. View at: Publisher Site | Google Scholar

Antonio Paoli, Antonino Bianco, Ernesto Damiani, and Gerardo Bosco
Department of Biomedical Sciences, University of Padova, Via Marzolo 3, 35031 Padova, ItalySport and Exercise Sciences Research Unit, University of Palermo, Via Eleonora Duse 2, 90146 Palermo, Italy
Academic Editor: Giuseppe D’Antona
Received24 Apr 2014
Accepted30 May 2014
Published03 Jul 2014
Copyright © 2014 Antonio Paoli et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.



Ketogeeninen ruokavalio ja epilepsia

Ketogeenisen ruokavalion neuroprotektiiviset ominaisuudet on tunnettu pitkään. Jo vuosisadan ajan lasten lääkeresistenttia epilepsiaa on hoidettu ketogeenisellä ruokavaliolla. Kuva ketogeenisen ruokavalion neuroprotektiivisista vaikutuksista tarkentuu jatkuvasti.

Ketogeenisen ruokavalion (KD) hyöty epilepsian ja eräiden muiden neurologisten häiriöiden terapiana hyväksytään laajalti, mutta sen kaikkia toimintamekanismeja ei täysin tunneta.

KD:n noudattaminen johtaa merkittäviin metabolisiin muutoksiin. Eräs tärkeimmistä metabolisista muutoksista on ketoosi. Toisaalta ketogeeninen ruokavalio lisää myös monityydyttämättömien rasvahappojen pitoisuutta ja laukaisee solujen puhdistusjärjestelmän, eli autofagian, joka hidastaa solujen ikääntymistä ja siivoaa soluista erilaisia kuona-aineita.

Nämä ”primaariset” vaikutukset johtavat ”toissijaisiin”, osittain adaptiivisiin vaikutuksiin, esimerkiksi muutoksiin mitokondrioiden tiheydessä ja geeniekspressiossa. Kliinisesti ruokavalion vaikutuksia pidetään epileptisiä kouristuksia estävinä ja neuroprotektiivisina.

Ketogeenisen ruokavalion aineenvaihduntamekanismien mahdollisiä kliinisiä, neuroprotektiivisia ja kognitiivisia vaikutuksia tutkitaan laajasti NASA:a ja Yhdysvaltojen puolustusministeriötä myöten.

1. Ketogeenisen ruokavalion metabolia

Ketogeenisen ruokavalion (KD) arvo epilepsian hoidossa tunnustetaan, vaikka tarkat mekanismit, joilla se vaikuttaa, ovat edelleen osin selvittämättä [1]. Ketogeenisen ruokavalion tuottamat metaboliset muutokset ovat kuitenkin erilaisia kuin epilepsialääkkeiden (AED) [2] vaikutusmekanismit. Näiden mekanismien selvittäminen voi johtaa ketogeenisen ruokavalion hyödyntämiseen myös muiden neurologisten sairauksien terapiana [3].

KD koostuu neljästä elementistä, joista minkä tahansa muutokset voivat selittää sen kouristuksia ehkäiseviä eli antikonvulsantteja vaikutuksia:

  1. lisääntynyt rasvan määrä, yleensä suhteessa 3-4 grammaa rasvaa kutakin proteiini- ja hiilihydraattigrammaa kohti
  2. mahdollisimman pieni glukoosin kulutus
  3. kalorirajoitus
  4. nesterajoitus

[1] Vaikka viimeisestä elementistä (4) on esitetty jonkin verran kritiikkiä, kliininen käytäntö on osoittanut, että nesteen rajoittamisen lopettaminen voi johtaa kohtausten uusiutumiseen hyvin samalla tavalla kuin lopetettaessa glukoosirajoitus.

KD: n noudattaminen johtaa krooniseen ketoosiin [5]. Ruokavalion noudattamisen tärkein tulos on vapaiden rasvahappojen (FFA) pitoisuuden lisääntyminen veressä. Vapaat rasvahapot (FFA) kuljetetaan mitokondrioihin, jossa ne päätyvät β -oksidatiiviseen prosessiin. Tämä β-oksidaatio, jossa vapaat rasvahapot hajotetaan ketoneiksi, edellyttää karnitiinia.

Kuva: Ketogeenisen ruokavalion metaboliset muutokset

Ketoaineisiin kuuluvat β-hydroksibutyraatti, asetoasetaatti ja asetoni [5]

1.1. Ketoaineiden merkitys

Ketoneiden (asetonin, asetoasetaatin ja beta-hydroksibutyraatin) lisääntynyt pitoisuus veressä voi olla ketogeenisen ruokavalion merkittävin epileptisiä kohtauksia hillitsevistä metabolisista vaikutuksista.

Ketoaineiden hajoaminen toimittaa asetyyli-CoA:n suoraan trikarboksyylihapposykliin, mikä tehostaa energia-aineenvaihduntaa. Samalla tämä aineenvaihduntakanava kiertää glykolyysissä syntyvän asetyylikoentsyymi-A:n tarpeen ATP:n tuotannossa.

Toisin kuin glukoosi, joka vaatii kuljettajan läpäistäkseen veri-aivoesteen, ketoaineet läpäisevät veri-aivoesteen helposti. Kun kuljetusmolekyyleistä, kuten glut 1, on puutetta, KD on suositeltava epilepsiaterapia, koska sen avulla on mahdollista kiertää solujen glukoosin tarve [1]. Lapset, joilla pyruvaatin muuntuminen asetyyli-CoA:ksi on estynyt esimerkiksi pyruvaattidehydrogenaasin (PDH) puutteessa, hyötyvät glukoosin aineenvaihduntareitin ohittamisesta [3].

β-hydroksibutyraatti on veressä mitattavista ketoneista hallitseva ketoaine, ja sitä käytetään ketoosin asteen seuraamiseen terapian aikana. Beta-hydroksibutyraatin hajoaminen johtaa lisääntyneeseen asetonin tuotantoon [6].

Asetoni on yksi ketoaineista, joilla on kouristuksia hillitsevä, eli antikonvulsanttinen vaikutus erilaisissa hiirien kliinisissä kohtausmalleissa [7]. Tämän vaikutusmekanismia ei tunneta, vaikka vaikutusta K2p-kanaviin pidetään mahdollisena [5]. TCA-syklin (sitruunahappokierron) avulla asetyyli-CoA lisää hermovälittäjäaineiden glutamaatin ja gamma-aminovoihapon (GABA) ja vastaavasti tärkeimpien aivojen eksitatoristen ja estävien välittäjäaineiden määrää aivoissa.

Gamma-aminovoihappo eli GABA on tärkein aivojen ja muun keskushermoston hermosolujen toimintaa jarruttava välittäjäaine. GABA:n välittämä viesti on luonteeltaan inhibitorinen eli vaimentava tai lamaava: GABA välittää hermosolulle käskyn vähentää toimintaa tai lopettaa toimintansa. Noin 40 % aivosoluista reagoi gamma-aminovoihapon inhibitoriseen vaikutukseen. Yksittäisissä neuroneissa GABAn vaikutus voi olla myös eksitoiva eli kiihdyttävä. Elimistön tärkein kiihottava välittäjäaine, GABA:n vastavaikuttaja, on glutamaatti.
GABA:n nauttiminen lisää kasvuhormonin ja prolaktiinin synteesiä. GABA voi auttaa nukahtamisvaikeuksista kärsiviä ja parantaa unen laatua.
GABA- eli gamma-aminovoihapporeseptoreita on kahta päätyyppiä; GABAA ionikanavareseptori ja GABAB G-proteiinikytkentäinen reseptori. GABAC tunnetaan nykyään GABAA-rho reseptorina. Myös reseptorien alatyyppejä tunnetaan.
Monet rauhoittavat lääkeaineet kuten bentsodiatsepiinit ja barbituraatit lisäävät hermoston GABA-aktiivisuutta aiheuttaen hermoratojen toiminnan epäspesifiä, yleistynyttä hidastumista. Bentsodiatsepiiniryhmään kuuluvat lääkeaineet sitoutuvat bentsodiatsepiinireseptoreihin, GABAA-reseptorin alatyyppiin aiheuttaen positiivisen allosteerisen modulaation johtaen kloridikavanan avautumistaajuuden kiihtymiseen. Barbituraattien vaikutusmekanismi on hieman erilainen, ne pidentävät suoraan kloridikanavan aukioloaikaa sitoutumalla GABAA β-aliyksikköön. Tässä on syy barbituraattien myrkyllisyyteen bentsodiatsepiineihin verrattuna yliannostustapauksissa. Näitä reseptoreita on sekä aivoissa että sisäelimissä.
Myös monet epilepsialääkkeet (esimerkiksi valproaatti, vigabatriini, gabapentiini ja topiramaatti) tehostavat elimistön oman GABA:n vaikutusta.
Baklofeeni (Baclon, Baclopar, Lioresal) on GABAB-agonisti eli se jäljittelee GABA:n vaikutusta elimistössä ja sitoutuu GABAB-reseptoreihin. Baklofeenia käytetään yleisimmin keskushermoston toiminnan aiheuttaman liiallisen lihasjänteyden ja spasmien hoidossa. Sairauksia, joissa baklofeenia yleisesti käytetään, ovat muun muassa MS-tauti ja selkäydinvammat. Baklofeenista voi olla apua dystoniaan.
GABA:n puute voi aiheuttaa ahdistuneisuutta, masentuneisuutta ja epileptisiä kohtauksia.
GABA transaminaasi entsyymi katalysoi gamma-aminovoihapon ja 2-oksoglutaraatin muuntumista sukkiinisemialdehydiksi ja glutamaatiksi. Sukkiinisemialdehydin taas hapettaa sukkiinihapoksi sukkiinisemialdehydi dehydrogenaasientsyymi, ja sen jälkeen se on käypä energianlähde sitruunahappokierrossa. – Wikipedia

GABAn lisääntynyt vaikutus keskushermostossa voi selittää ketogeenisen ruokavalion kouristuksia hillitsevää vaikutusta[5].

1.2. Monityydyttymättömien rasvahappojen (PUFA) merkitys

Vapaiden rasvahappojen lisääntymisen seurauksena on monityydyttymättömien rasvahappojen (PUFA) pitoisuuden kasvu.

PUFA:n potentiaalinen kyky estää kohtauksia aivoissa saattaa liittyä melko monimutkaisiin mekanismeihin, kuten:

  1. sähköisen jännitteen rajoittamien natrium- ja kalsiumkanavien estäminen
  2. lipidille herkän kaliumkanavan aktivointi
  3. hermosolujen stimulaatiota rajoittavan natriumpumpun aktiivisuuden tehostaminen
  4. peroksisomiproliferaattorilla aktivoituvan reseptori-a:n (PPARa) aktivoiminen
  5. PUFA indusoi aivospesifisten irrotusproteiinien ilmentymistä ja aktiivisuutta mitokondrioissa, vaikuttaen siten neuroprotektiivisesti

[5]. Tämä viimeinen vaikutus toimii rajoittamalla reaktiivisten happiradikaalien (ROS) syntymistä.

1.3. Bioenergetiikka ja neuroprotektiivinen

Ketogeenistä ruokavaliota on ensisijaisesti pidetty epileptisia kouristuksia ehkäisevänä. KD-ruokavalion tutkimukset viittaavat paljon laajempiin ja monimutkaisempiin nuroprotektiivisiin vaikutuksiin.

Neuroprotektiivisuus voi vaikuttaa antikonvulsanttisesti (kouristuksia ehkäisevästi), mutta sillä on myös muita merkittäviä metabolisia vaikutuksia [3]. Kaiken kaikkiaan KD:n noudattaminen lisää ja tehostaa energian tuotantoa aivoissa. Appleton ja De vivo [8] kertoivat, että KD lisäsi bioenergeettisten substraattien (adenosiinitrifosfaatti (ATP)) kokonaismäärää ja nosti energian varausta rottien aivoissa.

Asetoasetaatti, beta-hydroksibutyraatin dehydraustuote, muutetaan asetyylikoentsyymi-A:ksi, joka kulkeutuu trikarboksyylihapposykliin (TCA), eli sitruunahappokiertoon.

Asetyylikoentsyymi-A eli aktiivinen etikkahappo on kaikille ravintoaineille yhteinen välituote solun valmistaessa energiaa. Asetyylikoentsyymi-A:ta saadaan monosakkarideista, triglyserideistä sekä aminohapoista erilaisten reaktiovaiheiden kautta.

Asetyylikoentsyymi-A:n asetyyliryhmän hiilet (C) hapettuvat hiilidioksidiksi TCA-syklissä ja vedyt (H) siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, esimerkiksi ATP:ksi.

Solujen energialähteinä toimivat ensi sijassa hiilihydraatit ja rasvahapot, mutta muitakin molekyylejä esimerkiksi aminohappoja voidaan käyttää. Aminohappojen käyttö energialähteenä on tosin normaalitilanteissa vähäistä.

Glukoosi hajoaa glykolyysissä kahdeksi pyruvaatiksi, joista edelleen molemmista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta. Jos taas happea (O) ja mitokondrioita ei ole tarpeeksi saatavilla, pyruvaatti pelkistyy edelleen maitohapon anioniksi laktaatiksi. Rasvahapot hajoavat pääasiassa hapettumalla β-oksidaatiossa niin, että rasvahappoketjusta irtoaa kahden hiilen asetyyliryhmiä, jotka ovat kiinnittyneenä reaktioon osallistuvaan koentsyymi-A:han.

TCA-syklin lisääntynyt energiatuotanto tuottaa protoneja ja elektroneja, jotka kanavoituvat elektronien siirtoketjuun. Tämä puolestaan lisää ATP:n muodostumista adenosiinidifosfaatista (ADP) ATP-syntaasin avulla.

ATP voidaan joko muuttaa fosfokreatiiniksi energian varastointia varten tai hajottaa adenosiiniksi. Lisääntyneet ATP-tasot tarjoavat energiavaroja hermosolun toiminnan ylläpitämiseksi myös silloin, kun solun glukoosinotto on häiriintynyt. Lisääntynyt solunulkoinen adenosiini toimii eräänlaisena neuroprotektiivisena puskurina laskemalla jännitettä ja estämällä siten paikallisia kohtauksia [6].

On myös arveltu, että KD vaikuttaa energiametaboliaentsyymejä koodaavien transkriptiotekijöiden säätelyyn (ylösregulointiin) ja mitokondrioiden tiheyden lisääntymiseen hermosoluissa, mikä johtaa kasvaneisiin energiavarastoihin.

Energian saannin helpottuminen voi tukea kohtausten ehkäisemistä esimerkiksi tukemalla GABAergistä estoa [9].

Wikipedia:Aivojen välittäjäaineet ovat kemiallisia välittäjämolekyylejä, jotka välittävät (eksitoivat, inhiboivat tai moduloivat) signaaleja aivojen hermosolujen eli neuronien välillä. Eksitoiva välittäjäaine kiihdyttää, inhiboiva välittäjäaine jarruttaa aivotoimintaa. Välittäjäaineet eli neurotransmitterit siirtyvät neuronien välillä synapseissa.

Keskushermoston eli aivojen ja selkäytimen tärkeimpiä neurotransmittereita ovat aminohapot. Noin 80–90 prosentissa keskushermoston synapseista välittäjäaineena toimii aminohappo, 5–10 prosentissa amiini ja 1–2 prosentissa peptidi.

Aivoissa tärkeitä aminohappotransmittereita ovat muun muassa glutamaatti ja glysiini, joista edellinen saattaa olla aivojen tärkein kiihdyttävä välittäjäaine. Glutamaatilla on kolmentyyppisiä reseptoreita. Ne on nimetty niille suhteellisen spesifien agonistien mukaan N-metyylidekstroaspartaatti (NMDA)-, kainaatti- ja 1-amino-3-hydroksi-5-metyyli-iso-oksatsoli-4-propionaatti (AMPA)-reseptoreiksi; mahdollisesti on olemassa muunkin tyyppisiä reseptoreita.

Gamma-aminovoihappo eli γ-aminovoihappo eli GABA on tärkein aivojen toimintaa jarruttava välittäjäaine. Jopa yli kolmasosa aivojen synapseista on GABAergisiä. GABA:lla on monia reseptoreita, esimerkiksi GABAA ja GABAB. Glutamaatti ja GABA muodostavat ikään kuin eksitoiva/inhiboiva välittäjäaineparin aivoissa.

Aminohapoista yksinkertaisin eli glysiini toimii inhibitorisena välittäjäaineena keskushermostossa. Sen reseptoreita löytyy etupäässä selkäytimestä. Glysiinin välittäjäaineparina etupäässä selkäytimen alueella toimii eksitoiva aminohappo aspartaatti. Asetyylikoliinin vaikutus aivokuorella ja hippokampuksessa on pääosin eksitoiva; myös inhibitiota saattaa esiintyä, mutta se on liitetty viereisten inhiboivien GABAergisten solujen aktivaatioon.

Alzheimerin taudissa asetyylikoliiniradat isoaivokuorelle ja hippokampukseen vaurioituvat, mikä aiheuttaa dementian. Noradrenaliinia on runsaasti aivorungon pienissä locus coeruleus -tumakkeissa, joista lähtevät aksonit haarautuvat eri tahoille, muun muassa hypotalamukseen, pikkuaivoihin ja isoaivokuorelle. Noradrenaliini osallistuu muun muassa vireystilan säätelyyn.

Dopamiinia sisältäviä neuroneja on runsaasti erityisesti keskiaivoissa substantia nigran ja tegmentumin tienoilla. Näiden aksonit haarautuvat laajalle alueelle. Aivoissa on neljä dopaminergista päärataa: mesokortikaalinen, mesolimbinen, nigrostriataalinen ja tuberoinfundibulaarinen. Nigrostriataalisen radan tuhoutuessa ilmentyy Parkinsonin tauti.

Skitsofrenian ajatellaan johtuvan mesokortikaalisen ja mesolimbisen radan dopamiinin D2-reseptorien ylistimuloitumisesta. Serotoniinia eli 5-hydroksitryptamiinia sisältävien hermosolujen soomaosista suurin osa sijaitsee ydinjatkoksen keskiviivalla olevassa raphe-tumakkeessa. Näiden neuronien aksonit ulottuvat aivojen kaikkiin osiin. Serotoniini osallistuu muun muassa tunne-elämän, muistin, syömiskäyttäytymisen ja ruumiinlämmön säätelyyn.

Histamiinia on ennen muuta hypotalamuksen corpora mamillare -alueella olevissa neuroneissa, jotka projisoituvat useimpiin aivojen osiin. Keskushermostossa histamiini osallistuu muun muassa neuroendokriiniseen säätelyyn, uni-valverytmin, vireystilan ja ruokahalun säätelyyn. Edellä mainittujen välittäjäaineiden lisäksi aivoissa vaikuttaa muun muassa suuri määrä erilaisia neuropeptidejä.

Merkittävimmät

Muut

On esitetty hypoteesi, jonka mukaan metaboliset sopeutumisprosessit ruokavalion aiheuttamiin muutoksiin aiheuttaa muutoksia geeniekspressiossa, mikä puolestaan johtaa joihinkin edellä mainituista muutoksista. Muu neuroprotektiivinen polku moduloidaan vähentämällä reaktiivisten happiradikaalien muodostumista, jonka katsotaan liittyvän monityydyttämättömien rasvahappojen vaikutukseen solujen irrotettavissa proteiineissa [5].

1.4. Ketogeenisen ruokavalion muita kliinisiä etuja

Ketogeenistä ruokavaliota pidetään todistetusti toimivana terapiamuotona, jolla on hyvin vähän haitallisia vaikutuksia. Laaja KD-terapiaa tukeva kliininen näyttö erityisesti lapsilla esiintyvän epilepsian hoitona on johtanut viimeaikaisiin laajempiin tutkimuksiin ketogeenisen ruokavalion metabolisista hyödyistä esimerkiksi neurodegeneratiivisten sairauksien hoidossa[3].

Eräs mielenkiintoisimmista ja aktiivisimmista tutkimusalueista on runsaasti rasvaa sisältävän kaloripitoisen ruokavalion vaikutus aivokasvainsolujen selviytymiseen. Aivosyöpäsoluilla on rajoitettu metabolinen joustavuus. Ne ovat hyvin riippuvaisia glukoosimetaboliasta.

Mitokondrioiden poikkeavuudet heikentävät aivokasvainten kykyä tuottaa energiaa ketoaineista. Toisin kuin normaaleissa soluissa, pahanlaatuisilla kasvainsoluilla on heikentynyt geneettinen sopeutumiskyky muuttuviin energiasubstraatteihin. Niiden energiansaanti rajoittuu lähinnä glukoosiin, minkä vuoksi paasto, niukkaenerginen ruoka ja ketogeeninen ruokavalio heikentävät syöpäsoluja. Näitä samoja aivokasvainten kehittymiseen liittyviä geneettisiä vikoja voidaan hyödyntää pahanlaatuisten solujen tuhoamisessa [3, 10, 11].

Vuonna 1995 Nebeling et al. [12] raportoi kahdesta nuoresta tytöstä, joilla oli pitkälle edennyt aivokasvain. Tyttöjen syövät reagoivat heikosti sädehoitoon ja kemoterapiaan. Lopulta tyttöjä päätettiin hoitaa ketogeenisella ruokavaliolla. Heidän vasteensa KD-hoidolle oli merkittävä sekä kliinisesti että positroniemissiotomografian seurantatutkimusten mukaan.

Zuccoli et al. [13] kuvasi potilasta, jolla oli erittäin pahanlaatuinen multippeli glioblastoma ( kasvain), joka parani ketogeenisella ruokavaliolla. Hullua kyllä, hoidon houkuttelevasta tehokkuudesta ja hyvistä alustavista tuloksista huolimatta aivokasvainten hoitoa ketogeenisellä ruokavaliolla ei ole sittemmin kliinisesti tutkittu ihmisillä. Miksi?

Useat hiiri- ja rotamalleilla tehdyt laboratoriotutkimukset ovat äskettäin vahvistaneet, että aivokasvaimen kasvun estyminen liittyy suoraan alentuneisiin glukoosipitoisuuksiin ja kohonneisiin ketoaineiden pitoisuuksiin. Lisäksi KD:n osoitettiin vähentävän aivojen reaktiivisia happiradikaaleja (ROS) [5].

Syöpäsolut tarvitsevat korkeita ROS-tasoja angiogeneesin indusoimiseksi ja kasvainten kasvutekijöiden tuottamiseksi [11], joten tämä mekanismi selittää KD:n vaikutusta.

Esimerkki:

12-vuotiaalla tytöllä todettiin keskushermostoon vaikuttava neurokutaaninen melanoosi Kasvain oli erittäin pahanlaatuinen ja eteni nopeasti. Kliiniset oireet olivat pääasiassa vaikeita kohtauksia, jotka edellyttivät toistuvaa pääsyä tehohoitoyksikköön sekä kohtausten lisäksi vakavia kognitiivisia ja valppauteen liittyviä oireita. Kun onkologit päättivät, että kasvainten vastainen hoito olisi tehotonta, tyttöä ryhdyttiin hoitamaan ketogeenisella ruokavaliolla. Neljän viikon kokeilun jälkeen KD:llä ei ollut mitään vaikutusta kasvaimen etenemiseen. Kohtausten taajuus ja vakavuus parani, mutta häntä hoidettiin samanaikaisesti AED:n kanssa. Ketogeenisellä ruokavaliolla oli kuitenkin huomattava parantava vaikutus tytön kognitioon, valppauteen ja mielialaan sairauden vakavuudesta ja etenemisestä huolimatta.

KD:n myönteinen vaikutus kognitioon, valppauteen ja mielialaan tunnetaan hyvin [1]. Tämä voi olla erityisen tärkeää nuorten vakavien kasvainten etenevissä vaiheissa. KD:n mahdollinen neuroprotektiivinen vaikutus motivoi tutkimuksia sen potentiaalista hoitovaihtoehtona muissa neurologisissa häiriöissä [3].

Yhä useammat eläintutkimukset osoittavat, että paastolla ja ketogeenisellä ruokavaliolla saavutetulla ketoosilla on selkä ja johdonmukainen neuroprotektiivinen vaikutus erilaisisten aivovaurioiden jälkeen.

Yksi ihmisillä toteutettu pienimuotoinen pilottitutkimus ja useat eläinmallitutkimukset ovat osoittaneet autististen käyttäytymisparametrien parantuneen KD-hoidolla. Vielä on selvitettävä, liittyykö tämä vähentyneeseen epileptiseen aktiivisuuteen, jota havaitaan jopa 30%: lla näistä potilaista, vai KD:n ensisijaiseen vaikutukseen [3]. Tämä tekijä, joka voi olla ratkaiseva KD:n soveltamiselle muiden neurologisten häiriöiden hoitoon, kuin kuin vaikeasti hoidettava epilepsia [14].

Yhteenvetona voidaan todeta, että ketogeenisen ruokavalion pääasiallinen metabolinen vaikutus on aivojen energiansaannin turvaaminen vapailla rasvahapoilla. Niiden hajoaminen ketoaineiksi yhdessä PUFA-yhdisteiden lisääntymisen kanssa johtaa merkittäviin muutoksiin aineenvaihdunnan, bioenergian, mitokondrioiden ja jopa geenien toiminnassa. Näillä primaarisilla ja sekundaarisillä muutoksilla on kouristuksia estäviä ja neuroprotektiivisia vaikutuksia. KD on merkittävä osa lasten epileptologien terapiavaihtoehtoja. Onko ketogeeninen ruokavalio yhtä tehokas hoitoväline myös neurodegeneratiivisten tautien, kuten Parkinsonin ja Alzheimerin taudin hoidossa ja muissa patologioissa, kuten pahanlaatuisten kasvainten hoidossa? Tätä tutktitaan. Tulokset tämän artikkelin julkaisun (2011) jälkeen ovat olleet hyvin lupaavia.

Viitteet

  1. A. L. Hartman and E. P. G. Vining, “Clinical aspects of the ketogenic diet,” Epilepsia, vol. 48, no. 1, pp. 31–42, 2007. View at: Publisher Site | Google Scholar
  2. A. L. Hartman and J. M. Freeman, “Does the effectiveness of the ketogenic diet in different epilepsies yield insights into its mechanisms?” Epilepsia, vol. 49, supplement 8, pp. 53–56, 2008. View at: Publisher Site | Google Scholar
  3. K. W. Barañano and A. L. Hartman, “The ketogenic diet: uses in epilepsy and other neurologic illnesses,” Current Treatment Options in Neurology, vol. 10, no. 6, pp. 410–419, 2008. View at: Publisher Site | Google Scholar
  4. E. C. Wirrell, “Ketogenic ratio, calories, and fluids: do they matter?” Epilepsia, vol. 49, supplement 8, pp. 17–19, 2008. View at: Publisher Site | Google Scholar
  5. K. J. Bough and J. M. Rho, “Anticonvulsant mechanisms of the ketogenic diet,” Epilepsia, vol. 48, no. 1, pp. 43–58, 2007. View at: Publisher Site | Google Scholar
  6. S. A. Masino, M. Kawamura, C. A. Wasser, L. T. Pomeroy, and D. N. Ruskin, “Adenosine, ketogenic diet and epilepsy: the emerging therapeutic relationship between metabolism and brain activity,” Current Neuropharmacology, vol. 7, no. 3, pp. 257–268, 2009. View at: Publisher Site | Google Scholar
  7. N. Hasebe, K. Abe, E. Sugiyama, R. Hosoi, and O. Inoue, “Anticonvulsant effects of methyl ethyl ketone and diethyl ketone in several types of mouse seizure models,” European Journal of Pharmacology, vol. 642, pp. 66–71, 2010. View at: Publisher Site | Google Scholar
  8. D. B. Appleton and D. C. De Vivo, “An experimental animal model for the effect of ketogenic diet on epilepsy,” Proceedings of the Australian Association of Neurologists, vol. 10, pp. 75–80, 1973. View at: Google Scholar
  9. K. Bough, “Energy metabolism as part of the anticonvulsant mechanism of the ketogenic diet,” Epilepsia, vol. 49, supplement 8, pp. 91–93, 2008. View at: Publisher Site | Google Scholar
  10. B. T. Seyfried, M. Kiebish, J. Marsh, and P. Mukherjee, “Targeting energy metabolism in brain cancer through calorie restriction and the ketogenic diet,” Journal of Cancer Research and Therapeutics, vol. 5, supplement 1, pp. S7–15, 2009. View at: Google Scholar
  11. P. Stafford, M. G. Abdelwahab, D. Y. Kim, M. C. Preul, J. M. Rho, and A. C. Scheck, “The ketogenic diet reverses gene expression patterns and reduces reactive oxygen species levels when used as an adjuvant therapy for glioma,” Nutrition and Metabolism, vol. 7, article 74, 2010. View at: Publisher Site | Google Scholar
  12. L. C. Nebeling, F. Miraldi, S. B. Shurin, and E. Lerner, “Effects of a ketogenic diet on tumor metabolism and nutritional status in pediatric oncology patients: two case reports,” Journal of the American College of Nutrition, vol. 14, no. 2, pp. 202–208, 1995. View at: Google Scholar
  13. G. Zuccoli, N. Marcello, A. Pisanello et al., “Metabolic management of glioblastoma multiforme using standard therapy together with a restricted ketogenic diet: case report,” Nutrition & Metabolism, p. 33, 2010. View at: Publisher Site | Google Scholar
  14. J. H. Cross, A. Mclellan, E. G. Neal, S. Philip, E. Williams, and R. E. Williams, “The ketogenic diet in childhood epilepsy: where are we now?” Archives of Disease in Childhood, vol. 95, no. 7, pp. 550–553, 2010. View at: Publisher Site | Google Scholar

Keren Politi, Lilach Shemer-Meiri, Avinoam Shuper, and S. Aharoni, Department of Pediatric and Adolescent Neurology, Schneider Children’s Medical Center of Israel, Faculty of Medicine, Tel Aviv University, Tel Aviv, Israel

Copyright © 2011 Keren Politi et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

https://www.hindawi.com/journals/ert/2011/963637/




Solujen puhdistusjärjestelmä – autofagosytoosi

Virtuaalisessa rinnakkaistodellisuudessa kierot käärmeöljykauppiaat kauppaavat pitkää ikää ja terveitä elinvuosia erilaisilla detox-kuureilla, jotka voivat perustua mihin tahansa parsa- tai hopeaveden ja tislatun veden välillä. Jotkin näistä ovat parhaimmillaankin terveyden kannalta neutraaleja, mutta osa kuureista on hengenvaarallisia.

Vaikeisiin ongelmiin ei ole helppoja ratkaisuja. On kuitenkin menetelmä, joka kasvavan tieteellisen tutkimusaineiston perusteella puhdistaa elimistöstä haitallisia ja myrkyllisiä partikkeleita. Se on tehokas ja vieläpä täysin maksuton.

Autofagosytoosi on prosessi, jossa solut kierrättävät vaurioituneita, sairastuneita ja ikääntyneitä solujen osia energiaksi ja uusiksi soluelimiksi.

Toimiva autofagosytoosi on avainasemassa hyvän terveyden ja pitkäikäisyyden kannalta. Kun solut vaurioituvat pysyvästi esimerkiksi tulehduksissa ja ikääntyessään, elimistöön kertyy nopeasti toimimattomia ja haitallisia solunosia, jotka pitää korjata tai siivota elimistöstä.

Autofagosytoosi on soluissa tarkasti säädelty prosessi, jossa lysosomaaliset entsyymit hajottavat solun omia rakenneosia, solulimaa ja soluelimiä (esim. mitokondrioita) kalvon ympäröimissä autofagosomeiksi kutsutuissa rakenteissa.

Autofagosomi


Autofagosomi on pallomainen rakenne, jossa on kaksikerroksiset kalvot. Se on avainrakenne
makroautofagiassa, solunsisäisessä hajoamisjärjestelmässä sytoplasman sisällölle, jossa:

  • epänormaalit solunsisäiset proteiinit
  • ylimääräiset tai vaurioituneet organellit
  • mikro-organismit

kierrätetään soluissa ja käytetään solujen uusien rakenteiden osiksi tai ravinnoksi.

Muodostumisen jälkeen autofagosomit toimittavat sytoplasman komponentit lysosomeihin. Autofagosomin ulkokalvo sulautuu lysosomiin muodostaen autolysosomin. Lysosomin hydrolaasit hajottavat autofagosomista vapautuneen sisällön ja sen sisemmän kalvon.

Autofagosomien muodostumista säätelevät eräät geeniperheet, jotka aiemmin tunnettiin nimellä APG, AUT, CVT, GSA, PAZ ja PDD. Geeniperheet on yhdistetty ATG-perheeksi (AuTophaGy related).

Joissakin soluissa, kuten alkion kantasoluuissa, alkion fibroblasteissa ja maksasoluissa, autofagosomit voidaan nähdä renkaanmuotoisina rakenteina valomikroskopialla.

Aluksi autofagosomit sulautuvat endosomeihin tai endosomista peräisin oleviin rakkuloihin. Näitä rakenteita kutsutaan sitten amfisomeiksi tai välituotteiksi autofagisiksi vakuoleiksi. Nämä rakenteet sisältävät endosyyttisiä markkereita, jopa pieniä lysosomaalisia proteiineja, kuten katepsiini D.

Tutkimuksissa on saatu vahvaa näyttöä siitä, että autofagosytoosin virheellinen toiminta on yksi vanhenemisen tärkeimmistä mekanismeista. Tämän järjestelmän löytäminen on johtanut täysin uuteen biologian tutkimusalaan. Autofagosytoosin virheellisen toiminnan korjaaminen on esimerkiksi pidentänyt koe-eläinten elinikää huomattavasti.

Jo 1930-luvulla havaittiin, että normaalia vähemmän energiaa saaneiden rottien elinikä venyi kolmanneksen pidemmäksi kuin normaalin energiamäärän saaneilla lajitovereilla. Vähemmän energiaa saaneet rotat osoittautuivat uteliaammiksi, oppimiskykyisemmiksi ja aktiivisemmiksi kuin normaalisti tai runsaasti ravintoa saaneet rotat. Syytä ilmiölle ei kuitenkaan osattu selittää.

Autofagosytoosin tunnisti japanilainen Joshinori Osumi vasta 1990-luvulla. Vuonna1996 hänet palkittiin löydöstä Nobelin lääketieteen palkinnolla.

Autofagosytoosi yhdessä muiden selviytymismekanismien, ketogeneesin, glukoneogeneesin ja perusaineenvaihdunnan energiankulutuksen vähentämisen kanssa mahdollistaa ihmisen selviytymisen hengissä pitkään ilman ravintoa. Autofagosytoosissa elimistö ”kannibalisoi” sairastuneita soluja ja jäännösproteiineja” tyydyttääkseen solujen energiatarpeen.

Monet sairaudet, kuten Parkinsonin tauti ja jotkut syövät aiheutuvat autofagosytoosin puutteellisesta toiminnasta. Vaikka solujen oli jo aiemmin tiedetty kierrättävän omaa materiaaliaan, vasta Yoshinori Osumi 1990-luvulla määritteli tarkasti geenit ja metaboliareitit, joiden kautta kierrätys tapahtuu. Osumin työstä lähti kokonaan uusi biologian haara, joka selvittää, miten elimistömme käyttää ”itse-kannibalismia” terveenä pysymiseen.

Mitä autofagiasta (autofagosytoosista) pitäisi tietää?


Columbian yliopiston tohtori Priya Khoronan mukaan autofagosytoosi on kehon tapa puhdistaa vahingoittuneet solut uudempien, terveempien solujen regeneroimiseksi.

”Auto” tarkoittaa itseä ja ”phagy” tarkoittaa syödä. Joten autofagian kirjaimellinen merkitys on ”itse syöminen”.

Vaikka itsensä kannibalisoiminen voi kuulostaa pelottavalta, autofagosytoosi on todella hyödyllistä yleiselle terveydelle. Tämä johtuu siitä, että autofagia on evoluution kehittämä suojamekanismi, jonka avulla keho voi poistaa sairastuneet solut ja kierrättää niiden osat kohti solujen korjaamista ja puhdistamista, kertoo kardiologin tohtori Luiza Petre.

Petre kertoo, että autofagian tarkoitus on kierrättää roskat ja säädellä solujen toiminta optimaaliseksi. ”Se on kierrätystä ja puhdistusta samaan aikaan. Lisäksi se siivoaa erilaisia soluihimme kertyneitä stressitekijöijöitä ja toksiineita”.

Autofagosytoosin terveysvaikutukset


Autofagosytoosin tärkein etu näyttää olevan
anti-aging, eli solujen ikääntymisen hidastaminen. Petre kertoo, että tämä mekanismi tunnetaan parhaiten kehon tapana kääntää kelloa ikään kuin taaksepäin rakentamalla nuorempia ja terveempiä soluja.

Khorana huomauttaa, että kun solumme ovat stressaantuneita, autofagia tehostuu, mikä suojelee soluja ja auttaa pidentämään elinikää. Rekisteröity ravitsemusterapeutti, Scott Keatley, RD, CDN, kertoo, että nälässä ja paastotilassa autofagia pitää kehon toiminnassa hajottamalla solumateriaalia ja kierrättämällä sitä solujen uusiutumiseen ja energiantarpeen tyydyttämiseen.

Solutasolla autofagian (autofagosytoosin) etuja ovat erityisesti:

  • myrkyllisten proteiinien poistaminen soluista (tällaiset myrkyllisten proteiinien kasaumat keskushermoston soluissa aiheuttavat neurodegeneratiivisia sairauksia, kuten Parkinsonin ja Alzheimerin tautia).
  • jäännösproteiinien kierrätys
  • energiaa ja rakennuspalikoita soluille
  • vanhojen ja sairaiden solujen uusiminen ja korvaaminen terveillä soluilla

Autofagia on viime aikoina saanut paljon huomiota erityisesti siksi, että virheellisesti toimiva autofagosytoosi näyttelee keskeistä osaa pahanlaatuisten syöpäkasvainten kehittymisessä. Autofagosytoosin korjaaminen voi osoittautua syövän ehkäisyssä ja hoidossa merkittäväksi terapiavaihtoehdoksi.

Autofagosytoosi heikkenee ikääntymisen seurauksena. Soluihin kerääntyy enemmän kuona-ainetta, jota solut eivät pysty siivoamaan, mikä johtaa sairastuneisiin ja puutteellisesti toimiviin soluihin. Toimimattomat ja vahingolliset solut pääsevät rauhassa lisääntymään, mikä on syöpäsolujen modus operandi (MO)”.

Kaikki syövät alkavat jonkinlaisista viallisista soluista. Kehon tulisi tunnistaa ja poistaa nämä viallisesti toimivat solut käyttämällä autofagisia prosesseja. Tällä hetkellä tutkitaan, voiko autofagosytoosi vähentää syöpäriskiä tai jopa auttaa ehkäisemään syövän leviämistä.

Vaikka tästä ei ole vielä riittävästi tieteellistä näyttöä, Jotkut tutkimukset viittaavat siihen, että monet syöpäsolut voidaan poistaa autofagosytoosissa. Virheellisesti toimivien solujen tunnistaminen ja tuhoaminen sekä korjausmekanismin käynnistäminen auttavat vähentämään syöpäriskiä. Tutkijat uskovat, että uudet tutkimukset johtavat terapiaan, joka auttaa lääkäreitä kohdentamaan autofagosytoosia syöpähoitona.

Tutkimuksissa autofagosytoosi on yhdistetty moniin terveysvaikutuksiin. Autofagosytoosi tunnetaan kuitenkin vielä sen verran huonosti, että liian pitkälle meneviä johtopäätöksiä ei kannata tehdä. Autofagosytoosin soluprosessit ovat monimutkaisia ja vaikeasti havainnoitavia.

Vuonna 2019 tehdyssä tutkimuksessa seurattiin autofagosytoosin vaikutuksia syöpäsoluihin. Tutkimus osoitti, että vaikka autofagosytoosi voi estää syöpäsolujen kehittymisen, se voi myös edistää niiden kasvua kasvaimen vaiheesta riippuen.

Tutkijoita kiinnostaa myös autofagian ja maksan terveyden yhteys. Tänä vuonna ilmestyneessä tutkimuskatsauksessa tutkittiin tapoja, joilla autofagosytoosi voi auttaa suojaamaan maksasoluja lääkkeiden ja alkoholin aiheuttamilta maksavaurioilta.

Muissa tutkimuksissa on havaittu, että autofagosytoosi vaikuttaa monissa maksan toiminnoissa. Se voi estää useiden maksasairauksien, kuten Wilsonin taudin, akuutin maksavaurion, alkoholista riippumattoman rasvamaksan ja kroonisen alkoholiin liittyvän maksasairauden etenemisen.

Suurin osa autofagiaa koskevista tutkimuksista on kuitenkin tehty laboratorioissa in vitro (kirjaimellisesti ”lasissa”; in vitro on tutkimustekniikka, jossa koe suoritetaan koeputkessa, lasimaljassa tai yleisesti eliön tai solun ulkopuolella) tai eläinkokeissa.

Autofagosytoosilla näyttää olevan keskeinen rooli immuunijärjestelmän toiminnassa. Autofagosytoosi puhdistaa soluista toksiineja ja tartuntatauteja. On todisteita siitä, että autofagosytoosi voi parantaa infektio- ja neurodegeneratiivisia sairauksia sairastavien solujen terveyttä kontrolloimalla tulehdusta.

Toinen tutkimuskatsaus havaitsi, että autofagosytoosi auttaa suojaamaan soluja soluun tunkeutuvilta mikrobeilta. Vaikka autofagosytoosin vaikutusta soluihin on tutkittu paljon, tutkijat eivät ole vielä varmoja siitä, voisiko autofagosytoosi toimia hoitona erilaisille sairauksille. Eläinmalleista saadun näytön perusteella ketoosin indusoima autofagosytoosi yhdessä sädehoidon kanssa poisti täysin hiiren syöpäkasvaimen. On kuitenkin liian varhaista sanoa, toimiiko sama ihmisillä.

Ruokavalion muutokset, jotka voivat tehostaa autofagosytoosia

Autofagosytoosi tarkoittaa kirjaimellisesti ”itsensä syömistä”. Tämän kannibalistisen prosessin voi käynnistää helposti pätkäpaastolla, paastolla ja ketogeenisellä ruokavaliolla.

”Paasto on tehokkain tapa autofagosytoosin käynnistämiseksi.”, Petre kertoo. ”Ketogeeninen, eli runsasrasvainen ja vähän hiilihydraatteja sisältävä ruokavalio tuottaa samat edut kuin paasto ilman ravinnon välttelyä, koska ketoosi imitoi paastoa aineenvaihdunnan tasolla.

Kun kehoa ei rasiteta ulkoisella kuormituksella kellon ympäri, keholle jää aikaa korjata viallisia soluja. Esimerkiksi jatkuvan syömisen aiheuttama glukoosi-insuliini-glukagoni-glukoosi-insuliini-glukagoni-kierre pitää elimistön ylikierroksilla lähes ympäri vuorokauden.

Korkea verensokeri ja hyperinsulinemia vaurioittavat verisuonia ja elimiä. Vähitellen hyperglykemia ja hyperinsulinemia johtavat solujen insuliiniherkkyyden heikentymiseen, eli insuliiniresistenssiin, joka on käytännössä kaikkien elintapasairauksien yhteinen nimittäjä.

Insuliiniresistentit solut eivät saa riittävästi energiaa veren korkeasta glukoosipitoisuudesta huolimatta, joten solut alkavat surkastua ja kuolla. Kun luurankolihasten ja elinten solut eivät ota glukoosia riittävästi vastaan, glukoosi ohjataan rasvasoluihin, jossa se muutetaan triglyserideiksi, eli läskiksi. Osa glukoosista voi glykatoitua proteiinien ja rasvahappojen kanssa, jolloin verisuoniin muodostuu siirappimaisia glykaation lopputuotteita (AGE), jotka edelleen kasvattavat sairastumisen riskiä.

Hyperglykemia, hyperinsulinemia, viallisesti toimiva autofagosytoosi ja glykaatio kietoutuvat vahvasti toisiinsa erityisesti glukoosin välityksellä. Korkea verensokeri on yhteinen nimittäjä, joka luo metabolisesti suotuisan ympäristön monille elintapasairauksille sydän- ja verisuonitaudeista syöpiin. Korkea verensokeri ylläpitää korkeaa insuliinitasoa, estää autofagosytoosia ja altistaa glykaatiolle. Hyperinsulinemia altistaa insuliiniresistenssille ja estää laihtumista. Autofagosytoosin estyminen altistaa tulehduksille ja pahanlaatuisille kasvaimille. Kaikki nämä yhdessä ovat sydän- ja verisuonitautien riskitekijöitä. Jos autofagosytoosi ei toimi, elimistöön kerääntyy haitallista solujätettä, joka pitäisi siivota ja/tai korjata.

Keto-ruokavaliossa noin 70-75 prosenttia päivittäisistä energiasta saadaan rasvasta, 15-20 % proteiineista ja vain 5-10 prosenttia kaloreista hiilihydraateista. Tämä muutos kalorilähteissä saa elimistön muuttamaan aineenvaihduntareittiään. Solut alkavat käyttää rasvaa polttoaineena hiilihydraateista saatavan glukoosin sijaan.

Glukoosin rajoittamisen seurauksena verenkiertoon vapautuu lipolyyttisiä hormoneja (glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia), jotka käynnisävät rasvasolujen lipolyysin.

Lipolyysissä rasvasoluihin varastoituja triglyseridejä pilkotaan vapaiksi rasvahapoiksi ja glyseroliksi. Vapaat rasvahapot kulkeutuvat maksaan, jossa niistä tuotetaan ketogeneesissä ketoaineita (asetonia, asetoasetaattia ja betahydroksibutyraattia). Glyserolia käytetään glukoneogeneesissä. Sydänlihaksen solut voivat hapettaa vapaita rasvahappoja energiaksi betaoksidaatiossa. Ketoaineet laskevat vapaiden happi- ja typpiradikaalien (ROS ja RNS) määrää, mikä vähentää oksidatiivista stressiä ja inflammaatiota. Ketoaineilla on myös syto- ja neuroprotektiivisia ominaisuuksia.

Tutkimukset viittaavat Khoranan mukaan siihen, että ketoosi voi myös tuottaa nälän indusoimana autofagosytoosin, jolla on neuroprotektiivisia vaikutuksia. Alhainen glukoosipitoisuus toteutuu ketogeenisellä ruokavaliolla ja paastolla. Ruokavalioita yhdistää matalat insuliinitasot ja korkeat glukagonitasot. Tämä metabolinen ympäristö on autofagosytoosin avaintekijä.

Glukagonitaso on se tekijä, joka laukaisee autofagosytoosin. Niin kuin tiedämme, insuliini on anabolinen hormoni ja sen vastavaikuttajana glukagoni on katabolinen hormoni. Tämä tarkoittaa, että insuliinia tarvitaan uusien rakenteiden muodostamiseen yhtä hyvin proteiinisynteesissä kuin rasvasynteesissä (lipogeneesissä). Sen sijaan katabolisissa aineenvaihduntatapahtumissa olemassaolevia rakenteita glykogeeneistä adiposyytteihin (rasvasoluihin) puretaan energiakäyttöön. Katabolisia aineenvaihduntatapahtumia ovat esimerkiksi: glykogenolyysi, lipolyysi ja autofagosytoosi.

Kun elimistössä on vähän sokeria paaston tai ketoosin seurauksena, elimistössä kehittyy positiivinen stressi, jonka vasteena on korjaustilan käynnistyminen. Myös intensiivinen ja raskas liikunta käynnistää autofagosytoosin. Erään eläintutkimuksen mukaan fyysinen harjoittelu voi indusoida autofagosytoosia elimissä, jotka osallistuvat aineenvaihdunnan säätelyprosesseihin. Näihin voivat kuulua luurankolihakset, maksa, haima ja rasvakudos.

https://www.healthline.com/health/autophagy

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2990190/

https://www.medicalnewstoday.com/articles/autophagy

http://genesdev.cshlp.org/content/21/22/2861.full.html

https://www.hindawi.com/journals/isrn/2012/927064/

https://en.wikipedia.org/wiki/Autophagy

https://fi.wikipedia.org/wiki/Autofagosytoosi

https://oppimis-ja-muistitekniikat.fi/elimiston-puhdistusjarjestelma/

https://en.wikipedia.org/wiki/Phagosome

https://en.wikipedia.org/wiki/Autophagosome




Ketogeeninen ruokavalio & PPMS

Aivan viime aikoihin asti multippeliskleroosia on pidetty ensisijaisesti tulehduksellisena autoimmuunitautina. Lähes täysin huomiotta on jäänyt tautiin liittyvä neurodegeneratiivinen komponentti, joka vaikuttaa sairauden etenemiseen ja invaliditeettiin.

Löysin hyvin kiinnostavan tutkielman vuodelta 2015. Mithu Storonin ja Gordon T. Plantin kirjoittama The Therapeutic Potential of the Ketogenic Diet in Treating Progressive Multiple Sclerosis selvittää ketogeenisen ruokavalion terapeuttista vaikutusta ensisijaisesti etenevää multippeliskleroosia sairastavilla.

Perinteistä kuvaa MS-taudista haastavat kliiniset havainnot tulehduksen ja neurodegeneraation välisestä dissosiaatiosta, jossa neurodegeneratiivisella komponentilla saattaa olla tulehduksellisia tekijöitä merkittävämpi rooli taudin patogeneesissä.

Tässä katsauksessa tutkitaan mitokondrioiden toimintahäiriöiden ja hermoston rappeutumisen suhdetta multippeliskleroosissa. Tarkastelemme todisteita siitä, että ketogeeninen ruokavalio voi korjata mitokondrioiden toimintaa, ja pohdimme ketogeenisen ruokavalion terapeuttista potentiaalia etenevän multippeliskleroosin hoidossa.

Kaikkiin potentiaalisiin terapeuttisiin vaihtoehtoihin tutustuminen on perusteltua, koska etenevään MS-tautiin ei tällä hetkellä tunneta parantavaa tai edes taudin etenemistä hidastavaa hoitoa.

1. Survival of the sickest? Multippelisklerootikko ketoosissa


Näyttö ketogeenisen ruokavalion neurologisista hyödyistä kasvaa nopeasti. Lääkeresistenttiä epilepsiaa on hoidettu ketogeenisellä ruokavaliolla jo vuosisadan ajan. Tutkimuksissa ketogeenisen ruokavalion terapeuttisista hyödyistä Parkinsonin taudin ja Alzheimerin taudin hoidossa on saatu erittäin lupaavia tuloksia.

Löysin hiljattain useita tutkimuksia, jotka tukevat ketogeenisen ruokavalion terapeuttisia hyötyjä multippeliskleroosia sairastavilla. Tämä on uusi pohjaton kaninkolo, johon aion kompastua. Ehkäpä meidän kaikkein sairaimpienkin horisontissa voi nähdä sateenkaaren ja lupauksen paremmasta? Minä en lupaa mitään, mutta katsotaan millainen maailma peilin takana odottaa.

Jean-Martin Charcotin huolellinen kliininen ja patologinen kuvaus potilaasta, jolla oli demyelinoivia leesioita tai “sclérose en plques” vuonna 1868, antoi maailmalle ensimmäisen selkeän kuvauksen multippeliskleroosista (MS).

Puolitoista vuosisataa Charcotin havaintojen jälkeen, taudin patogeneesi on yhä suurelta osin mysteeri. Primaaristi progressivisen, eli ensisijaisesti etenevän multippeliskleroosin hoito ei ole oireenmukaisia hoitoja paitsi edistynyt käytännössä lainkaan.

Arviolta 85 prosentilla MS-potilaista esiintyy toistuvia yksittäisten neurologisten oireyhtymien jaksoja, jotka yleensä häviävät konservatiivisella hoidolla täysin tai lähes täysin. Tätä tautimuotoa kutsutaan relapsoivaksi remittoivaksi tai aaltoillen eteneväksi MS-taudiksi (RRMS).

Noin 15 prosentilla potilaista on asteittainen ja progressiivinen neurologisen toiminnan menetys, joka ei parane. Tätä tautimuotoa kutsutaan primaaristi progressiiviseksi MS-taudiksi (PPMS). Vaikka tautimuodoissa on yhtäläisyyksiä, ne eroavat toisistaan kuin yö ja päivä.

Vaikuttaa siltä, että RRMS on tulehduksellinen autoimmuunitauti ja PPMS neurodegeneratiivinen hermosoluja tuhoava sairaus. Minä olen invalidisoitunut tämän ilman pahenemis- ja paranemisvaiheita etenevän etenevän ms-taudin luomassa kuplassa vuodesta 2008.

Potilaista, joilla on RRMS, suurimmalle osalle kehittyy progressiivisia neurologisia oireita 1-3 vuosikymmentä ms-diagnoosin jälkeen. Tätä tautimuotoa nimitetään toissijaisesti eteneväksi MS-taudiksi (SPMS). Se muistuttaa ensisijaisesti etenevää MS-tautia.

Multippeliskleroosia on perinteisesti pidetty immuunivälitteisenä tulehdussairautena. Immuunivasteen uskotaan aiheuttavan spontaanisti remisoituvia relapseja RRMS:ssä.

Perinteisen näkemyksen mukaan immuunisolut kulkeutuvat vaurioituneen veri-aivoesteen läpi ja aiheuttavat RRMS:lle tyypillisen fokaalisen ja levinneen tulehduksen. Perinteinen näkemys multippeliskleroosista tulehdussairautena on johtanut siihen, että lähes kaikissa terapeuttisissa strategioissa käytetään immunomoduloivaa tai immunosuppressiivista lähestymistapaa. Lähestymistapa toimii aaltoilevaa ms-tautia sairastavilla, mutta siitä ei ole mitään apua etenevää ms-tautia sairastavien hoidossa.

Näkemys multippeliskleroosista tulehduksellisena sairautena on riittämätön, koska fokaalinen tulehdus voi puuttua etenevää tautimuotoa sairastavilta. Neurodegeneraatiolla voi olla keskeisempi rooli etenevän MS-taudin patogeneesissä.

Tulehduksen ja taudin etenemisen välisen dissosiaation todisteiden lisääntyminen ellyttää tarkistettua näkökulmaa neurodegeneraation roolista multippeliskleroosin patogeneesiin ja siten terapeuttisisten strategioiden uudelleenarviointia.

Tässä katsauksessa tutkimme todisteita hermoston rappeutumisesta ja muuttujista etenevän ms-taudin patogeneesissä. Samalla arvioidaan ketogeenisen ruokavalion toimivuutta etenevän multippeliskleroosin hoitomuotona.

Minä aloitin ketogeenisen ruokavalion joulukuun toisena päivänä torjuakseni alkavan diabeteksen. Huomasin pian oloni energisemmäksi ja aktiivisemmaksi. Söin vähemmän, mutta jaksoin enemmän. Painoni putosi muutamassa kuukaudessa 10 kg. Verensokeri laski esidiabeettiselta tasolta optimaaliselle tasolle. Aiemmin korkea verenpaineeni on nyt melko hyvä. Kaiken kaikkiaan minulle tämä ruokavalio on tehnyt hyvää.

2. Onko MS ensisijaisesti neurodegeneratiivinen sairaus?


Perinteinen MS-malli perustuu ”
ulkopuolelta-sisään” -tulkintaan. Tässä mallissa virheellisesti toimiva immuunijärjestelmä hyökkää keskushermostoa vastaan. Oletus on, että jokin tai jotkin ulkoiset tekijät laukaisevat tulehduksen, joka johtaa autoimmuunireaktioon ja taudille ominaisiin vaurioihin keskushermostossa.

Perifeeriset immuunisolut läpäisevät vaurioituneen veri-aivoesteen päästäkseen keskushermostoon, jossa ne aiheuttavat akuutteja multifokaalisia tulehduksellisia vaurioita Vauriot ovat joskus oireettomia, mutta yleensä ne liittyvät pahenemisvaiheeseen eli relapsiin aaltoilevasti etenevässä RRMS:sä. Pahenemisvaiheisiin liittyy erilaisia neurologisia oireita.

RRMS on yleisin multippeliskleroosin muoto, mutta suurimmalle osalle aaltoilevasti etenevää tautimuotoa sairastavista potilaista kehittyy multippeliskleroosin toissijaisesti progressiivinen muoto (SPMS) kolmen vuosikymmenen sisällä taudin puhkeamisen jälkeen.

Tulehduksellisten ja neurodegeneratiivisten komponenttien kaksinaisuuden tekee kiinnostavaksi havainto, että MS ”etenee” molemmissa tautimuodoissa osittain yhteneväisellä tavalla riippumatta siitä, sairastuiko potilas aluksi aaltolevasti etenevään tautimuotoon vai ensisijaisesti etenevään tautiin. Patofysiologisesti näiden kahden taudifenotyypin välillä ei löydy eroa.

2.1. Vaihtoehtoinen MS-malli


Todisteet taudin etenemisen ja tulehduksen erillisestä dissosiaatiosta ovat haastaneet perinteisen lähestymistavan. Eteneminen ilman autoimmuunikohtauksia on osoitus erillisestä ja/tai rinnakkaisesta patogeenisestä prosessista.

Jotkut tutkijat ovat ehdottaneet multippeliskleroosiin ”sisältä-ulospäin” -mallia, jossa primaarinen solujen rappeuma on käynnistävä tekijä, joka sitten laukaisee tulehduksen. Rappeuma vapauttaa antigeenisen soluaineen, joka sitten johtaa immuunivasteeseen.

2.2. Tulehduksen pysäyttäminen ei pysäytä taudin etenemistä


Vaikka toistaiseksi ei ole pitävää näyttöä siitä, että solujen rappeuma olisi tulehduksen laukaiseva ensimmäinen tapahtuma (ikivanha muna- vai kana-kysymys), kliiniset havainnot tukevat näiden kahden välistä dissosiaatiota, jossa rappeuma ei seuraa tulehdusta, vaan voi tapahtua tulehduksesta riippumatta.

Tulehduksiin vaikuttavalla immuunimoduloivalla hoidolla ei ole juurikaan merkitystä multippeliskleroosin etenemiseen hyvin pitkällä aikavälillä, vaikka aaltoilevasti etenevän tautimuodon pahenemisvaiheiden hoitona immuunimoduloiva lääkitys toimiikin hyvin.

Autologinen hematopoieettinen kantasolusiirtoihin perustuva hoito on erittäin tehokas tulehduksen vähentämisessä, mutta sekään ei pysäytä aksonien rappeutumista ja aivojen atrofiaa. MS-taudissa tapahtuu progressiivista hermoston rappeutumista ja aksonien atrofiaa tulehduksellisista tekijöistä riippumatta.

Atrofiatarkoittaa solun koon pienenemistä sen rakenneosien vähenemisen seurauksena. Atrofioituvassa solussa rakenneproteiinien hajotus on nopeampaa kuin niiden synteesi. Elimen tasolla atrofialla voidaan tarkoittaa myös kudoksen tai elimen surkastumista, joka saattaa johtua solujen pienenemisen ohella niiden määrän vähenemisestä. Atrofian vastakohta on hypertrofia.

Atrofian taustalla on solujen pyrkimys sopeutua muuttuneisiin ympäristöolosuhteisiin ja säilyä hengissä. Elimen atrofiaa voi aiheuttaa myös vanhenemiseen liittyvä lisääntynyt apoptoosi, eli ohjattu solukuolema.

Atrofian mahdollisia aiheuttajia ovat solun vähentynyt aktiivisuus, hermotuksen heikentyminen, verenkierron tai ravintoaineiden riittämättömyys, hormonitoiminnan muutos ja lisääntynyt paine kudoksessa.

2.3. Harding-oireyhtymä


Teorian tueksi on olemassa patologista näyttöä, joka osoittaa että neurodegeneraatio voi tapahtua ilman mitään edeltävään tulehdukseen viittaavia todisteita. Myeliinivaipan sisäkerroksista on tunnistettu pistemäisiä vaurioita, vaikka myeliinivaipan ulkokerrokset ovat ehjät.

Tämä haastaa T-soluvälitteisen ulkoisen mekanismin mahdollisuuden. Harding-oireyhtymässä on todisteita siitä, että neurodegeneraatio edeltää tulehdusreaktiota. Vastaava perinnöllinen mitokondrioiden toimintahäiriö voi aiheuttaa MS-taudissa havaitun atrofian ja neurodegeneraation.

Harding-oireyhtymässä solujen rappeuma, joka ilmenee mitokondrioiden viallisen toiminnan seurauksena, voi laukaista autoimmuunivasteen ihmisillä, joilla on immunologinen ja geneettinen alttius ko. Oireyhtymälle.

Vaikka Leberin perinnöllinen optinen neuropatia (LHON) on tavallisempi miehillä, naisilla on suurempi riski saada autoimmuunisairaus, ja tämä voi selittää, miksi naisilla esiintyy enemmän Harding-oireyhtymää multippeliskleroosin kaltaisen tulehduksen kanssa, vaikka kyseessä on sama mutaatio kuin LHON.

Leberin perinnöllinen optinen neuropatia (LHON) on mitokondriaalisesti perinnöllinen häiriö, jolle on ominaista kivuton näköhäiriö, joka voi johtaa vakavaan optisen atrofiaan. Se voi liittyä muihin sairauksiin, kuten multippeliskleroosiin (MS).

LHON:n liittymistä MS:n kaltaiseen sairauteen kutsutaan usein Hardingin taudiksi (tai Hardingin oireyhtymäksi).

3. Mitokondrioiden rooli multippeliskleroosissa


Kliininen näyttö, jonka mukaan MS-tudin neurologisiin vaurioihin vaikuttaa sekä neurodegeneraatio että inflammaatio kasvaa koko ajan riippumatta siitä, laukaiseeko neurodegeneraatio tulehduksen vai tulehdus neurodegeneraation. Sekin on mahdollista, että kyse on rinnakkaisista tautitapahtumista.

Mitokondrioiden toimintahäiriöillä uskotaan kuitenkin olevan keskeinen rooli neurodegeneratiivisessa tapahtumissa. Kasvava näyttö osoittaa, että mitokondrioiden toimintahäiriöillä voi olla myös huomattava merkitys MS-taudin patogeneesissä.

3.1. Mitokondrioiden virheellinen toiminta voi selittää aksonien kohtalon


Aksoni, eli viejähaarake (hermosyy) on hermosolun eli neuronin osa, joita on vain yksi neuronia kohti, kun taas tuojahaarakkeita eli dendriittejä on useita yhdessä neuronissa.

Aksoni haarautuu loppupäästään ja muodostaa näin useita hermopäätteitä, jotka puolestaan voivat muodostaa synapsin toisen hermosolun tai lihassolun kanssa. Aksoni voi olla joko myelinisoitunut tai myelinisoitumaton. Myelinisoituneessa aksonissa hermoimpulssi kulkee nopeammin kuin myelinisoitumattomassa, koska hermoimpulssi hyppii myeliiniin muodostuneiden Ranvierien kuroumien välillä. – Wikipedia

Aksonaalinen rappeutuminen on multippeliskleroosille tunnusomainen piirre ja sitä esiintyy jopa ilman paikallista demyelinaatiota. Eläinmallit viittaavat siihen, että mitokondrioiden vaurio voi olla aksonin rappeutumista edeltävä tautitapahtuma.

Reaktiivisten happiradikaalien (ROS) muodostuminen voi myötävaikuttaa aksonien mitokondriovaurioihin. Reaktiivisten happiradikaalien detoksifikaatio voi puolestaan pysäyttää aksonin rappeutumisen.

Rappeutuvien aksonien katsotaan sisältävän toimintahäiriöisiä mitokondrioita, kun taas demyelinaatiosta selviytyvät aksonit sisältävät toimivia mitokondrioita. Nämä havainnot vastaavat äskettäistä tutkimusta glaukomatoottisesta optisesta neuropatiasta, jossa havaittiin, että terveet mitokondriot voivat tarjota suojaa hermoston rappeutumiselta huolimatta korkean silmänsisäisen paineen läsnäolosta.

Demyelinaatiota seuraava aksonien rappeutuinen aiheutuu nykykäsityksen mukaan mitokondrioiden tuottaman energian vähyydestä. Mitokondrioiden toiminta näyttää säätelevän aksonien kohtaloa.

Demyelinaatio: Myeliinikato on MS-taudille tyypillinen myeliinivaurio (myeliini on nopeasti johtavia hermosyitä ympäröivän, eristävän hermotupen rasva-aine).


3.2. Mitokondrioiden toimintahäiriö havaitaan harmaassa aineessa


Harmaan aineen atrofia on multippeliskleroosille tunnusomainen kliininen havainto. Atrofia lisääntyy, kun RRMS-tautimuoto etenee SPMS-tautimuodoksi. Immunohistokemiallisilla värjäystekniikoilla ja mikroskopialla on osoitetettu, että hermosolujen atrofia lisääntyy demyelinaatiosta riippumatta myös aivojen alueilla, joilla on ”
terveeltä äyttävää harmaata ainetta”.

MS-taudissa aivokuoren neuronien mitokondrioiden toiminnan on osoitettu vahingoittuneen. Campbell et al. (2011) käytti kompleksista IV / kompleksi II histokemiaa, immunohistokemiaa, laserdisektiomikroskopiaa sekä PCR- ja DNA-sekvensointimenetelmiä osoittamaan silmiinpistävän kompleksien II ja IV aktiivisuuden vähenemisen oksidatiivisen fosforylaatioketjun aikana neuroneissa, jotka saatiin SPMS-tapausten ruumiinavauksista.

3.3. Progressiivinen mitokondrioiden vahingoittuminen voi korreloida relapsien vähentyneen toipumisen kanssa


Transkriptiokofaktorin PGC-1a tasoja, joilla on keskeinen rooli mitokondrioiden toimintaan liittyvien tumatranskriptiotekijöiden aktivaatiossa, voidaan vähentää aivokuoren neuroneissa progressiivisessa MS-taudissa.

Transkriptiokofaktori PGC-1a.n ilmentymisen havaittiin korreloivan hermosolujen tiheyden kanssa. Kun otetaan huomioon havainto, että aivojen atrofian nopeus kasvaa, kun RRMS etenee SPMS-tautimuodoksi, PGC-1a: n lasku voi viitata mitokondrioiden toiminnan samanaikaiseen heikkenemisseen.

Taudin tässä etenemisvaiheessa toipuminen relapseista muuttuu asteittain huonommaksi. Mitokondrioiden toiminnan asteittainen heikkeneminen ja siitä johtuva ATP-saatavuuden heikkeneminen voi aiheuttaa aksonin sietokyvyn heikkenemisen, mikä tekee jokaisesta relapsista toipumisesta yhä vaikeampaa.

PGC-1a-tasojen laskua on havaittu myös muissa neurodegeneratiivisissa taudeissa, kuten Alzheimerin taudissa

Mitokondriot ja neurodegeneraatio


Tutkijapiireissä pidetään todennäköisenä mallia, jossa mitokondrioiden toimintahäiriöt ovat keskeisiä neurodegeneraatiivisten tapahtumien patogeneesissä. Tässä mallissa mitokondrioiden toimintahäiriöt edeltävät synaptista toimintahäiriötä, atrofiaa ja hermosolujen tuhoa.

Multippeliskleroosin eläinmallissa (enkefalomyeliitissä, EAE), mitokondriovaurion on osoitettu edeltävän tulehdusta ja laukaisevan neurodegeneraation. Vaikka mitokondrioiden vaurioihin johtavat tarkat molekyylireitit ovat edelleen tuntemattomia, oksidatiiviset vauriot ovat yksi mahdollinen reitti.

Varhaiset tutkimukset antioksidanttihoidoista MS-eläinmalleissa ovat antaneet lupaavia tuloksia. Superoksididismutaasi 2:n on osoitettu korjaavan aksonihäviön EAE: hen liittyvässä näköhermotulehduksessa.

Superoksididismutaasi eli SOD on entsyymi, joka katalysoi superoksidi-ionien disproportioitumista vetyperoksidiksi ja hapeksi. Superoksididismutaasi on tärkeä antioksidantti useissa soluissa.

Synteettisen antioksidantin, Mito-Q:n, on osoitettu olevan neuroprotektiivinen ja hidastavan taudin etenemistä EAE:ssa, vaikka sillä ei ole vaikutusta tulehdustapahtumaan. Tämä vahvistaa edelleen dissosiaatiota kahden erillisen tautiprosessin välillä ja osoittaa, että neurodegeneraation hillitsemistä tulisi harkita mahdollisena terapian kohteena etenevässä multippeliskleroosissa.

Tähän mennessä eräs harvoista etenevän MS-taudin hoitoon käytettävissä olevista vaihtoehdoista, joilla saattaa olla myönteisiä terapeuttisia vaikutuksia, on dimetyylifumaraatti tai DMF.

DMF on ainoa nykyinen lääke, joka immunomoduloivan vaikutuksen lisäksi on toimii voimakkaana antioksidanttina. Sen uskotaan vähentävän oksidatiivista stressiä NRF-2-reitin kautta, ja sillä on siten neuroprotektiivinen vaikutus. Tämä neuroprotektiivinen vaikutus on ollut ilmeinen myös muissa neurodegeneratiivisissa taudeissa.

5. Mitokondriot progressiivisen MS-taudin terapeuttisena kohteena


Mitokondrioiden toimintahäiriöiden rooli neurodegeneraatiossa viittaa siihen, että terapian kohdistaminen mitokondrioiden toimintaan voi olla hyödyllinen terapeuttinen strategia etenevän MS-taudin hoidossa.

Mitokondrioiden toimintaan kohdistuvien lääkkeiden toimivuudesta MS-taudin hoitona on vähän tutkimustietoa, mutta niiden tulokset ovat olleet lupaavia.

Koentsyymi Q10:llä on antioksidanttisia ominaisuuksia ja se on osa elektronin siirtoketjua, joka on vuorovaikutuksessa kompleksin I kanssa.

12 viikon satunnaistettu lumekontrolloitu kaksoissokkoutettu koentsyymi Q10 -lisäravinnetutkimus potilailla, joilla oli relapsoiva remittoiva MS (RRMS), osoitti IL-6:n ja MMP-9:n vähenemistä. Saman ryhmän toisen samanlaisen tutkimuksen tulokset osoittivat Q10-lisäravinteen vähentävän MS-potilaiden masennusta ja väsymystä.

Mito-Q on ubikinonia sisältävä antioksidantti, jonka on osoitettu hidastavan taudin etenemistä ja vähentävän hermosolujen tuhoa multippeliskleroosin hiirimallissa; toisaalta yhdessä tutkimuksessa, jossa käytettiin koentsyymi Q10:n synteettistä analogia, taudin eteneminen ei hidastunut.

Glukoosin hypometabolia


Jotkut tutkimukset ovat viitanneet siihen, että hermosolujen aineenvaihdunnassa voi tapahtua solujen glukoosinoton vähenemiseen vaikuttava bioenerginen muutos ennen neurodegeneraation kliinisten oireiden ilmaantumista.

Tämä glukoosin hypometabolia voi heijastua mitokondrioiden toiminnan heikkenemisenä. Muutoksen on havaittu tapahtuvan kauan ennen neurodegeneraation kliinisten oireiden ilmaantumista, mikä viittaa mahdollisuuteen, että glukoosin hypometabolia voi olla alkuvaihe, joka johtaa aksonin atrofiaan ja hermosolujen menetykseen vähentämällä ATP:n saatavuutta. Bioenerginen muutos näyttää vaikuttavan erityisesti glukoosin metaboliaan. Tällaista muutosta ei havaita ketoosiin perustuvassa aineenvaihdunnassa.

6.1. Glukoosin hypometabolia MS: ssä


Progressiivisen MS-taudin taustalla oleva neurodegeneratiivinen prosessi voi myös johtaa glukoosin hypometaboliaan. Tämä viittaa potentiaaliseen terapeuttiseen etuun energian saannin tehostamisessa vaihtoehtoisella reitillä, kuten ketoosiin perustuvalla metabolialla.

Tutkimus, jossa verrattiin 47 MS-potilasta, joilla oli vaihteleva vireystaso ja 16 tervettä kontrollia, osoitti, että potilailla oli kontrolleihin verrattuna heikentynyt aivojen glukoosimetabolia useilla aivojen eri alueilla, mukaan lukien prefrontaaliset-, premotoriset- ja täydentävät motoriset alueet sekä tyvitumake.

Vireysasteen ja glukoosin metabolisen nopeuden välillä oli käänteinen korrelaatio. Toinen tutkimus, johon osallistui 8 MS-potilasta ja 8 potilaita vastaavaa tervettä vertailuhenkilöä, osoitti MS-potilaiden hermosolujen glukoosinoton heikentyneen 40% terveisiin verrokkiin verrattuna.

Ekstramitokondrioiden metabolia lisääntyy, kun glukoosin mitokondrioiden metabolia on heikentynyt. Pilottitutkimuksessa, jossa verrattiin 85 potilasta, joilla oli relapsoiva remittoiva MS, 54 potilasta, joilla oli sekundaarisesti progressiivinen MS ja 18 tervettä kontrollia, ekstramitokondrioiden glukoosimetabolia osoitti korrelaation taudin etenemisen kanssa, mikä viittaa siihen, että heikentyneellä glukoosin mitokondrioiden metabolialla voi olla merkittävä rooli progressiivisessa MS-taudin etenemisessä.

Vastaavia tuloksia on saatu myös muiden neurodegeneratiivisten tautien, kuten dementian, Alzheimerin taudin ja Parkinsonin taudin tutkimuksissa.

Muita merkittäviä molekyylitodisteita heikentyneestä glukoosimetaboliasta MS-taudissa, nähdään glukoosin (GLUT) ja monokarboksylaattikuljettajien (MCT) muuttuneessa jakautumisessa. MS-tautiin liittyvien kroonisten leesioiden sisällä aksonaalisen GLUT3- ja MCT2-kuljetusmolekyylien määrä on selvästi vähentynyt.

Nämä biokemialliset muutokset hermoston metaboliassa voivat selittää glukoosinoton heikkenemistä demyelinoiduissa aksoneissa. Hermosolut näyttävät muuttuvan eräällä tavalla ”glukoosiresistenteiksi”, koska solujen glukoosinoton tarvitsemien kuljetusmolekyylien määrä romahtaa. Solujen heikentynyt glukoosinotto heijastuu solujen energianpuutteena, hypoglykemiana ja lopulta solujen tuhoutumisena, eli atrofiana.

Jos hermosoluille tarjotaan glukoosin sijaan vaihtoehtoinen polttoaine, hermoston rappeutuminen voi hidastua tai pysähtyä.

Tämä on mielenkiintoinen terapeuttinen mahdollisuus, sillä vielä tämän vuosituhannen alussa oltiin aivan varmoja siitä, että hermosolut tarvitsevat välttämättä glukoosia. Viimeaikaiset tutkimukset ovat osoittaneet, että aivot toimivat jopa tehokkaammin ketoaineilla kuin glukoosilla.

Ketoaineiden vaikutus on osoitettu kliinisesti erilaisilla aivojen kuvantamiseen perustuvilla menetelmillä sekä tutkittavien kognitiivisia kykyjä mittaavilla testeillä. MRI-kuvat ovat osoittaneet, että aivojen aktiivisuus lisääntyy ketoainella. Myös kognitiiviset kyvyt, kuten muisti paranevat ketoaineita saaneilla Parkinsonin ja Alzheimerin tautia sairastavilla potilailla.

Vuonna 1967 Cahill et al. osoitti, että pitkittyneen paaston aikana keho tarjoaa aivoille vaihtoehtoisen polttoainelähteen ketoaineiden muodossa. Keskushermosto ei pysty käyttämään rasvaa suorana energialähteenä. Pitkittyneen hiilihydraattirajoituksen jälkeen rasva muuttuu ketoaineiksi prosessissa, jota kutsutaan ketogeneesiksi.

Ketogeneesi tapahtuu ensisijaisesti maksassa olevien mitokondrioiden matriisissa. Ketogeneesi johtaa ketoaineiden (beetahydroksibutyraatin, asetoasetaatin ja asetonin) tuotantoon. Ne korvaavat glukoosin aivojen tärkeimpinä polttoaineiden lähteinä.

Hans Krebs erotti normaalin ”fysiologisen” ketoosin, jossa ketonipitoisuus ei ylitä 8 mmol / l, ja diabeettisen ketoasidoosin, eli happomyrkytyksen, joka on diabeteksen komplikaatio, jossa ketoaineineiden määrä voi olla yli 20 mmol / kg L ja voi johtaa kuolemaan.

Ketoaineet voivat helposti läpäistä veri-aivoesteen. Aivojen ketoaineiden hyödyntäminen lisääntyy, kun ketoneiden määrä seerumissa nousee 12 mmol / l:n pitoisuuteen. Eläintutkimusten meta-analyysi on osoittanut, että glukoosin aivojen aineenvaihdunnan nopeus laskee 9% jokaisen plasman ketonien 1 mmol / l kasvun jälkeen.

Ketonit ohittavat glykolyyttisen reitin ja siirtyvät suoraan trikarboksyylihapposykliin (TCA) mitokondrioissa, mikä osaltaan edistää anapleroosia.

Anapleroosi on trikarboksyylihapposyklin välituotteiden muodostumisprosessi. Omenahappoentsyymillä (mtME), fosfenopyruvaattikarboksikinaasilla (PEPCK), propionyyli-CoA-karboksylaasilla, pyruvaattikarboksylaasilla ja proliinidehydrogenaasilla on tärkeä rooli anapleroosissa.

Ketogeeninen ruokavalio progressiivisen MS-taudinn neurodegeneraation estäjänä?


Ketogeenistä ruokavaliota on perinteisesti käytetty resistentin epilepsian hoitoon, mutta on yhä ilmeisempää, että sen edut voivat koskea laajempaa neurologisten sairauksien kirjoa.

Vaikka tutkimus sen käytöstä epilepsian ulkopuolella on vielä alkuvaiheessa, havainnot ovat lupaavia ja niillä on merkittävä potentiaali neurodegeneraation hoidossa, erityisesti mitokondrioiden toiminnan suhteen.

Ketogeenisellä ruokavaliolla on suotuisa vaikutus mitokondrioiden toimintaan. Se vähentää reaktiivisten happiradikaalien määrää ja lisää ATP:n saatavuutta. Ruokavalio voi suojata hermosoluja atrofialta ja vähentää inflammaatiota. Ketogeenisen ruokavalion aikana tuotettuja ketoneja voidaan käyttää vaihtoehtoisena polttoaineen lähteenä heikentyneen glukoosimetabolian yhteydessä.

9. Ketogeenisen ruokavalion vaikutus oksidatiiviseen stressiin


Ketogeenisen ruokavalion on osoitettu vähentävän reaktiivisten happiradikaalien muodostumista vaikuttamalla UCP-
irroittajaproteiineihin. Se lisää myös antioksidanttien, mukaan lukien katalaasi ja glutationi, tasoja inhiboivan vaikutuksensa kautta histonideasetylaaseihin ja aktivoimalla Nrf2-reittiä.

Irrooittajaproteiini (UCP) on mitokondrioiden sisäkalvoproteiini, joka on säännelty protonikanava tai kuljettaja. Irrotettava proteiini kykenee siten hajottamaan protonigradientin, joka syntyy NADH-moottorilla pumppaamalla protoneja mitokondrioiden matriisista mitokondrioiden kalvojen väliseen tilaan.

9.1. Ketogeeninen ruokavalio lisää mitokondrioiden UCP-proteiinitasoja


Oksidatiivinen fosforylaatio tuottaa reaktiivisia happiradikaaleja (ROS). Reaktiivisten happiradikaalien ylituotanto korreloi voimakkaasti mitokondriomembraanien potentiaalisten erojen välillä. Proteiinien irrottaminen (UCP) voi vähentää tätä potentiaalieroa sallimalla protonien pääsyn mitokondrioiden matriisiin.

Vaikka tämä irtikytkentä voi vähentää hapettuvan fosforylaation kautta syntyvää ATP:tä, sen kokonaisnettovaikutuksena on parantaa soluhengitystä ja ATP-tasoja vähentämällä reaktiivisten happilajien muodostumista ja suojata solua apoptoottisilta tapahtumilta.

Ketogeeninen ruokavalio näyttää edistävän UCP-aktiivisuutta, erityisesti UCP2:n, UCP4:n ja UCP5:n aktiivisuutta vastaavalla reaktiivisten happilajien vähenemisellä.

9.2. Ketonit estävät histonideasetylaaseja


Betahydroksibutyraatilla on suora, annoksesta riippuva estovaikutus luokan I histonideasetylaaseihin (HDAC), mukaan lukien HDAC1, HDAC3 ja HDAC4.

Asetoasetaatin on myös osoitettu estävän luokan I ja luokan IIa HDAC: ita. Betahydroksibutyraatin HDAC-esto edistää histoni H3-lysiini 9:n ja histoni H3-lysiini 14:n asetylointia ja lisää FOXO3A:n säätelemien geenien transkriptiota.

Näihin kuuluvat geenit, jotka johtavat mitokondrioiden antioksidanttientsyymien, kuten superoksididismutaasin (SOD) ja katalaasin ilmentymiseen.

9.3. Ketogeeninen ruokavalio johtaa Nrf2-reitin aktivoitumiseen


Ketogeeninen ruokavalio nostaa glutationitasoja rottien hipokampuksessa. Tämän uskotaan tapahtuvan Nrf2 (tumatekijä erythroid 2:een liittyvä tekijä) -reitin kautta. Kun ketogeeninen ruokavalio aloitetaan ensimmäisen kerran, oksidatiivinen stressi lisääntyy väliaikaisesti. Tämä voi aktivoida Nrf2:ta, koska viikko oksidatiivisen stressin väliaikaisen nousun jälkeen Nrf2: n ilmentyminen on lisääntynyt.

Kolme viikkoa ruokavalion aloittamisen jälkeen oksidatiivinen stressi laskee alle perustason ja Nrf2 pysyy koholla.

10. Ketogeenisen ruokavalion vaikutus ATP-tasoihin


Ketogeeninen ruokavalio parantaa ATP-tuotantoa. Betahydroksibutyraatin anto aivojen iskemian hiirimallissa säilyttää solujen ATP-tasot. Hiirien ruokinta ketogeenisellä ruokavaliolla kolmen viikon ajan johti lisääntyneeseen ATP-pitoisuuteen ja ATP / ADP-suhteeseen aivoissa.

ATP-tasojen paraneminen voidaan osittain selittää ketogeenisen ruokavalion kyvyllä vähentää oksidatiivista stressiä. Vaikka ruokavalio voi vähentää reaktiivisten happiradikaalien muodostumista lisäämällä UCP-aktiivisuutta, mikä tahansa UCP-aktiivisuuden aiheuttama oksidatiivisen fosforylaation väheneminen on suurempi kuin soluhengityksen tehostuminen ja siihen liittyvä ATP-tuotanto, joka tapahtuu vähentyneen oksidatiivisen stressin seurauksena.

Ketogeeninen ruokavalio näyttää myös säilyttävän ATP-tasot mitokondrioiden soluhengitysketjun toimintahäiriöiden yhteydessä, mahdollisesti täydentämällä TCA-syklin välituotteita.

Betahydroksibutyraatti vaimentaa elektroninsiirtoketjun kompleksin I vaurion aiheuttamaa ATP-tuotannon vähenemistä. Sen uskotaan lisäävän TCA-välisukkinaatin tasoja, joka ohittaa kompleksin I tullessaan TCA-sykliin. Tällä on huomattavia seurauksia MS-taudissa, koska elektronin siirtoketjun sisällä olevan kompleksin I vikoja on havaittu sekä valkoisen aineen vaurioissa että motorisen aivokuoren ”normaaleilla” alueilla.

Ketonit voivat myös säilyttää ATP-tasot, jos elektronin siirtoketjun kompleksi II estetään, mutta tähän liittyy jonkin verran alueellista spesifisyyttä.

11. Ketogeenisen ruokavalion vaikutus mitokondrioiden biogeneesiin


Ketogeeninen ruokavalio lisää mitokondrioiden biogeneesiä rotan hippokampuksessa ja pikkuaivojen vermissä (vermis). Vaikka tarkkaa reittiä tälle ei tunneta, sen uskotaan liittyvän PGC1a-perheen transkriptiokoaktivaattoreihin, jotka edistävät transkriptiotekijöitä, mukaan lukien NRF-1, NRF-2 ja ERRa.

12. Ketogeenisen ruokavalion vaikutus tulehdukseen


MS-taudin rotamallissa ketogeeninen ruokavalio tukahdutti tulehduksellisten sytokiinien ilmentymisen ja lisäsi CA1-hippokampuksen synaptista plastisuutta ja pitkäaikaista potentiointia, mikä johti parantuneeseen oppimiseen, muistiin ja motoriseen kykyyn.

Ketogeenisen ruokavalion tulehdusta ehkäisevä vaikutus voidaan osittain selittää estämällä NLRP3-tulehdusta betahydroksibutyraatilla tavalla, joka on riippumaton nälän aiheuttamista mekanismeista, kuten AMPK, autofagia tai glykolyyttinen esto.

NLRP3-tulehdus on vastuussa prokaspaasi-1:n pilkkomisesta kaspaasi-1: ksi ja sytokiinien IL-1β ja IL-18 aktivaatiosta. Sen esto estää IL-1β: n ja IL-18: n muodostumisen ja niiden alavirran vaikutukset.

13. Ketogeenisen ruokavalion neuroprotektiiviset ominaisuudet


Ketoaineilla on hermosoluja suojaava, eli neuroprotektiivinen rooli neurodegeneraation eläinmalleissa. Neuronien solupinnalla sijaitsevat ATP-herkät kaliumkanavat (K ATP-kanavat) stabiloivat hermosolujen herkkyyttä.

Ketonit edistävät näiden kanavien ”avointa tilaa” ja lisäävät hermosolujen vakautta. K ATP-kanavilla on myös rooli mitokondrioiden toiminnassa ja solukuolemassa. Sisemmällä mitokondriokalvolla sijaitsevien K ATP-kanavien ”avoin tila” estää mitokondrioiden läpäisevyyden siirtymähuokosten (MPTP) muodostumisen, jotka voivat johtaa mitokondrioiden turvotukseen ja solukuolemaan.

Asetoasetaatin ja beetahydroksibutyraatin on osoitettu nostavan kynnystä kalsiumin aiheuttaman MPTP: n muodostumiselle.

14. Ketonien vaikutuksen alueellinen vaihtelu hiiren pikkuaivoissa


Huolimatta näistä näennäisesti positiivisista vaikutuksista mitokondrioiden bioenergeettisiin aineisiin, ketogeenisen ruokavalion vaikutukset hiiren aivojen mitokondrioihin eivät ole homogeenisia ja jotkut tulokset näyttävät ristiriitaisilta.

Tutkimuksessa rotilla, jotka saivat ketogeenistä ruokavaliota 8 viikon ajan, antioksidanttitaso kohosi hippokampuksessa, mutta ei aivokuoressa, ja antioksidanttiaktiivisuuden havaittiin vähenevän pikkuaivossa.

15. Havainnot ihmisillä


Toistaiseksi ihmisillä tehtyjä tutkimuksia ketonien / ketogeenisen ruokavalion vaikutuksista neurodeneratiivisissa häiriöissä on hyvin vähän.

On kuitenkin ainakin yksi satunnaistettu kaksoissokkoutettu lumekontrolloitu tutkimus, jossa tarkasteltiin ketonien vaikutuksia neurodegeneratiiviseen fenotyyppiin 152 lievää tai kohtalaista Alzheimerin tautia sairastavalla. Osallistujilla havaittiin kognitiivisten kykyjen parantumista, kun ketogeenista yhdiste AC-1202:ta käytettiin 90 päivän ajan.

Tämä parannus oli suurempi potilailla, joilla ei ollut APOE4-polymorfismia. Pienemmät tutkimukset muissa neurodegeneratiivisissa olosuhteissa ovat tuottaneet yhtä positiivisia tuloksia.

On todisteita glukoosinkuljettajan toimintahäiriöistä aksoneissa, joihin on muodostunut MS-taudin aiheuttamia kroonisia vaurioita. Tutkimukset ketogeenistä ruokavaliota noudattaneista perinnöllisistä glukoosinkuljettajan toimintahäiriöitä sairastavilla ovat myös antneet positiivisia tuloksia.

16. Päätelmä


Ketogeenisellä ruokavaliolla on potentiaalia hoitaa progressiivisen MS:n neurodegeneratiivista komponenttia seuraavien in vitro ja in vivo -tutkimuksista saatujen havaintojen perusteella:

  1. Neurodegeneraation uskotaan perustavan progressiivisen MS: n patogeneesin.
  2. Mitokondrioiden toimintahäiriö voi johtaa ATP: n saatavuuden heikkenemiseen. Tämä voi edistää aksonin atrofiaa, mikä johtaa rappeutumiseen.On todisteita mitokondrioiden toimintahäiriöistä ”normaalilta näyttävässä” harmaassa aineessa ja mitokondrioiden toiminta näyttää korreloivan aksonien eloonjäämisen kanssa.
  3. In vitro- ja eläintutkimusten mukaan ketogeeninen ruokavalio lisää ATP-tuotantoa, edistää mitokondrioiden biogeneesiä ja ohittaa toimintahäiriöt sisällä mitokondrioiden bioenergeettinen prosessi lisää antioksidanttitasoja ja vähentää oksidatiivisia vaurioita.Koska ATP: n lisääntyminen ja mitokondrioiden toiminnan yleinen paraneminen korreloivat aksonien eloonjäämisen kanssa, ketogeeninen ruokavalio voi tarjota terapeuttista hyötyä MS-taudin neurodegeneratiiviselle komponentille.EAE-eläinmallit eivät edusta tarkasti MS: n taustalla olevaa patogeneesiä, koska neurodegeneraatiolla ei ole merkittävää roolia EAE:ssä.Mitokondrioita kohdentavat aineet, ketonit ja ketogeeninen ruokavalio ovat kuitenkin osoittaneet positiivisia tuloksia useissa hermoston rappeutumismalleissa, ja kun otetaan huomioon progressiivisen MS-tautiin käytettävissä olevan hoidon täydellinen puuttuminen, ketogeeninen ruokavalio on turvallinen vaihtoehto taudin etenemisen hidastamiseen.


Runsaasta rasvan määrästä huolimatta ketogeeninen ruokavalio on turvallinen ja jopa hyödyllinen kardiometabolisten riskitekijöiden suhteen (A. F. Cicero, M. Benelli, M. Brancaleoni, G. Dainelli, D. Merlini, and R. Negri, “Middle and long-term impact of a very low-carbohydrate ketogenic diet on cardiometabolic factors: a multi-center, cross-sectional, clinical study,” ).

Se on ollut jatkuvassa käytössä lähes vuosisadan ajan epilepsian hoidossa, ja se on ollut hyvin siedetty jopa lapsilla. Nykyisiin ketogeenisiin ruokavalioprotokolliin sisältyy useita vaihtoehtoja, mikä kannustaa kokeilemaan itselleen parhaiten sopivaa mallia.

MS-taudin nykyiset hoitovaihtoehdot vaikuttavat immuunijärjestelmän toimintaan ja uusiutumisasteeseen vaikuttaen vain vähän taudin etenemiseen. Niihin liittyy joskus merkittäviä sivuvaikutuksia, kuten lymfopenia ja multifokaalinen leukoenkefalopatia.

Tämän vuoksi joillekin potilaille voi olla edullisempaa noudattaa riskitöntä ruokavaliota, jolla on potentiaalia hidastaa taudin etenemistä vaikuttamatta immuunivasteeseen. Yhteenvetona voidaan todeta, että ketogeeninen ruokavalio ansaitsee lisätutkimuksia progressiivisen MS-taudin potentiaalisena terapiana.

https://citeseerx.ist.psu.edu/viewdoc/download?doi=10.1.1.812.402&rep=rep1&type=pdf




Likaista biologiaa & muutama vesiperä

Biologia on likaista. Paperilla matematiikka on puhdasta ja kaunista, mutta jos ihmisen aineenvaihdunnan toiminta määritellään termodynamiikan ensimmäisellä pääsäännöllä muuttujista piittaamatta, johtopäätökset ovat väistämättä harhaanjohtavia. Likaista biologiaa & muutama vesiperä tutustuu painonhallintaan ja terveyteen vaikuttaviin tekijöihin hieman toisesta vinkkelistä.

Olen aiemmissa kirjoituksissani arvioinut, että LCHF-ruokavaliota noudattavia ja suosittelevia lääkäreitä on muutamista kymmenistä satoihin. Olin väärässä. Pelkästään Kanadassa on lähes 4000 naistentautien lääkäriä, jotka suosittelevat potilailleen LCHF-ruokavaliota osana hoitosuosituksia.

Gary Taubesin mukaan koko maailmassa voi olla jo yli 10 000 lääkäriä, jotka toimivat institutionalisoituja lääketieteen dogmeja vastaan suosittelemalla LCHF-ruokavaliota osana lihavuuden, metabolisen oireyhtymän ja aikuistyypin diabeteksen hoitosuunnitelmaa.

Andreas Eenfeldtin Diet Doctor on maailman johtava lääketieteen ammattilaisten ylläpitämä ketogeeniseen ruokavalioon keskittynyt riippumaton verkkosivusto. Monet pidempään ketoilleet tunnistavat Diet Doctorin suunnannäyttäjien joukosta useita henkilöitä. Tämä henkilögalleria esimerkkinä siitä, että maailmalla yhä useammat lääketieteen ammattilaiset ja ravintoterapeutit luottavat tieteeseen ja tutkimukseen enemmän kuin pölyttyneisiin dogmeihin.

Diet Doctor Team

Tieteellinen tieto ei perustu muuttumattomiin dogmeihin

Koska tieteellinen metodologia on itseään korjaava järjestelmä, oletus on, että paremmin ilmiöitä kuvaava havaintojen ja evidenssin tukema malli korvaa huonommin ilmiöitä selittävän mallin. Perinteinen diet-heart hypoteesi on aikansa elänyt. Se on aika kuopata. Myös kaloriteoria kaipaa kipeästi päivittämistä.

Conclusions: Available evidence from randomized controlled trials shows that replacement of saturated fat in the diet with linoleic acid effectively lowers serum cholesterol but does not support the hypothesis that this translates to a lower risk of death from coronary heart disease or all causes. Findings from the Minnesota Coronary Experiment add to growing evidence that incomplete publication has contributed to overestimation of the benefits of replacing saturated fat with vegetable oils rich in linoleic acid.”

Uudet utkimukset eivät tue Ancel Keysin vuosikymmeniä vanhaa hypoteesiä, jonka mukaan tyydyttyneet rasvat ja kolesteroli aiheuttavat ateroskleroosia ja lisäävät kuolleisuutta.

On totta, että tyydyttyneet rasvat lisäävät ja monityydyttämättömät rasvat vähentävät lipoproteiinien määrää veressä. Tutkimusten mukaan kuolleisuus lisääntyy enemmän matalilla kolesterolitasoilla.

Robert Atkins

Palataan historiassa hieman taaksepäin. Robert Atkins ei ollut ensimmäinen ketoilija. Aihetta on käsitelty länsimaisessa lääketietellisessä kirjallisuudessa jo 1700-luvulta lähtien. Paaston ja hiilihydraattien rajoittamisen hyödyt on tunnettu Kiinassa pari vuosituhatta.

Robert Atkins (1930-2003) oli yhdysvaltalainen lääketieteen tohtori, fysiologi ja sydänlääkäri. Perinteisiä ruokavaliosuosituksia noudattanut Atkins kärsi ylipainosta ja masennuksesta. Hän aloitti 33-vuotiaana Alfred W. Penningtonin kehittämän ruokavalion noudattamisen rajoittamalla sokerin ja tärkkelyksen saantia. Vain kuudessa viikossa hänen painonsa putosi 12 kg.

Laihtumisen rohkaisemana hän ryhtyi hoitamaan ylipainoisia potilaitaan samanlaisella ruokavaliolla. Myös potilaiden paino laski ja terveys koheni. Vuonna 1972 Robert Atkins julkaisi maineikkaan laihdutusoppaan: Dr. Atkins’ Diet Revolution: The High Calorie Way to Stay Thin Forever. Vuonna 1992 hän julkaisi toisen kirjansa: Dr. Atkins’ New Diet Revolution, joka toimi lähtölaukauksena vuosituhannen vaihteen jälkeiselle vähähiilihydraattiselle buumille.

On selvää, etteivät terveysviranomaiset ja terveysjärjestöt katsoneet hyvällä Atkinsin oppeja. Hiilihydraattien rajoittamista vastustavat muistavat aina mainita, että Atkins kuoli 125 kiloisena läskinä sydänkohtaukseen, ja että hänellä oli pitkä historia sydänkohtauksia. Tällä urbaanilla legendalla halutaan alleviivata ketogeenisen Atkinsin ruokavalion oletettuja sydänriskejä. tarina on myytti.

Robert Atkins kaatui ja loukkasi päänsä. Sairaalassa hänet punnittiin. Robert Atkins painoi sairaalaan tullessaan 88,5 kiloa. Atkins vaipui sairaalassa koomaan ja sai nesteytystä yhdeksän päivää kestäneen kooman ajan. Sairaalassa Atkinsin paino nousi noin 28 kiloa. Hän siis painoi kuollessaan enemmän kuin sairaalaan saapuessaan. Robert Atkins sairasti kardiomyopatiaa (sydännlihaksen sairaus), jonka todennäköisin aiheuttaja oli infektio. Robert Atkins kuoli kaatumisen aiheuttamaan aivovammaan. Tämä on virallinen lääketieteellinen totuus.

Tutkimusten mukaan Atkinsin dieetti on turvallinen ja tehokas

Vuoden 2000 jälkeen tehdyt tutkimukset ovat osoittaneet, että Atkinsin dieetti on tehokas ruokavalio painonpudotuksessa ja hyödyllinen sydänterveyden riskitekijöiden kannalta. Tutkimukset eivät ole kuitenkaan vakuuttaneet läheskään kaikkia.

Kun sata lääkäriä julkaisi taannoin ketogeenisen ruokavalion terveyshyötyjä painottavan julkilausuman Huffington Postissa, vain muutama viikko myöhemmin ketogeeninen ruokavalio ja Atkinsin dieetti teilattiin mediassa täysin. Kamppailu on ankaraa. Paradigmat kaatuvat väistämättä, mutta väärien tietojen kumoaminen on hidasta.

Miksi ihminen lihoo?

Nykyihminen kehittyi noin 200 000 vuotta sitten. Ravitsemussuositukset otettiin käyttöön Yhdysvalloissa vuonna 1977. Ihmiskunta selvisi ja kehittyi 200 000 vuotta ilman virallisia ohjeita. Kuinka se on mahdollista? Miksi ihminen lihoo, vaikka meillä on vimpan päälle ohjeet oikein syömiseen?

Ihminen kehittyi sekasyöjäksi,koska se oli ainoa tapa selvitä. Ravinto kerättiin luonnosta silloin kun jotain ravintoa oli kerättävissä. Eläimiä saalistettiin ravinnoksi aina kuin se oli mahdollista tai tarpeen. Talvisin saaliseläimet olivat käytännössä varhaisten ihmisten ainoa ravinnonlähde. Tähän kehityshistoriaan nojaa paleodieetin perusta. Ruokaa syötiin silloin, kun sitä oli. Ylimääräisen energian elimistö varastoi rasvasoluihin.

Ihminen lihoo siksi, että evoluutio on mahdollistanut energian varastoimisen rasvasoluihin pahan päivän varalle. Ihminen selviää erinomaisesti ilman ravintoa pitkiäkin aikoja. Miten ihminen lihoo, on kokonaan toinen kysymys, joka liittyy energiansaannin ja kulutuksen tasapainoon sekä noin kymmeneen muuhun muuttujaan.

Luontokappaleet joko varastoivat energiaa tai vaihtolämpöisinä säästävät energian kulutuksessa. Varastoiminen tarkoittaa rasvan keräämistä, koska ravinnon saanti ei aina ollut itsestään selvää.

Lähes kaikki eläimet varastoivat energiaa rasvasoluihin. Lihominen on siis luonnollinen tapa varautua siihen, että ravintoa ei olekaan saatavilla. Rasvasoluihin varastoituu myös rasvaliukoisia vitamiineja.

Kun ihminen ei saa energiaa ravinnosta, elimistössä aktivoituu aineenvaihduntaprosessi, joka purkaa rasvasoluihin varastoituneita triglyseridejä vapaiksi rasvahapoiksi ja glyseroliksi verenkiertoon. Vapaiden rasvahappojen karboksyyliryhmät hapetetaan solujen beetaoksidaatiossa asetyylikoentsyymi-A:ksi, jota mitokondriot voivat sitruunahappokierrossa hapettaa energiaksi. Osa asetyylikoentsyymi-A:sta voidaan edelleen muuttaa solujen energiaksi kelpaaviksi ketoaineiksi. Maksa muuttaa ketogeneesissä vapaita rasvahappoja ketoaineiksi, kuten betahydroksibutyraatiksi.

Vapaita aminohappoja, sitruunahappokierron välituotteita, ketoaineita, vettä ja glyserolia voidaan muuttaa glukoosiksi glukoneogeneesissä. Veren punasolut tarvitsevat välttämättä glukoosia, jonka keho osaa itse valmistaa. Aiempien oletusten mukaan aivojen solut eivät ole riippuvaisia glukoosin saannista.

Evoluutio on varmistanut näin sen, että me emme kuole nälkään, jos emme saa heti ruokaa. Terve ihminen voi paastota pelkällä vedellä jopa 30 vuorokautta ja pysyä terveenä ja toimintakykyisenä.

Maailman pisimpään paastosi skotlantilainen Angus Barbieri, joka paastosi veden ja vitamiinipillereiden avulla kokonaista 382 vuorokautta. Paaston aikana hänen painonsa putosi 125 kiloa. Tapaus on hyvin dokumentoitu ja mainitaan mm. Guinnesin ennätysten kirjassa.

Angus Barbieri
Lähde: Wikipedia

Lämpöopin ensimmäinen pääsääntö

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Ongelma on se, että monimutkaiset asiat halutaan yksinkertaistaa. Lihomisen selittäminen energian säilymisellä tarkoittaa sitä, että viivat vedetään suoriksi ja kaikki häiritsevät taustavaikuttajat pyyhitään yhtälöstä.

Tutkiva journalismi on lähestulkoon haudattu. Uutiset julkaistaan sen tarkemmin asioihin paneutumaatta. Monet journalistit käytännössä vain kääntävät uutistoimistojen uutisia ymmärtämättä uutisen aiheesta juuri mitään. Se on valitettavaa, mutta totta.

Kalorioppi toimii periaatteessa hyvin paperilla. Ikävä tieteellinen fakta on, että rumat tosiasiat pilaavat kauniit teoriat. Biologia on likaista. En tarkoita saastaista, vaan tarkoitan, että kaikkien yhtälöön vaikuttavien tekijöiden laskeminen ja mallintaminen jokaiseen ihmiseen päteväksi universaaliksi lainalaisuudeksi on mahdotonta.

Biologia on likaista, koska aineenvaihdunnasta ei voi vetää universaaleja lakeja. Se sisältää liikaa rumia tosiasioita, jotka pilaavat kauniin teorian.

Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biokemiallinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan mekanismeja.

Kalorioppi

Kalori on vanha energian mittayksikkö. Se tarkoittaa lämpömäärää, joka kasvattaa yhden 14,5 asteisen vesigramman lämpötilaa assteella normaalipaineessa. Ravinnosta puhuttaessa pitäisi puhua kilokaloreista.

Tohtorit Newburg ja Johnston esittivät vuonna 1930 hypoteesin, jonka mukaan lihavuus johtuu kalorein mitattuna liian rusaasta ravinnosta, eikä aineenvaihdunnan häiriöstä. Tutkimusaineisto oli niukka, mutta kaloriteoria otettiin vastaan kumoamattomana tieteellisenä faktana.

Montignacin kritiikki kaloriteoriaa vastaan

Ranskalaisen Michel Montignacin periaate on seuraava: ”Lihominen ei johdu liiasta syömisestä vaan huonosta syömisestä.”

Montignacin mukaan kalorien vähentämiseen perustuva laihdutusteoria on 20. vuosisadan suurin ”tieteellinen ankka”. ”Se on ansa, huiputus, hölmö ja vaarallinen olettamus, jolla ei ole mitään tieteellistä perustaa. Ja kuitenkin se on ohjannut ravitsemuskäyttäymistämme yli puolen vuosisadan ajan.”

Montignac selvittää painon kertymisen logiikan seuraavasti: Olettakaamme, että yksilön päivittäinen tarve on 2500 kcal ja hänen saamansa kalorimäärä on pitkän ajan vastannut tätä tarvetta. Mikäli päivittäinen kaloriannos putoaa äkkiä 2000 kcal:iin, seurauksena on todellakin vastaavan vararasvamäärän käyttö ja toteamme painon pudonneen.

Jos päivittäinen kalorimäärä sen sijaan vakiintuu 2000:ksi aiemman 2500:n sijasta, elimistön eloonjäämisvaisto mukauttaa energiatarpeen nopeasti uudelle tasolle. Koska ihmiselle annetaan vain 2000 kcal, hän kuluttaa vain 2000 kcal. Painonmenetys keskeytyy nopeasti. Mutta elimistö ei jää tähän. Itsesäilytysvaisto houkuttelee sen entistä suurempaan varovaisuuteen. Ja tämä varovaisuus johtaa uusien varastojen muodostamiseen. Mikäpä siinä, jos sille annetaan vain 2000 kcal, se vähentää energiantarvettaan entisestään ja kuluttaa esimerkiksi vain 1700 kcal ja tallettaa ylimääräiset 300 kcal vararasvoiksi.

Montignacin mukaan vararasvojen muodostuminen tai muodostumatta jääminen on suoraan riippuvainen insuliinin erityksestä. Insuliinin eritys käynnistyy aina silloin kun veren sokeripitoisuus on nousemassa liian korkeaksi. Sen tehtävänä on auttaa veren glukoosin imeytymistä elimistön kudoksiin. Tarjolla oleva glukoosi käytetään joko tyydyttämään kehon välitöntä energiantarvetta tai, mikäli sitä esiintyy runsaasti, vararasvojen muodostamiseen. (1)
Ajatus, että jokaisen ihmisen biokemiallinen kone noudattaa täsmälleen samalla tavalla termodynamiikan ensimmäistä pääsääntöä, on yhtä hölmö, kuin väite, että kaikkien autojen bensiininkulutus on täsmälleen sama.

Termodynamiikan ensimmäinen pääsääntö:

  • Energiaa ei voida hävittää, se vain muuttaa muotoaan.
  • Termodynaamiseen systeemiin voidaan tuoda energiaa kahdessa eri muodossa työnä W ja lämpönä Q.
  • Tuotu energia muuttuu systeemin sisäenergiaksi U.
  • Sisäenergian muutos on siis systeemiin tuodun energian määrä:

ΔU=Q+W

  • Sisäenergian muutos ilmenee muutoksena systeemin lämpötilassa, paineessa, tilavuudessa tai olomuodossa.
  • Systeemistä voi myös lähteä energiaa. Tällöin systeemi, joko luovuttaa lämpömäärän -Q tai tekee ympäristölle työn -W. Huomaa miinus merkki energian lähtiessä systeemistä.

Syötyjen ja kulutettujen kaloreiden laskeminen on käytännössä mahdotonta. Erilaiset laskurit ja laskentakaavat helpottavat seurantaa, mutta nekin antavat epätäsmällisiä osatotuuksia.

Tietenkin ihminen laihtuu, jos syödyn energian määrä on vähäisempi kuin kulutetun energian määrä, mutta jos aineenvaihdunta toimii normaalisti, se purkaa energianpuutteessa mm. lihasten proteiineja polttoaineeksi. Äärimmäisellä rasvoja rajoittavalla ruokavaliolla ihminen voi ”syödä” omat lihaksensa. (1)

Kaikki laihduttajat tietävät, että laihduttaminen on vaikeampaa kuin lihominen. Meidät on ehdollistettu syömään 4-6 kertaa päivässä (mukaanlukien välipalat), että verensokerimme pysyy tasaisena.

Koska ravintomme koostuu pääasiassa sokereista, verensokerin ja insuliinipitoisuuden vaihtelut aiheuttavat energiapiikkejä ja energiatason nopeita laskuja. Tämä pitää meidät nälkäisinä ympäri vuorokauden. Jatkuvaa nälkää kompensoidaan välipalapatukoilla, pullakahveilla, välipaloilla, snackseillä, virvoitusjuomilla jne.

Tämä aiheuttaa toisaalta kokonaisenergian huomaamattoman kasvun, mutta tärkeämpää on se, kuinka ruoka vaikuttaa verensokeriin ja insuliiniin.

Miksi insuliini on tärkeää?

Kuvaparissa tyypin 1 diabetesta sairastava potilas ennen ja jälkeen insuliinihoidon. Kun haima lopettaa insuliinintuotannon, aineenvaihdunta ei voi käyttää syötyä ravintoa polttoaineena, joten se turvaa välttämättömien elintoimintojen jatkuvuuden purkamalla lihaksiin, maksaan ja rasvakudokseen varastoitua energiaa solujen polttoaineeksi.

Ennen insuliinilääkitystä tyypin 1 diabeetikot nääntyivät nälkään riippumatta siitä, kuinka paljon he söivät.

Haiman beetasolut erittävät vereen insuliinia kahdella mekanismilla.

  1. Ensinnäkin syöminen signaloi aivoille, että elimistö saa ravintoa. Tällöin hypotalamus signaloi haimalle, että ruokaa olisi pian tulossa, joten eritäpä sitä insuliinia vereen.Syöminen vaikuttaa insuliinin eritykseen makuaisti-hypotalamas-haima reitillä. Hypotalamuksen säätelemään insuliinin eritykseen vaikuttaa ainakin makuaisti. (1, 2).
  2. Veren glukoosipitoisuuden kasvu vaikuttaa haiman insuliinin eritykseen suoraan. Haiman Langerhansin saarekkeiden beetasolut aistivat verensokerin muutoksia ja pystyvät autonomisesti säätelemään verensokeria.Verensokerin noustessa haiman beetasolut erittävät vereen insuliinia, joka siivoaa glukoosin (ja muut ravinteet) verestä soluihin. Verensokerin laskiessa haiman alfasolut erittävät vereen glukagonia, joka aktivoi lihaksiin ja maksaan varastoitujen glykogeenien purkamisen glukoosimolekyyleiksi.

Insuliinin merkitystä painonhallinnalle ja terveydelle ei voi vähätellä.

  1. Insuliini on elintärkeä hormoni, jota ilman me kuolisimme.
  2. Insuliini vaikuttaa glukoosin ja muiden ravintoaineiden soluunottoon, glykolyysiin, glykogeenien synteesiin, proteiinien synteesiin sekä elektroninsiirtoketjun toimintaan.
  3. Insuliini estää glukoosia tuottavan glukoneogeneesin käynnistymisen, maksan ja lihasten sokerivarastoja purkavan glykogenolyysin, rasvahappoja purkavan lipolyysin, proteolyysin ja ketogeneesin.

Insuliinin toiminta

Insuliini on energia-aineenvaihdunnan tarvitsema elintärkeä hormoni. Se toimii kuin liikennevalvoja, joka ohjaa solujen energia-aineenvaihduntaa ja energian varastointia.

Solujen energiakylläisyyden perusteella solujen insuliinireseptoreihin kiinnittyneet insuliinimolekyylit päästävät ravintoaineita soluihin, jotka tarvitsevat energiaa ja/tai soluihin, joissa on tilaa varastoida energiaa.

Soluun kiinnittynyt insuliinimolekyyli näyttää glukoosi- ja rasvamolekyyleille vihreää valoa; tänne mahtuu.

Insuliini on porttivahti, joka avaa solut vain yhteen suuntaan: sisälle. Glukagoni insuliinin vastavaikuttajana puolestaan toimii solusta ulos periaatteella ja purkaa mm. glykogeeneihin varastoituneita sokereita verenkiertoon.

Veressä on aina insuliinia, mutta, kun insuliinipitoisuus laskee riittävästi, haima erittää glukagonia,joka purkaa energiavarastoja. Kun maksan ja lihasten sokerivarastot on kulutettu, verenkiertoon erittyy lipolyyttisiä hormoneja (adrenaliini, noradrenaliini, kortikotropiini ja glukagoni), jotka käynnistävät rasvasolujen purkamisen. Insuliini estää rasvasolujen purkamista, eli lipolyysiä. Jos verensokeri on jatkuvasti korkea ja veressä on paljon insuliinia, rasvasolujen purkaminen energiakäyttöön estyy.

Insuliiniresistenssi ja hyperinsulinemia

Jos haiman kyky tuottaa insuliinia loppuu, kuten tyypin 1 diabeteksessa tapahtuu, ravintoaineet eivät pääse verestä soluihin. Insuliinin puutteessa energian tuotanto loppuu ja ihminen nääntyy nälkään, vaikka söisi koko ajan. Tyypin 2 diabeteksessa haima tuottaa alkuun jopa normaalia enemmän insuliinia, mutta solujen insuliiniherkkyyden heikentyminen johtaa siihen, että veressä on liikaa insuliinia (hyperinsulinemia).

Insuliiniresistenssi ja hyperinsulinemia assosioituvat kaikkiin yleisimpiin kroonisiin sairauksiin. Tätä ei vielä tiedetty viime vuosisadan puolivälissä, mutta tieto lisääntyy ja se korjaa vanhoja käsityksiä.

Useimpien sairauksien taustalla on aineenvaihdunnan toimintahäiriö ja tämän aiheuttamat komplikaatiot. Lihavuus on lähes aina oire siitä, että aineenvaihdunnan toiminta on häiriintynyt. Nykyisin on tapana syyllistää ja leimata lihavia, mutta se on väärin. Lihavuus on oire, ei syy.

Hyperinsulinemiaan assosioituvat mm. Alzheimerin ja Parkinsonin taudit, tyypin 2 diabetes, alkoholista riippumaton rasvamaksa, haavainen paksusuolentulehdus, krooninen inflammaatio, lihavuus, ateroskleroosi, kardiomyopatia, sydänhalvaukset ja verenpaine. Edelliset kuvankaappaukset Catherine Kroftsin videolta.

Insuliini rakentaa lihas- ja rasvakudosta

Insuliini vaikuttaa myös anabolisiin aineenvaihduntatapahtumiin, kuten energian varastoimiseen lihasten ja maksan glykogeeneihin ja rasvasoluihin sekä esimerkiksi lihaskudosta rakentavaan proteiinisynteesiin. Tämä on äärimmäisen tärkeää.

Kun verenkierrossa on liikaa energiaravinteita (glukoosia ja rasvaa), ravintoaineet ohjataan ensin soluihin, jotka tarvitsevat energiaa. Ylimääräinen glukoosi varastoidaan ensimmäiseksi maksan ja lihasten sokerivarastoihin (glykogeenit), johon mahtuu keskimäärin 250-500 grammaa sokeria ihmisen lihaskunnosta riippuen.

Glukoosi, joka ei mahdu glykogeeneihin, varastoidaan rasvasoluihin. Myös ylimääräinen rasva ohjataan rasvasoluihin. Insuliinilla on keskeinen rooli energiaravinteiden ohjaamisessa soluihin. Solut käyttävät energian lähteenä joko rasvaa tai glukoosia. Solu ei voi samanaikaisesti sekä polttaa, että varastoida energiaa. Niin ei vain tapahdu. Tämä on periaatteessa perinteisen kaloriopin mukainen mekanismi.

Kiinnostavaksi tilanne muuttuu, kun likainen biologia kumoaa perinteisen mallin. Jos ja kun veressä on liikaa sokeria (hyperglykemia) ja insuliinia (hyperinsulinemia), sokeri voidaan varastoida vain rasvasoluihin, jossa glukoosi muutetaan lipogeneesissä triglyserideiksi. Jatkuvasti koholla oleva insuliini johtaa solujen insuliiniresistenssiin, minkä seurauksena insuliinin kyky siivota verestä ravintoaineet soluihin heikkenee. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, joten insuliini ohjaa yhä enemmän ravintoa verenkierrosta rasvasoluihin samalla, kun insuliiniresistenttien lihassolujen energiansaanti vähenee. Tämän seurauksena ihminen alkaa lihoa.

Insuliiniresistentti varastoi enemmän energiaa rasvasoluihn

Mitä tämä käytännössä tarkoittaa? Se tarkoittaa sitä, että samasta syödystä energiamäärästä insuliini varastoi suhteessa suuremman osan rasvakudokseen, koska ravintoa energiaksi polttavien lihassolujen kyky vastaanottaa energiaa on heikentynyt. Insuliiniresistentin ihmisen lihominen voi alkaa, vaikka kilokalorimääräisesti energiansaanti pysyisi aiemmalla tasolla. Insuliiniresistenssi vaikuttaa lihomiseen satunnaista ylensyöntiä enemmän.

Veressä on aina hieman insuliinia. Proteiinit ja rasvat lisäävät insuliinin eritystä, koska energia-aineenvaihdunta loppuu ja ihminen nääntyy nälkään, jos insuliinia ei ole saatavilla. Glukoosi kohottaa insuliinitasoja tuplasti enemmän kuin proteiini ja moninkertaisesti enemmän kuin rasva. Liikaa hiilihydraatteja sisältävä ravinto pitää verensokerin liian korkealla, jolloin insuliinin eritys lisääntyy ja vähitellen jatkuvasti koholla olevat verensokeri ja insuliini alkavat vaikuttaa negatiivisesti aineenvaihdunnan toimintaan. Tämä ennakoi insuliiniresistenssia, joka on useimpien kardiometabolisten sairauksien tärkein aiheuttaja.

Aineenvaihdunta on enemmän kuin lämpöoppia ja paljon enemmän kuin iltapäivälehtien höpöhöpöjutut. Energia ei häviä suljetusta systeemistä, mutta energian käyttöä ja varastoitumista säätelee monimutkainen biologinen kone. Perinteisenen kalorioppi selittää kyllä lihomista, mutta se kuvaa puutteellisesti lihomisen syitä ja aineenvaihdunnan jänniä mekanismeja.

Se, että eräät konservatiiviset ja institutionalisoituneet tieteestä piittaamattomat ravitsemusneuvojat väittävät, ettei hormoneilla, kuten insuliinilla ole suurtakaan merkitystä painon kannalta, on raivostuttavaa paskapuhetta.

Yksinkertaisesti: keho ei voi varastoida sokereita tai läskiä ilman insuliinin välittävää vaikutusta.

Etanolin aineenvaihdunta

Entä, jos laitamme energian tilalle alkoholin? Termodynamiikan ensimmäisen pääsäännön mukaan juodun alkoholin pitäisi poistua kehosta, koska muuten ylimääräinen alkohli varastoituisi elimistöön alkoholina tai läskinä.

Aineenvaihdunta polttaa juotua alkoholia muiksi aineiksi. Myös ravinnon sisältämä energia muuttuu aineenvaihdunnassa. Ravinto ei ole pelkkää energiaa.

Lämpöoppi toimii, mutta siinä on huomioitava myös yhtälöön vaikuttavat lukemattomat muuttujat, koska muuten siihen ei voi luottaa.
Etanoli on luonnosta ja alkoholijuomista löytyvä alkoholi, joka metaboloituu monimutkaisella katabolisella aineenvaihduntareitillä. Useat entsyymit osallistuvat etanolin prosessointiin ensin asetaldehydiksi ja edelleen etikkahapoksi ja asetyylikoentsyymi-A:ksi.

Kun asetyylikoentsyymi-A on muodostunut, siitä tulee sitruunahappokierron substraatti, joka hapetetaan solujen mitokondrioissa energiaksi. Sitruunahappokierron jäännöstuotteina on vettä ja hiilidioksidia.

Entsyymien esiintymisessä ja saatavuudessa olevien erojen vuoksi eri ikäiset ihmiset käsittelevät etanolia eri aineenvaihduntareiteillä. Maksa on tärkein etanolin aineenvaihduntaan osallistuva elin, koska maksassa esiintyy korkeina pitoisuuksina etanolin aineenvaihdunnan tarvitsemia entsyymeitä.

Ruoansulatusjärjestelmä tuottaa noin 3 g etanolia päivässä fermentoimalla ravintoa. Etanolin katabolinen hajoaminen on välttämätöntä paitsi ihmisten, myös kaikkien tunnettujen organismien, elämälle.

Eräät etanolin aineenvaihduntaan liittyvien entsyymien aminohapposekvenssit eivät ole muuttuneet 3,5 miljardiin vuoteen. Kaikki organismit tuottavat alkoholia pieninä määrinä useilla aineenvaihduntareiteillä.

Etanolia syntyy pääasiassa rasvahappojen synteesin, glyserolipidimetabolian, ja sappihapon biosynteesireittien kautta. Jos keholla ei olisi mekanismia alkoholien katabolisoimiseksi, alkoholit kumuloituisivat elimistöön ja muuttuisivat myrkyllisiksi.

Ehkä tämän vuoksi evoluutio on kehittänyt keinon katabolisoida etanolia myös sulfotransferaasin avulla. Sulfotransferaasit sulfonoivat serebrosideja sulfatideiksi. Serebrosidit ovat sfingolipideihin kuuluvia glykolipidejä, jotka vaikuttavat mm. hermokudoksessa.

Serebrosidien rakenne koostuu sfingosiinistä, rasvahappo-osasta ja glukoosista tai galaktoosista. Galaktooseja sisältäviä serebrosideja esiintyy erityisesti myeliinistä. No niin. Pitikö se viina vetää tähänkin juttuun? Ohessa etanolin aineenvaihduntareitti

Kuvankaappaus: Wikipedia

Kuinka etanolin aineenvaihdunta liittyy termodynamiikan ensimmäiseen pääsääntöön?Aineenvaihdunta muuttaa etanolin energiaksi, mutta ei varastoi etanolia soluihin alkoholina. Itse asiassa aineenvaihdunta ei edes osaa muuttaa etanolia läskiksi.

Lihottaako alkoholi ja miten se lihottaa?

Alkoholi sisältää noin 7 kcal/g energiaa. Puhtaassa etanolissa on enemmän energiaa kuin sokerissa ja melkein saman verran kuin rasvassa.

Alkoholi voi vaikuttaa lihomiseen ja rasvoittaa maksaa, mutta ei sen vuoksi, että laskennallisesti etanolissa on paljon energiaa. Lihomiseen ja maksan rasvoittumiseen vaikuttavat ne muuttujat, jotka sotkevat puhtaan termodynamiikan ensimmäisen pääsäännön kauniin yhtälön likaisella biologialla.

Mitä alkoholille tapahtuu? Kun ihminen juo alkoholia, maksa paiskii ylitöitä. Entsyymi nimeltä Alkoholidehydrogenaasi (ADH) hapettaa alkoholin asetaldehydiksi. Alkoholia palaa noin 0,1 g/painokilo/h, eli 70-kiloinen henkilö polttaa 7 grammaa alkoholia tunnissa.

Aldehydidehydrogenaasi metaboloi asetaldehydistä edelleen asetaattia. Asyyli-CoA syntaasi (ACSS2) ja asetyyli-CoA syntaasi (ACSS1) syntetisoivat asetaatista asetyylikoentsyymi-A:ta. Kun asetyylikoentsyymi-A on muodostunut, se siirtyy mitokondrioiden sitruunahappokiertoon, jossa siitä hapetetaan energiaa ja jäännöstuotteena on vettä ja hiilidioksidia. Kaikki energiaa tuottavat ravinteet muuttuvat aineenvaihdunnassa asetyylikoentsyymi-A:ksi, joka poltetaan vedeksi ja hiilidioksidiksi.

Alkoholin sisältämät sokerit lihottavat, alkoholi hidastaa rasvan palamista ja kasvattaa ruokahalua. Jos alkoholin yhteydessä syö energiatiheää ruokaa, alkoholi lisää ravinnon sisältämän rasvan ja hiilihydraattien varastoimista mm. maksaan. Puhdas alkoholi ei muutu elimistössä läskiksi. Se on sitä likaista biologiaa, joka ei sovi yhteen termodynamiikan ensimmäisen pääsäännön kanssa. Eräs alkoliin liittyvä kiinnostava huomio on se, että alkoholi itse asiassa parantaa solujen insuliinisensitiivisyyttä.

Runsaan alkoholin nauttimisen seurauksena veren alkoholipitoisuus pysyy korkeana kunnes maksa on prosessoinut kaiken alkoholin asetaldehydiksi, astetaatiksi ja asetyylikoentsyymi-A:ksi, joka hapetetaan sitruunahappokierrossa energiaksi. Jo tämä itsessään todistaa, että keho ei osaa muuttaa alkoholia läskiksi. Elimistö metabolisoi alkoholin ennen muita ravinteita. Jos ihminen syö, kun veressä on alkoholia, syöty ravinto muutetaan energiaksi tai varastoidaan vasta alkoholin palamisen jälkeen. Tämä voi lihottaa.

Aineenvaihdunta on siitä merkillinen biokemiallinen järjestelmä, että rasvat eivät aina varastoidu läskinä, mutta hiilihydraatit joudutaan joskus muuttamaan läskiksi.

Energiaravinteet: rasvat, hiilihydraatit ja proteiinit seuraavat kukin omia kemiallisia aineenvaihduntareittejään. Niillä on elimistössä muitakin tehtäviä kuin energian tuottaminen.

Alkoholiesimerkin takoituksena oli havainnollistaa, että aineenvaihdunnan kannalta tapahtumat eivät ole yksinkertaisesti sisään-ulos-tapahtumia, vaan paljon paljon monimutkaisempia reaktioketjuja, joihin vaikuttavat mm. geenit, sukupuoli, ikä ja hormonit.

Me tiesimme tämän aina, mutta emme ymmärtäneet. Alkoholin aiheuttama humalatila jatkuu, kunnes maksa on polttanut kaiken alkoholin verestä. Alkoholin sisältämä energia (kalorit) palaa, mutta ei varastoidu.

Lihava ihminen – Homo Corpulentus

Lihomiseen vaikuttaa ravinnon sisältämän energian lisäksi mm. ympäristö, geenit, hormonit, sukupuoli,ikä, suolistoflooran koostumus, stressi, unen määrä ja laatu, sekä ruumiinrakenne, eli kehon rasva- ja lihaskudoksen suhde. Näillä kaikilla on huomattava merkitys siihen, kuinka elimistö käyttää ravinnosta saatuja kaloreita, ja kuinka ihminen lihoo. Lihomiseen vaikuttavia tekijöitä kutsutaan obesogeneettiseksi potentiaaliksi.

Yleisesti ottaen aineenvaihdunta varastoi energiaa silloin kun energiansaanti ylittää kulutuksen. Tämä on selvää, mutta tutkimuksista tiedetään, että samaa ruokaa saman verran syövien ihmisten aineenvaihdunnan tapa käsitellä ravinnosta saatua energiaa poikkeaa toisistaan.

Tämä on osoitettu mm. identtisillä kaksosilla, jotka ovat syöneet laskennallisesti saman verran energiaa, mutta toinen on pysynyt hoikkana ja toinen lihonut. Kuinka se on mahdollista? Identtisillä kaksosilla on havaittu suoliston mikrobiomin vaikutus energia-aineenvaihduntaan. Lajistoltaan runsaampi mikrobiomi on yhteydessä tehokkaamaan aineenvaihduntaan ja energian kulutukseen, kun lajistoltaan köyhempi mikrobiomi assosioituu lihomiseen.

Ravinnolla on lihomisen kannalta merkittävä rooli, mutta jopa 70 % kehonpainoon vaikuttavista muuttujista johtuu geneettisistä tekijöistä, kertoi Professori Alfredo Martinez (Center of Nutrition Research at the University of Navarra, Pamplona, Espanja) Nature Reviews Disease Primers-lehdelle.

Melanokortiini 4 reseptori -geenimuutos näyttää liittyvän lihavilla ihmisillä selvästi ahmimishäiriöön. Sveitsiläistutkijat totesivat, että kaikki tätä geenimuutosta kantavat erittäin lihavat potilaat kärsivät ahmimishäiriöstä. Melanokortiini 4 reseptorin geenimuutosta on kahden tuoreen tutkimuksen mukaan runsaalla viidellä prosentilla lihavista ihmisistä. Geenimuunnos vaikuttaa ruokahalun sääntelyyn aivojen hypotalamuksessa.”Duodecim

Lihomisalttiuteen vaikuttavia geenimuutoksia on löydetty 118. Yksittäinen muutos ei kasvata lihomisen riskiä merkittävästi, mutta ihmisillä, joilla on useita lihomisalttiuteen vaikuttavia geenimuutoksia, on vahva taipumus lihomiseen kaloreista ja liikunnan määrästä riippumatta. Esimerkiksi ankyrin-B geenin muutokset lisäävät glukoosin kulkua rasvasoluihin.

Myös äidin paino vaikuttaa raskauden ja imetyksen aikana lapsen kehitykseen. Professori Martinezin mukaan raskaudenaikainen lihominen ensimmäisten 20 raskausviikon aikana lisää syntyvän lapsen ylipainoisuuden riskiä. Ilmiö palautuu sikiöaikaiseen aineenvaihduntaan, joka vaikuttaa pysyvästi lapsen geeneihin.

Toisaalta äidin imetyksen aikainen ravinto voi aiheuttaa vastaavanlaisia epigeneettisiä muutoksia lapsen insuliininsäätelyä ohjaavissa geeneissä ja altistaa lapsen myöhemmin elämässä insuliiniherkkyyden alenemiselle ja insuliiniresistenssille, kertoo professori Mark H. Vickers (Liggins Institute at the University of Auckland, New Zealand) Frontiers in Endocinology-lehdessä.

Kolesteroli

Yritän kirjoittaa kolesterolista oman tutkielman, koska aihe on äärimmäisen laaja ja monimutkainen.

Ei ole olemassa hyvää tai pahaa kolesterolia. On vain kolesterolia. Jos kolesterolimolekyyliä muutetaan yhdelläkin atomilla puoleen tai toiseen, se ei enää ole kolesterolia.

LDL, HDL ja kylomikronit (yms.) ovat rasvaa, kolesterolia ja vitamiineja kuljettavia lipoproteiineja. Sellaisina ne ovat aivan välttämättömiä rasva-aineenvaihdunnan normaalille toiminnalle. Se, että lipoproteiineja kutsutaan kolesteroliksi on hyvin harhaanjohtavaa.

Kolesterolisynteesi tuottaa kolesterolia, joka on mm. steroidihormonien, kuten estrogeenin, testosteronin ja D-vitamiinin synteesin välttämätön lähtöaine. Ruoansulatusnesteet tarvitsevat kolesterolia, aivot tarvitsevat kolesterolia, hermoratoja suojaavissa myeliinikalvoissa on kolesterolia ja solut tarvitsevat kolesterolia solukalvoihin. Joka päivä uusiutuu noin 200 grammaa soluja, joiden solukalvojen yksi rakennusaine on kolesteroli. Ihmisen kolesterolista 25 % on aivoissa, ja ravinto ei lisää kokonaiskolesterolia juuri lainkaan. Elimistö tuottaa sen verran kolesterolia kuin se tarvitsee.

Esimerkiksi suomalaisen väitöstutkimuksen mukaan naisten kuolleisuus lähtee kasvuun, jos kokonaiskolesteroli laskee neljään tai sen alle. Mutta tutustutaan kolesteroliin toisessa artikkelissa.

Inspiraation ja tiedon lähteitä

Gary Taubes

Robert Lustig

Paul Mason

Catherine Crofts

Nina Teicholz

Andreas Eenfeldt

Jason Fung

Georgia Erde

Benjamin Bikaman

Stephen Phinney

Darius Mozaffarian
Tim Noakes

David Unwin

Jeffry Gerber

Ted Naiman

Ivor Cummins

Dave Feldman




Ketogeeninen ruokavalio ja terveys

Korkea verenpaine on huonojen ravitsemustottumusten jälkeen toiseksi yleisin sairastumisen riskiä lisäävä tekijä, kertoo David J. Unwin (lue tutkimus tästä). Unwin on vuoden 2012 jälkeen hoitanut lihavia, korkeaa verenpainetta ja aikuistyypin diabetesta sairastavia potilaita ketogeenisellä ruokavaliolla. Tulokset ovat olleet hyviä.  Ketogeeninen ruokavalio ja terveys on laaja katsaus ketoilun positiivisiin terveysvaikutuksiin.

Kymmenet lääkärit ympäri maailman suosittelevat ketogeenistä ruokavaliota laihduttamiseen ja kardiometabolisten sairauksien hoitoon.

Uuden ravitsemusmallin omaksumisen vaikeus on siinä, että kasvavasta tutkimusnäytöstä ja parantuneista potilaista huolimatta ketogeeninen ruokavalio ei sovi nykyisiin ravitsemusmalleihin. Se haastaa vuosikymmeniä vallalla olleet ravitsemusopit ja lääketieteen paradigmat.

Ketogeeninen ruokavalio olettaa, että tyydyttyneisiin rasvoihin perustuva energiansaanti laihduttaa ja pitää kehon terveenä. Se sotii kaikkea oppimaamme vastaan.

Tieteen itseään korjaava periaate sopii huonosti ravitsemustieteen institutionalisoituihin dogmeihin. Jos tutkimukset antavat tuloksia, jotka eivät tue vallalla olevia käsityksiä, vanhoja oppeja pitää korjata vastaamaan uusia havaintoja.

Onko ketoilu vaarallista, koska siinä syödään paljon rasvaa?

Oppi rasvojen terveyshaitoista on rakennettu tieteellisesti hataralle perustalle. Rasvojen yhteys sydän- ja verisuonitauteihin on tieteellisesti kyseenalaistettu, mutta tämän paradigman asema ravitsemustieteessä on horjumaton.

Laajan kohorttitutkimusten meta-analyysin mukaan tyydyttyneet rasvat eivät lisää sydän- ja verisuonitautien riskiä.

” This current meta-analysis of cohort studies suggested that total fat, SFA, MUFA, and PUFA intake were not associated with the risk of cardiovascular disease. However, we found that higher TFA intake is associated with greater risk of CVDs in a dose-response fashion. Furthermore, the subgroup analysis found a cardio-protective effect of PUFA in studies followed up for more than 10 years.” Lue meta-analyysi tästä!

Olen laihtunut ketogeenisellä ruokavaliolla kolmessa kuukaudessa 9-10 kiloa. Ruokavalioni perusravinne on rasva, jota syön valtavasti virallisiin saantisuosituksiin nähden.  Verensokerini on hyvä 4,5-5,5. Verenpaineet ovat keskimäärin 135/85/80 -tasolla, mutta vaihteluväli on +/-10 suuntaansa.

Laihtuminen on ollut käsittämättömän helppoa, ja oloni on säilynyt koko ajan energisenä. Tältä osin uskallan suositella ruokavaliota muillekin. Tässä esiin tulevat lääketieteelliset havainnot ja väitteet perustuvat useisiin lähteisiin, joihin viittaan tekstissä ja tekstin jälkeen.

Kardiometabolinen syndrooma (CMS)

Kardiometaboliseen syndroomaan (CMS) sisältyy joukko aineenvaihduntaan, verenkiertoon ja munuaisiin assosioituvia häiriöitä. Yhteisiä nimittäjiä kardiometabolisille sairauksille ovat viskeraalinen rasva, keskivartalolihavuus ja insuliiniresistenssi.

Keskivartalolihavuuteen liittyy usein insuliinin heikompi vaikutus ääreiskudoksissa ja/tai seerumin korkea insuliinipitoisuus.

CMS:n oireisiin kuuluvat mm. korkea verenpaine, poikkeavuudet verenpaineen ja sykkeen vuorokausivaihtelussa, diabetekseen viittaavat rasva- ja sokeriaineenvaihdunnan muutokset, aikuistyypin diabetes, alkoholista riippumaton rasvamaksa, lisääntynyt verenhyytymistaipumus, kihti sekä sydän- ja verenkiertoelinten lisääntynyt tulehdusriski.

Epidemiologisissa tutkimuksissa on havaittu, että kardiometabolinen oireyhtymä kasvattaa sepelvaltimotauti-, aivohalvaus-, sydän- ja verisuonitautikuolleisuus- ja kokonaiskuolleisuus-riskejä.

Rohkeimpien lääkäreiden ja ketogeenisen ruokavalion puolestapuhujien, kuten Joseph R. Kraftin ja Ted Naimanin mukaan useimmat sydän- ja verisuonitaudit assosioituvat diagnosoituun tai diagnosoimattomaan diabetekseen. Tämä näkemys sopii hyvin havaintoon, että diabeetikoiden sydän- ja verisuonitautikuolleisuus on hyvin korkea.

Diabeteksen laboratoriodiagnoosin kehitykseen 1970-luvulla osallistuneen tri Joseph R. Kraftin mukaan hyperinsulinemia liittyy vahvasti verenpainetaudin, lihavuuden, ateroskleroosin, neurodegeneratiivisten sairauksien (Parkinsonin tauti, Alzheimerin tauti), eräiden syöpien ja verisuonitautien kehittymiseen.

Kardiometabolinen oireyhtymä ja kardiometaboliset sairaudet yleistyvät vauhdilla. Kraft varoitti diabetesepidemiasta ja hyperinsulinemiaan assosioituvista sairauksista jo 1970-luvulla.

Yhteinen nimittäjä kardiometabolisille sairauksille on samanaikainen insuliiniresistenssin aiheuttama hyperinsulinemia. Paikallinen insuliiniresistenssi ei yksistään yleensä aiheuta sairauksia, sillä aineenvaihdunta turvautuu siihen joskus tarkoituksella. Insuliiniresistenssi ja korkeat insuliinitasot yhdessä ovat vakava uhka terveydelle.

Lihavien prosentuaalinen osuus väestöstä Euroopassa

Synkkiä lukuja

Monet sairastuvat, vaikka he liikkuvat ja noudattavat yleisiä ravitsemussuosituksia. Länsimaissa on maailman paras sairaanhoitojärjestelmä, mutta samanaikaisesti todella sairas väestö.

Ylipainoisten ja lihavien määrä on Maailman terveysjärjestön (WHO) mukaan kolminkertaistunut vuoden 1975 jälkeen.

Kiinassa lihavia on 5-6 prosenttia väestöstä, mutta suurissa kiinalaiskaupungeissa, joissa syödään eniten pikaruokaa, lihavien osuus on lyhyessä ajassa kasvanut yli 20 prosenttiin; ylipainoisten ja lihavien kiinalaisten määrä on vain 10 viime vuoden aikana kolminkertaistunut. Keskivartalolihavien kiinalaisten määrä on samana aikana lisääntynyt 50 prosenttia.

Amerikkalaisista 35,4 prosenttia on lihavia, 61,5 % vyötärölihavia. Noin 100 miljoonaa amerikkalaista sairastaa tyypin 2 diabetesta tai esidiabetesta. Euroopan unionin alueella 30-70 % ihmisistä on jo ylipainoisia ja 10-30 % lihavia. EU:ssa lähes 30 miljoonaa ihmistä sairastaa diabetesta. Koko Euroopan (56 valtiota) alueella diabetesta sairastaa noin 60 miljoonaa ihmistä.

Diabetes

Aikuistyypin diabetesta sairastavien määrä on kasvanut noin 108 miljoonasta (1980) 422 miljoonaan (2014). Prosentuaalisesti maailman väestössä diabeteksen esiintyvyys on kasvanut 4,3 prosentista 8,8 prosenttiin neljässä vuosikymmenessä. Kasvun uskotaan jatkuvan. Nykyisen trendin perusteella vuonna 2045 joka kymmenes maailman ihminen sairastaa diabetesta.

Diabetesta sairastavien lisäksi jopa 352 miljoonan ihmisen glukoosin sieto on heikentynyt ja he sairastavat esidiabetesta. Mikä tällaisen selittää ja pitääkö tästä huolestua?

Minun mielestäni pitää huolestua. Diabetes yleistyy nopeimmin pieni- ja keskituloisten parissa, mutta se yleistyy myös muissa sosioekonomisissa väestöryhmissä. Diabetes on tärkein sokeutta, munuaisvaurioita, sydänkohtauksia ja alaraajojen amputaatioita aiheuttava sairaus.

Vuonna 2016 1,6 miljoonaa ihmistä menehtyi diabeteksen seurauksena ja näiden lisäksi 2,2 miljoonaa kuolemantapausta assosioitui vahvasti korkeaan verensokeriin (WHO).

IDF:n tilastojen mukaan diabetes ja siihen liittyvät komplikaatiot tappavat vuosittain noin 4 miljoonaa ihmistä. Tilastollisesti yksi ihminen kuolee diabeteksen seurauksena seitsemän sekunnin välein. Inhimillisen kärsimyksen lisäksi tyypin 2 diabetes tulee yhteiskunnille mahdottoman kalliiksi.

”The figures given in the IDF Atlas fit well with the estimates of an international consortium reporting worldwide trends in diabetes since 1980 based on a pooled analysis of 751 population-based studies with 4·4 million participants. According to this group global age-standardised diabetes prevalence increased from 4.3% (95% CI 2.4-7.0) in 1980 to 9.0% (7.2-11.1) in 2014 in men, and from 5.0% (2.9-7.9) to 7.9% (6.4-9.7) in women.”

Syitä diabetesepidemialle voidaan etsiä esimerkiksi vähentyneestä arkiliikunnasta, väestön lisääntymisestä ja ihmisten odotettavissa olevan elinajan kasvusta. Nämä eivät kuitenkaan selitä nykyistä diabetesepidemiaa riittävän hyvin, sillä miljoonat raskasta fyysistä työtä tekevät ja ravintosuosituksia noudattavat lihovat ja sairastuvat diabetekseen.

Eräs tärkeimmistä diabeteksen kasvua selittävistä tekijöistä on keskivartalolihavuuden nopea lisääntyminen lähes kaikissa sosioekonomisissa ryhmissä ympäri maailman.

Mistä tiedän, onko minulla diabetes?

Terveellä ihmisellä paaston jälkeinen plasman sokeri on 6 mmol/l tai vähemmän. Kahden tunnin sokerirasituksessa terveen ihmisen verensokeri pysyy alle 7,8 mmol/l.

Kun paastoverinäytteestä mitataan sokeria 6,1–6,9 mmol/l, kyseessä on kohonnut paastoplasman sokeri eli heikentynyt paastosokeri (IFG, impaired fasting glucose).

Heikentynyt sokerinsieto (IGT, impaired glucose tolerance) todetaan, kun verensokeripitoisuus on 7,8–11 mmol/l sokerirasituskokeessa 2 tunnin kohdalla tai 2 tuntia aterian jälkeen.

Tutkimuksessa ketogeeninen ruokavalio oli perinteistä vähärasvaista diabetesruokavaliota parempi:

”Individuals with type 2 diabetes improved their glycemic control and lost more weight after being randomized to a very low-carbohydrate ketogenic diet and lifestyle online program rather than a conventional, low-fat diabetes diet online program. Thus, the online delivery of these very low-carbohydrate ketogenic diet and lifestyle recommendations may allow them to have a wider reach in the successful self-management of type 2 diabetes.”

Hyvä uutinen on se, että tyypin 2 diabetes ei ole krooninen sairaus. Se on voitettavissa! Tyypin 2 diabetes voidaan hoitaa esimerkiksi vähäkalorisella tai ketogeenisellä ruokavaliolla. Näistä jälkimmäinen on tutkimusten perusteella parempi.

”A literature search was performed, and a total of 99 original articles containing information pertaining to diabetes reversal or remission were included. Results: Evidence exists that T2D reversal is achievable using bariatric surgery, low-calorie diets (LCD), or carbohydrate restriction (LC).” Lue tästä!

Lihavien määrän kasvu eri väestöissä

Pitääkö klassinen ruokapyramidi kaataa?

Perinteiset lautasmallit ja ravintopyramidit eivät selvästikään suojele meitä lihomiselta ja sairastumiselta. Sairaudet yleistyvät, vaikka ihmiset noudattavat suosituksia, liikkuvat ja lääketiede kehittyy. Missä vika?

Eräs perinteisen ravintopyramidin kaatajista on professori Tim Noakes, joka on elämänsä aikana juossut kymmeniä maratoneja ja ultramaratoneja. Noakes kirjoitti uransa alussa vähärasvaiseen ja runsaasti hiilihydraatteja sisältävään ruokavalioon kannustavia kirjoja.

Noakes käänsi oman ravitsemuksensa ylösalaisin sairastuttuaan aikuistyypin diabetekseen. Hän sairastui, vaikka vältteli rasvoja, liikkui hyvin aktiivisesti ja söi virallisten suositusten mukaisesti. Vallalla olevan mallin mukaan maailman ”timnoakesien” ei pitäisi lihoa tai sairastua aikuistyypin diabetekseen, mutta monet maailman ”timnoakesit” sairastuvat.

Tohtori David Unwin kertoo, että vuonna 1986 hänen vastaanotollaan kävi 57 aikuistyypin diabetesta sairastavaa. Tauti oli tuohon aikaan vielä melko harvinainen ja siihen sairastuivat lähinnä iäkkäät ihmiset. Vuonna 2012 samalla vastaanotolla tyypin 2 diabeetikkoja oli jo 472.


Insuliini on anabolinen hormoni

Verenpainetauti, lihavuus, dyslipidemia ja glukoosi-intoleranssi assosioituvat hyperinsulinemiaan. Oirekirjo tunnetaan metabolisena oireyhtymänä. Hyperinsulinemia vaikuttaa verenpaineeseen lisäämällä munuaisten natriumretentiota (natriumin säilytystä).

Insuliini on aminohapoista muodostuva hormoni. Hormonit ovat elimistön valmistamia endogeenisiä viestinvälittäjämolekyylejä, jotka kulkevat erittymispaikasta kohdesoluihin pääosin verenkierron välityksellä. Hormoni voi vaikuttaa pieninäkin määrinä soluun, jossa on hormonille spesifisiä reseptoreja.

Eri puolilla elimistöä sijaitsevat umpirauhaset erittävät hormoneja aivolisäkkeen ja hypotalamuksen säätelemänä. Insuliinin eritystä ohjaa veren sokeripitoisuus. Glukoosi aiheuttaa piikin insuliinin erityksessä. Proteiinit ja rasvat vaikuttavat insuliinin eritykseen paljon sokereita maltillisemmin.


Mitä hormonit ovat?

Hormonit, jotka voivat olla joko vesiliukoisia (katekoliamiinit, glukagoni ja insuliini) tai rasvaliukoisia (D-vitamiini, steroidit ja kilpirauhashormonit) säätelevät lähes kaikkia elimistön aineenvaihduntaprosesseja. Ne ovat aminohappo-, rasvahappo-, proteiini- ja peptidihormoneja tai steroideja.

Aminohappoyhdisteistä muodostuneet hormonit muodostuvat tyrosiinista ja tryptofaanista. näihin hormoneihin kuuluvat kilpirauhasen erittämät kilpirauhashormonit ja lisämunuaisytimen erittämät katekoliamiinit.

Solukalvojen fosfolipidi arakidonihappo toimii rasvahappoyhdisteisten hormonien lähtöaineena. Tällaisia ovat mm. eikosanoidit (esimerkiksi postglandiinit, tromoksiaanit ja leukotrieenit).

Proteiini- ja peptidihormonit ovat muodostuneet muutamista tai jopa sadoista aminohapoista. Tällaisia ovat esimerkiksi vasopressiini ja tyreoliberiini.

Proteiinihormoneja ovat mm. insuliini ja kasvuhormoni. Proteiinihormoneja, joihin on liittyneenä hiilihydraattiryhmä, kutsutaan glykoproteiineiksi. Glykoproteiineja ovat esimerkiksi follikkelia stimuloiva hormoni ja luteinisoiva hormoni. Steroidihormonien lähtöaineena toimii kolesteroli.

Insuliini ja insuliiniresistenssi

Terve aineenvaihdunta reagoi ruokailun kohottamaan verensokeriin erittämällä insuliinia haiman Langerhansin saarekkeiden β-soluista. Insuliinimolekyylit kulkeutuvat verenkierron mukana soluihin ja kiinnittyvät kudosten insuliiniherkkien solujen insuliinireseptoreihin.

Insuliinireseptoriin kiinnittynyt insuliinimolekyyli ”kutsuu” solukalvon läpäisevän kanavan, jota pitkin glukoosimolekyyli pääsee sujahtamaan solun sytoplasmaan.

Insuliini vaikuttaa insuliiniherkkiin kudoksiin, kuten lihas- ja rasvasoluihin sekä maksan soluihin. Sillä on merkittävä tehtävä kehon energiataloudessa ja erityisesti sokeriaineenvaihdunnassa, koska insuliini lisää insuliiniherkissä kudoksissa glukoosin, aminohappojen ja rasvahappojen soluun ottoa. Insuliiniresistenssi vaikuttaa ensimmäiseksi lihassoluihin, joten rasvasolujen energian varastoiminen lisääntyy.

Normaalisti insuliinin eritys vähenee verensokerin laskiessa. Terveillä verensokeri pysyy noin 5 mmol /l (90 mg /dl) -tuntumassa. Esidiabeteksessa sokeritasot kohoavat lähelle 7 mmol /l -tasoa. Diabetekseen sairastuneilla yön yli paaston jälkeen mitattu verensokeri on toistuvasti 7,0 mmol/l tai sitä korkeampi. Normaalin verensokerin yläraja on 6,0 mmol/l.

Insuliini on kehon energiatalouden kapellimestari. Se ohjaa ravinteiden käyttöä energian tuotantoon tai varastoimiseen solujen kylläisyysasteen mukaisesti.

Insuliinipitoisuuden laskiessa glukagoni purkaa insuliinin rakentamia energiavarastoja maksan ja lihasten glykogeeneistä. Näiden hormonien pitoisuus veressä vaihtelee jatkuvasti. Välillä glukoosia puretaan glukagonin aktivoimana glykogeeneistä ja välillä glykogeeni- ja rasvavarastoja kootaan insuliinin avulla.

Insuliiniresistentillä henkilöllä insuliini ei laske verensokeria halutulla tavalla. Rasva- ja lihassolut, tarvitsevat insuliinia glukoosin sisäänottoon. Kun nämä solut eivät reagoi insuliiniin, verensokeri nousee.

Pitkään jatkuvalla korkealla verensokerilla on monia haitallisia terveysvaikutuksia: se mm. heikentää verisuonia.  Aterioiden välillä insuliinitasot laskevat. Insuliinin laskun vaikutuksesta haiman alfasolut erittävät vereen glukagonia. Tämä insuliinin vastavaikuttaja aktivoi sokerivarastojen purkamisen maksasta vereen ja lihaksista lihasten omaan käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.

Rasvasolujen insuliiniresistenssissä verenkierrossa olevien lipidien imeytyminen heikkenee ja varastoituneiden triglyseridien hydrolyysi kiihtyy. Tämä lisää vapaiden rasvahappojen määrää veriplasmassa ja voi edelleen pahentaa insuliiniresistenssiä.

Hyperinsulinemia


Lisääntynyt viskeraalinen rasva erittää tulehdusta aiheuttavia sytokiinejä vereen, ja nämä vaikuttavat insuliinireseptorien toimintaa heikentävästi.

Hyperinsulinemia

Insuliiniresistenssi voi johtaa hyperinsulinemiaan, eli tilaan, jossa veressä on aivan liikaa insuliinia. Rasvasolujen insuliinisensitiivisyys säilyy pisimpään, minkä vuoksi veren glukoosia varastoidaan rasvasoluihin.

Insuliiniresistenssin vaikutuksesta lihasten toiminta heikkenee, sillä lihassolujen glukoosinsaanti vähenee. Samalla insuliinin vaikutuksesta rasvakudoksen rakentaminen tehostuu ja ihminen lihoo.

Koska insuliini on ensisijainen hormonaalinen signaali energian varastoimiselle insuliiniherkkiin rasvasoluihin, se stimuloi uuden rasvakudoksen muodostumista ja kiihdyttää painonnousua.

Insuliiniresistenssi lisää haiman beetasolujen insuliinin tuotantoa. Tämä nostaa veren insuliinitasoja (hyperinsulinemia) korkean verensokerin kompensoimiseksi.

Kompensoidun insuliiniresistenssivaiheen aikana insuliinitasot kasvavat, mutta verenkierron lisääntynyt insuliini ei kuitenkaan laske verensokeria.

Jos lisääntynyttä verensokeria kompensoiva insuliinieritys epäonnistuu laskemaan verensokeria, paastoglukoosi ja aterianjälkeinen glukoosi näkyvät mittauksissa kohonneina glukoosipitoisuuksina. Normaali glukoosipitoisuus pysyy aina 5 mml/l tuntumassa. Esidiabeteksessa verensokeritasot ovat 6,0-6,9 mml/l ja diabeteksessa yli 7 mml/l. Heikentynyt insuliinisensitiivisyys eli insuliiniresistenssi vaikuttaa näin tyypin 2 diabeteksen kehittymiseen.

Insuliiniherkät rasvasolut maksassa ja haimassa säilyttävät insuliinisensitiivisyyden lihassoluja pidempään. Tämän vuoksi insuliini kompensoi kohonnutta verensokeria ohjaamalla glukoosia rasvasoluihin, jossa glukoosi de novo lipogeneesissä muutetaan triglyserideiksi.

Tämä lisää myös maksan ja haiman rasvoittumista. Maksan rasvoittuminen lisää alkoholista riippumattoman rasvamaksan riskiä, mutta sitä suurempi ongelma insuliiniresistenssin ja aikuistyypin diabeteksen kannalta on haiman rasvoittuminen, sillä se heikentää entisestään insuliinintuotantoa, kunnes lopulta beetasolujen toiminta lakkaa kokonaan.

Insuliiniresistenssi assosioituu vahvasti ihmisiin, joilla on runsaasti viskeraalista keskivartaloläskiä, verenpainetauti, hyperglykemia, dyslipidemia, kohonneet triglyseriditasot, kohonnut hyvin pienten matalan tiheyden lipoproteiinien (sdLDL) tasot ja pienentyneet HDL-tasot.

Viskeraalinen keskivartalorasva assosioituu tutkimusten perusteella vahvasti insuliiniresistenssiin kahdella tavalla:

Ensinnäkin toisin kuin ihonalainen rasvakudos, viskeraalinen rasva tuottaa tulehduksellisia sytokiinejä, kuten tuumorinekroositekijä-alfa (TNF-a), interleukiini-1 ja interleukiini-6. Monissa kokeissa on osoitettu, että nämä proinflammatoriset, eli tulehdusta edistävät sytokiinit, hajottavat insuliinia tai estävät insuliinin normaalia toimintaa. Suuri osa tulehduksellisten sytokiinien tuotannosta on keskittynyt IKK-beeta / NF-kappa-B-reitille, proteiiniverkolle, joka tehostaa insuliiniresistenssiä vaikuttamalla tulehduksellisten markkerien ja välittäjien transkriptioon.

Toisaalta viskeraalinen rasva vaikuttaa myös rasvan kerääntymiseen maksaan, mikä aiheuttaa alkoholista riippumattoman rasvamaksan kehittymistä (NAFLD). Tämän seurauksena verenkiertoon vapautuu liikaa vapaita rasvahappoja lisääntyneen lipolyysin seurauksena. Edelleen NAFLD:n seurauksena maksan glykogenolyysi (glykogeenien pilkkominen glukoosiksi) ja maksan glukoosin tuotanto kiihtyvät, mikä pahentaa perifeeristä insuliiniresistenssiä ja kasvattaa tyypin 2 diabeteksen riskiä.

Insuliiniresistenssiin liittyy usein myös hyperkoaguloituva tila (heikentynyt fibrinolyysi) ja lisääntyneet tulehdukselliset sytokiinitasot.

Molekyylitasolla

Molekyylitasolla solu havaitsee insuliinin insuliinireseptoreiden välityksellä signaalin kulkiessa signalointikaskadin läpi. Tämä tunnetaan nimellä PI3K / Akt / mTOR signalointireitti.

Tuoreet tutkimukset viittaavat siihen, että tämä signalointireitti voi toimia fysiologisista olosuhteista riippuvaisena kaksisuuntaisena eli bistabiilina kytkimenä tietyntyyppisille soluille, jossa insuliinivaste voi olla kynnysilmiö.

Tämän signalointireitin herkkyys insuliinille voi heikentyä monien tekijöiden, kuten vapaiden rasvahappojen aiheuttaman insuliiniresistenssin seurauksena. Laajemmasta näkökulmasta herkkyyden virittäminen (tai herkkyyden vähentäminen) on organismin normaali tapa sopeutua muuttuvan ympäristön tai aineenvaihdunnan olosuhteisiin. Eli insuliiniresistenssi voi joissain tilanteissa olla elimistön kannalta toivottava tila.

Esimerkiksi raskaus muuttaa odottavan äidin aineenvaihduntaa. Odottavan äidin elimistön on vähennettävä lihaksiensa insuliiniherkkyyttä varatakseen enemmän glukoosia aivan erityisesti sikiön aivojen kehitykselle. Tämä voidaan saavuttaa siirtämällä insuliinin vastekynnystä, eli herkkyyttä erittämällä vereen istukan kasvutekijää, joka estää insuliinireseptorisubstraatin (IRS) ja PI3K:n vuorovaikutusta. Tämä on ns. säädettävän kynnyshypoteesin ydin.

Insuliiniresistenssi superoksidaasidismutaasi

Insuliiniresistenssi voi olla lisääntyneen ravinnonsaannin aiheuttama solutason reaktio. Ylimääräinen energiansaanti vaikuttaa solujen mitokondrioissa superoksidaasidismutaasin toimintaan.

Superoksidisdaasimutaasi on yksi tärkeimmistä antioksidanteista. Tällaisesta molekyylitason vaikutuksesta on viitteitä erilaisissa insuliiniresistenssistä tehdyissä havainnoissa. Kokeissa on havaittu myös, että insuliiniresistenssi voidaan kääntää nopeasti altistamalla solut esimerkiksi elektronin kuljetusketjun estäjille tai mitokondrioiden superoksididismutaasia jäljitteleville aineille.

Superoksidaasidismutaasi

Insuliiniresistenssi on yhteydessä verenpaineeseen. Nakamura tutkijakollegoineen. osoitti insuliiniresistenteillä jyrsijöillä ja ihmisillä, että vaikka insuliinin stimuloiva vaikutus adiposyyttien glukoosin imeytymisen insuliinireseptorisubstraatin 1 (IRS1) välityksellä heikentyi voimakkaasti, IRS2 välittämä vaikutus suolan imeytymiseen munuaisten proksimaaliseen tubulukseen, säilyi.

Kompensoiva hyperinsulinemia yksilöillä, joilla on insuliiniresistenssi, voi lisätä natriumin kerääntymistä proksimaaliseen tubulukseen, mikä johtaa natriumin ylikuormitukseen ja verenpaineen kohoamiseen.

Superoksidaasidismutaasi (SOD3) on useimmissa kudoksissa esiintyvä antioksidanttientsyymi, joka muuttaa haitallista superoksidia vähemmän haitalliseksi vetyperoksidiksi. Sekin on reaktiivinen happiyhdiste, mutta se toimii myös solujen viestinnässä viestinvälitysmolekyylinä. SOD3 saattaa siis osallistua solujen viestintään.

FM, PhD Lilja Laatikainen selvitti väitöstutkimuksessaan, kuinka solunulkoinen superoksididismutaasi-entsyymi suojaa kudoksia tulehdusreaktion aiheuttamilta vaurioilta. Tutkimus osoitti, että kudokseen virusvektorin avulla siirretty SOD3 estää tulehdussolujen, erityisesti makrofagien, kulkeutumisen vaurioituneeseen kohtaan.

Mekanismi on Laatikaisen tutkimuksen perusteella tulehdussolujen tarvitsemien tarttumismolekyylien ja tulehdusta edistävien sytokiinien tuoton vähentäminen estämällä keskeisen NF-kappa-B-molekyylin toimintaa. Tämän lisäksi SOD3 voimisti viestien välitystä Erk- ja Akt-signalointireiteillä, jotka edistävät solujen eloonjääntiä stressitilanteissa, ja vastaavasti vähensi solukuolemaan johtavien tekijöiden ilmentymistä, vähensi kudosvaurion laajuutta ja nopeutti kudoksen paranemista.

Insuliiniresistenssi tai heikentynyt insuliiniherkkyys on olennainen piirre aineenvaihdunnan oireyhtymässä, johon assosioituvat liikalihavuus, heikentynyt glukoosin sieto, dyslipidemia ja verenpaine. Dyslipidemialla tarkoitetaan rasva-aineenvaihdunnan häiriötä, jossa jokin veren rasva-arvoista (LDL, HDL, triglyseridit) ei vastaa suosituksia. Dyslipidemiasta puhutaan, jos seerumin LDL on yli 3 mmol litrassa, triglyseridipitoisuus yli 2 mmol/l tai HDL-pitoisuus alle 1mmol/l.

Insuliinin toiminta

Heikentynyt insuliiniherkkyys johtaa kompensoivaan hyperinsulinemiaan normaalin verensokerin ylläpitämiseksi. Insuliiniresistenssi voi olla toissijainen vaste insuliinireseptorin (IR) ja telakointiproteiinien, kuten insuliinireseptorisubstraattien (IRS) vaimennussäätelyä tai inaktivaatiota ohjaavalle signaloinnille.

Insuliinilla on tärkeä tehtävä verensokerin säätelyssä, sillä se stimuloi glukoosin kuljetusta rasvasolujen ja luurankolihasten kudosten läpi insuliinireseptorisubstraattien aktivaation jälkeen.

Insuliini stimuloi glukoosin kuljettajien (GLUT) siirtämistä solunsisäisistä kalvo-osastoista plasmakalvoon lisäämällä sokerin imeytymistä. Rasva- ja luurankolihaskudoksissa vaikuttaa useita glukoosin kuljetusmolekyylejä, mutta havaintojen perusteella GLUT4 on glukoosin solukalvojen läpi kuljettamisen kannalta tärkein kuljetusmolekyyli.

Insuliini sitoutuu ja aktivoi insuliinireseptori-tyrosiinikinaasia (IR), mikä johtaa IRS1:n, IRS2:n, IRS3:n ja IRS4:n fosforylaatioon. Sitoutumalla signalointipartnereiden, kuten fosfoinositidi-3-kinaasin (PI3K) kanssa insuliini aktivoi Akt/proteiinikinaasi B- ja proteiinikinaasi C-ζ -kaskadit, joilla on tärkeä tehtävä insuliinin toiminnassa.

IRS-alatyypit jakautuvat kudosspesifisesti, ja niillä on selkeät signalointikanavat. IRS1 välittää insuliinin vaikutusta glukoosin imeytymiseen rasvasoluissa ja luurankolihaksissa. IRS2 toimii ensisijaisesti välittäen insuliinin vaikutusta munuaistiehyihin.

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssi ja verenpaine

Insuliiniresistenssin ja verenpaineen välinen yhteys on joko kahden itsenäisen prosessin yhteys, joka ei ole ainakaan suoraan yhteydessä verenpaineeseen, tai syy-seuraussuhde, jossa insuliiniresistenssi aiheuttaa kohonneen verenpaineen.

Jos insuliiniresistenssi ei aiheuta kohonnutta verenpainetta, insuliiniresistenssi ja kohonnut verenpaine voivat olla saman soluhäiriön toisiinsa liittymättömiä seurauksia. Eli kyse voi olla solunsisäisen vapaan kalsiumin määrän lisääntymisestä, mikä johtaa verisuonten supistumiseen ja insuliinin heikentyneeseen toimintaan.

Insuliiniresistenssi on toisaalta myös moniin verenpaineen kohoamista aiheuttaviin aineenvaihdunnan poikkeamiin assosioituva molekyylimarkkeri.

Toinen vaihtoehto on, että hyperinsulinemia vaikuttaa verenpainetaudin syntyyn, lisäämällä natriumin imeytymistä munuaisiin, aktivoimalla sympaattista hermostoa ja muuttamalla verisuonten resistenssiä.

Kudoksen heikentynyt insuliiniherkkyys on yhteinen nimittäjä useille sairauksille, kuten metabolinen oireyhtymä, keskivartalolihavuus, hyperglykemia, dyslipidemia, hypertensio ja insuliiniresistenssi. Vaikka insuliiniresistenssin osuutta hyperglykemian ja dyslipidemian osalta on tutkittu, insuliiniresistenssin merkityksestä verenpainetaudin patogeneesissä tiedetään vähemmän kuin insuliiniresistenssin merkityksestä metabolisen oireyhtymän ja tyypin 2 diabeteksen sekä lihavuuden synnyssä.

Miten Suomessa?

Diabetesliiton mukaan Suomessa vajaat puoli miljoonaa ihmistä sairastaa aikuistyypin diabetesta. Arviolta 100 000 sairastaa diabetesta tietämättään. Joka vuosi yli 20 000 suomalaista sairastuu tyypin 2 diabetekseen.

Diabetes on suurin yksittäinen valtimotautien, aivoverenkiertohäiriöiden ja alaraaja-amputaatioiden syy. Se lisää myös munuais- ja silmäsairauksia. Suomessa diabeteksen hoitokustannuksiin kuluu ihan helvetisti rahaa. Diabeteksen hoitoon käytetään 15 % terveydenhuollon menoista.

FinTerveys 2017 -tutkimuksen mukaan yli 30-vuotiaista miehistä 72 % ja naisista 63 % oli vähintään ylipainoisia. Miehistä 26 % ja naisista 28 % oli lihavia. Melkein puolet suomalaisista on vyötärölihavia.

Jo noin puoli miljoonaa ihmistä käyttää verenpainelääkkeitä. Tuhansilla verenpaineet ovat jatkuvasti riskirajoilla.  

Ketogeeninen ruokavalio toimii painonhallinnassa, pitää verensokerin tasaisena ympäri vuorokauden ja laskee tutkitusti verenpainetta. Voisiko ketogeeninen ruokavalio auttaa verenpaineen, painon ja huonojen lipidiprofiilien kanssa kamppailevia myös Suomessa?

Miksi ketoilu laskee verenpainetta?

David J. Unwin kertoo hiljattain tehdystä pilottitutkimuksesta, jossa tutkijat havaitsivat, että hyvin vähän hiilihydraatteja sisältävään ruokavalioon assosioitui merkittäviä verenpaineen, painon ja lipidiprofiilien paranemista, minkä vuoksi potilaiden lääkitystä voitiin tutkimuksen aikana vähentää.

Kysymys on: Voidaanko samanlaisia positiivisia terveyshyötyjä saada laajemmassa tutkimuksessa? Unwin tutkijaryhmineen rekrytoi perusterveydenhuollon seurantatutkimukseen 154 potilasta, jotka sairastivat aikuistyypin diabetesta, tai joilla sokerin sietokyky oli merkittävästi heikentynyt.

Vähähiilihydraattisen ruokavalion vaikutuksia sydämen ja verisuonitautien riskitekijöihin tutkittiin keskimäärin kaksi vuotta. Seurattujen potilaiden verenpaine laski merkittävästi LCHF-ruokavaliolla:

* Systolinen verenpaine laski keskimäärin 10,9 mmHg
*Diastolinen verenpaine laski keskimääräinen 6,3 mmHg
*Tutkimukseen osallistuneiden potilaiden paino laski keskimäärin 9,5 kg    *lipidiprofiilit paranivat selvästi

Tutkimuksen aikana potilaiden verenpainelääkitystä vähennettiin 20 prosentilla.  Kansallinen terveydenhuollon huippuosaamisinstituutti (National Institute for Health and Care Excellence – NICE) määrittelee kohonneen verenpaineen riskirajaksi 140/90 mmHg ja sitä korkeammat tulokset. Kotioloissa mitatut päivittäiset verenpaineen keskiarvot, jotka ovat vähintään135/85 mmHg ovat korkean verenpaineen riskirajoilla. Ymmärtääkseni näitä arvoja noudatetaan myös suomalaisessa terveydenhuollossa.

Hiljattain julkaistun tutkimuksen (lue tästä) mukaan huonojen ravitsemustottumusten jälkeen korkea verenpaine on globaalisti merkittävin sairastumisen riskitekijä.

Isossa-Britanniassa korkea verenpaine on tupakoinnin ja huonojen ravitsemustottumusten jälkeen kolmanneksi merkittävin sairastumiselle altistava riskitekijä.

Usein korkean verenpaineen syy voi johtua esimerkiksi ylipainosta, tupakoinnista, runsaasta suolan käytöstä tai perinnöllisistä tekijöistä, mutta toisinaan kohonneelle verenpaineelle ei löydetä mitään suoraa kausaalista syytä. Tällöin puhutaan essentiaalisesta hypertensiosta. Se on viisaalta kuulostava diagnoosi, joka kertoo, että syytä kohonneelle verenpaineelle ei tiedetä.

Tutkijat laativat vuonna 2013 ohjeita vähähiilihydraattisen ruokavalion (vähemmän kuin 130 g hiilihydraattia / päivä) hoitosuosituksia tyypin 2 diabeteksen. 19 potilaan pilottitutkimuksen potilaat sairastivat aikuistyypin diabetesta tai heidän sokerinsietokykynsä (IGT) oli merkittävästi heikentynyt. Kahdeksan kuukauden tutkimuksen hämmästyttävimmät seuraukset olivat potilaiden verenpaineen merkittävä parantuminen.  è systolinen 148 ± 17–133 ± 15 mmHg, p <0,005 è diastolinen 91 ± 8–83 ± 11 mmHg, p <0,05).  Koehenkilöiden verenpaineet laskivat huolimatta verenpainelääkkeiden käytön lopettamisesta.

Hypoteesi vuoden 2013 pilottitutkimuksen tuloksille oli, että vähähiilihydraattiset ruokavaliot voivat toimia diabeteksen ja painonhallinnan hoidossa perinteisiä hoitomuotoja paremmin. Aluksi hypoteesi herätti lääketieteellisessä yhteisössä runsaasti kritiikkiä ja epäilyjä, mutta sittemmin ketogeeninen ruokavalio on laajemmin hyväksytty osaksi aikuistyypin diabeteksen hoitoa. (Lue tästä ja tästä).

Hiilihydraattien vähentämisen vaikutukset insuliinin aktiivisuuteen ja metabolisen oireyhtymän oireiden hoitoon osoitettiin jo vuonna 2005 (lue tutkimus). Lisätyn sokerin lisäksi kaikkien ravinnon glukoosilähteiden, kuten leivän, perunan, viljan ja riisin rajoittaminen vähentää insuliinin eritystä ja parantaa insuliiniherkkyyttä.

Metabolinen oireyhtymä, korkea verenpaine DB2, keskivartalolihavuus, dyslipidemia ja alkoholista riippumaton rasvamaksa (NAFLD) ovat vain jäävuoren huippu. Kaikki nämä sairaudet palautuvat pinnan alla vaanivaan insuliiniresistenssiin.

Vuonna 2013 valmistunut vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion ja vähärasvaisen ruokavalion pitkäaikaisia vaikutuksia selvittänyt satunnaistettujen kontrolloitujen tutkimusten (> 12 kuukauden kesto) meta-analyysi, osoitti vähän hiilihydraatteja sisältävällä ruokavaliolla selvää laskua diastolisessa verenpaineessa, mutta ei systolisessa verenpaineessa.

Samana vuonna valmistunut toinen satunnaistettu kontrolloitu tutkimus havaitsi, että sekä systolinen että diastolinen verenpaine laskivat kuuden viikon kuluttua.

Tyypin 2 diabetesta sairastavilla hyperinsulinemia lisää munuaisten natriumin pidättämistä. Samaa ei tapahdu terveillä verrokeilla. Vuonna 2017 satunnaistettujen vertailututkimusten systemaattinen katsaus ja meta-analyysi osoitti, että pienemmän glykeemisen kuorman ruokavalio laskee merkittävästi verenpainetta. (Lue tästä)

Huolimatta ketogeenisen ruokavalion hyötyjen laajemmasta hyväksynnästä, vähähiilihydraattisen ruokavalion pitkäaikaisvaikutukset herättävät yhä kysymyksiä.

Iso-Britannian diabetesyhdistyksen marraskuussa 2018 antaman lausunnon mukaan: vaikka vähän hiilihydraatteja sisältävän ruokavalion ”lyhytaikaiset” hyödyt diabetesta sairastavan painonhallintaan, parantunut glykeeminen kontrolli ja pienentynyt sydän- ja verisuonitautien riski on osoitettu, ketogeenisen ruokavalion pitkäaikaisvaikutuksista tarvitaan lisää tutkimuksia.

Tutkimus ja menetelmät

Tutkimuksessa analysoitiin retrospektiivisesti yleislääkäreiden tutkimusta varten keräämiä kliinisiä tietoja 9700 potilaasta Pohjois-Englannista.  Lääkärit ja sairaanhoitajat tarjosivat tyypin 2 diabetesta tai heikentynyttä glukoositoleranssia (IGT) sairastaville potilaille vaihtoehtoisena hoitomuotona vähän hiilihydraatteja sisältävää ruokavaliota.

Tutkimuksesta poissuljettiin: raskaana olevat, syömishäiriöiset, alipainoiset, tyypin 1 diabetesta sairastavat ja alle 18-vuotiaat. Tietoja kerättiin maliskuusta 2013 marraskuuhun 2018.

Ruokavalio-kokeeseen osallistuneille annettiin kirjalliset ohjeet ja lisätukea potilaan valinnasta ja kliinisestä tarpeesta riippuen.  Kokeeseen valikoitui monenkirjava joukko eri ikäisiä ja erilaisissa elämäntilanteissa eläviä ihmisiä.  Lääkärin ja sairaanhoitajan tapaamisten lisäksi kokeeseen osallistuville tarjottiin säännöllisiä 90 minuutin ”ryhmäistuntoja” lähes kuukausittain.

Ryhmäistuntoihin osallistui myös perheenjäseniä. Kohorttiin valikoitui 154 osallistujaa: 90 miestä ja 64 naista. Kunkin potilaan paino, verenpaine ja verenkuva tutkittiin ennen tutkimuksen alkua. 89 oli tyypin 2 diabetes. Kokeeseen osallistuvien ikähajonta oli 40-89 ja ryhmän keski-ikä 63 vuotta tutkimuksen alkaessa. Useimmat seurantaan osallistuvista olivat ylipainoisia (keskimääräinen painoindeksi 34).

Alkutiedot Lähtötason mittauksiin sisältyivät seuraavat: Paino, verenpaine, kokonaiskolesteroli, HDL-kolesteroli, paaston triglyseriditasot ja verenpainetaudit. Kaikki mittaukset kerättiin käyttämällä Yhdistyneen kuningaskunnan kansallisen terveyspalvelun standardilaitteita ja laboratorioanalyysejä.

Tutkittavia ohjeistettiin vähentämään merkittävästi ruokavalion sisältämiä piilosokereita ja tärkkelyspitoisia elintarvikkeita, kuten perunoita, leipää ja riisiä. Ohjeistuksessa käytettiin apuna tutkimusta varten kehitettyä sokeriekvivalenttijärjestelmää, joka edustaa erilaisten elintarvikkeiden glykeemistä kuormaa.

Esimerkiksi pieni viipale leipää aiheuttaa vastaavan verensokerin nousun kuin kolme teelusikallista sokeria, ja 150 g keitettyä riisiä nostaa verensokeria saman verran kuin kymmenen teelusikallista sokeria.  Sokeriekvivalenttijärjestelmän avulla potilaat ymmärsivät, että esimerkiksi maissihiutaleista, paahtoleivästä ja mehusta muodostuva aamiainen on käytännössä sokeria.

Tulokset

Kahden vuoden tutkimuksen aikana tutkittavien potilaiden verenpaine, paino ja lipidiprofiilit paranivat selvästi ketogeenisellä ruokavaliolla.

Tutkimus osoitti, että hiilihydraattien rajoittaminen on turvallinen ja tehokas tapa hoitaa tyypin 2 diabeteksen oireita.


Yhteenveto

Ketogeenisen ruokavalion vaaroja liioitellaan. Todennäköisesti näin tehdään, koska keto-dieetti ei mahdu perinteisiin oppeihin hyvästä ja terveellisestä ruokavaliosta.

Tutkimuksia ketogeenisen ruokavalion terveyshyödyistä julkaistaan kiihtyvään tahtiin ja yhä useammat lääketieteen ammattilaiset ovat ottaneet ketogeenisen ruokavalion osaksi lihavuutta, verenpainetautia, metabolista oireyhtymää, tyypin 2 diabetesta jne. sairastavien potilaiden hoitosuunnitelmaa.

Ketogeeninen ruokavalio pitää verensokerin ja veren insuliinipitoisuuden tasaisena. Korkea verensokeri ja korkea insuliini assosioituvat  kardiometabolisiin ja kroonisiin sairauksiin, kuten tyypin 2 diabetekseen. Ketogeeninen ruokavalio on paras tapa hoitaa insuliiniresistenssiä, joka on monien sairauksien perussyy. Ruokavalio hillitsee oksidatiivista stressiä ja inflammaatiota, jotka assosioituvat lukemattomiin kroonisiin sairauksiin.

Kansainvälisesti yhä suurempi joukko lääketieteen ammattilaisia ja ketogeeniseen ruokavalioon syvällisesti perehtyneitä ravintoterapeutteja, insinöörejä ja nörttejä luennoi ja kirjoittaa ketogeenisen ruokavalion hyödyistä.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6695889/

https://en.wikipedia.org/wiki/Insulin_resistance

https://www.sciencedirect.com/science/article/pii/S0085253815301745

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6359196/

https://lipidworld.biomedcentral.com/articles/10.1186/s12944-019-1035-2

https://www.ncbi.nlm.nih.gov/pubmed/28193599

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5664869/

 




Salaperäiset sirtuiinit

Salaperäiset sirtuiinit tehostavat solujen aineenvaihduntaa, hidastavat ikääntymistä, säätelevät geenien aktiivisuutta ja suojaavat aivoja. Mutta mitä sirtuiinit ovat ja miten ne vaikuttavat aineenvaihduntaan?

”Jo 1930-luvulta asti on tiedetty, että energiarajoitus pidentää jyrsijöiden elinikää. Nimenomaan energiamäärä (noin 60-70 % normaalista) eikä energian lähde näyttää tässä suhteessa olevan ratkaiseva tekijä. Energiamäärän vähentäminen saa aikaan kehon lämpötilan laskun sekä glukoosi- ja insuliinipitoisuuden, painon ja rasvamäärän vähenemisen (Guarente ja Picard 2005). Vähäinen energiansaanti tekee eläimet resistentiksi ulkoisille stressitekijöille, kuten oksidatiiviselle stressille. Tämä on tärkeä sopeutumismekanismi, sillä ikääntymisen uskotaan liittyvän ROS:n (reactive oxygen species) muodostukseen.”- Professori Markku Laakso / Duodecim


Johdanto

Nyt syntyviä sukupolvia odottavat ilmastonmuutoksen, hallitsemattoman väestönkasvun ja taloudellisesti yhä selvemmin jakaantuneen maailman asettamat haasteet.

Toisaalta lääketieteellinen kehitys ja ymmärrys geenien toiminnasta lupaa tuleville sukupolville pitkää ja tervettä elämää. Eräs mullistavimmista lääketieteellisistä keksinnöistä viime vuosina on ollut CRISPR-Cas-9 geenisakset, joilla DNA:sta voidaan leikata viallisia jaksoja ja korvata ne terveillä jaksoilla. Samaan aikaan ymmärrys ikääntymisestä ja siihen vaikuttavista aineenvaihduntamekanismeista on täsmentynyt.

Salaperäiset sirtuiinit ohjaavat ja tehostavat solujen rasva-aineenvaihduntaa silloin kun glukoosin saanti on vähäistä. Niukka energiansaanti käynnistää aineenvaihdunnan luonnollisen sopeutumismekanismin, johon osallistuu SIRT1-geeni. Sirtuiinit ovat NAD+ -riippuvaisia solujen apoptoosia, tulehdusvastetta, solujen elämänkaarta, geenitranskriptiota ja aineenvaihduntaa sääteleviä proteiiniasetylaaseja.



NAD+ eli nikotiiniamidiadeniinidinukleotidi ja proteiiniasetylaasit

Molekyylibiologiaan harjaannuttamattoman silmissä nämä sanat ovat silkkaa hepreaa. Mitä ne tarkoittavat ja mitä helvettiä ne meille tekevät? Vaikeilla sanoilla on miltei maagisia tarkoituksia. Mitä koentsyymit, kofaktorit ja entsyymit ovat?

NAD+ on kaikissa elävissä soluissa esiintyvä koentsyymi. Koentsyymit (tai kofaktorit) ovat orgaanisia molekyylejä tai epäorgaanisia metalli-ioneja, joka entsyymin on sidottava itseensä toimiakseen kemiallisia reaktioita katalysoivana entsyyminä.

Monet koentsyymeistä ovat vitamiineja, osa metalleja, kuten kofaktori-ionit Mn2+, Mg2+ ja Zn2+. Entsyymi, johon ei ole sitoutunut sen luontaista kofaktoria tai kofaktoreita on toimimaton apoentsyymi. Koentsyymi muodostaa entsyymin proteiiniosan eli apoentsyymin kanssa toimivan entsyymin.

Epäorgaanisia kofaktoreita ovat mm. ravinnosta saatavat metalli-ionit Cu2+, Fe2+ tai Fe3+, K+, Mg2+. Arvaatte varmaan, että näitä on paljon enemmän, mutta eiköhän pointti selvinnyt.

Nämä epäorgaaniset kofaktorit muodostavat apoentsyymien kanssa entsyymejä, kuten: sytokromi-c-oksidaasin, katalaasin, peroksidaasin, pyryvaattikinaasin, heksokinaasin ja glukoosi-6-fosfataasin.

Monet orgaanisista koentsyymeistä ovat vitamiineja tai niiden johdannaisia, kuten biosytiini, koentsyymi A, 5’-deoksiadenosyylikobolamiini, flaviiniadeniinidinukleotidi, lipoaatti, NADH/NAD+, pyriokdaalifosfaatti jne. Näiden koentsyymien esiasteet ovat vitamiineja, kuten biotiini (B7), pantoteenihappo(B5), B12, riboflaviini (B2), niasiini (B3), B6, folaatti (B9) ja tiamiini (B1).

Entsyymit ovat kemiallisia aineenvaihduntareaktioita nopeuttavia biologisia katalyytteja. Ne ovat yleensä proteiineja, mutta myös RNA-molekyylit eli ribotsyymit voivat olla entsyymejä. Entsyymien vaikutus perustuu niiden kykyyn alentaa substraattiin kohdistuvan reaktion aktivaatioenergiaa. Ilman entsyymejä kemialliset reaktiot tapahtuisivat soluissa liian hitaasti, eikä elämä olisi mahdollista. Nopeimmat entsyymit muuttavat jopa 40 miljoonaa molekyyliä reaktiotuotteiksi sekunnissa.


NAD+ ja sen pelkistynyt muoto NADH toimivat koentsyymeinä monissa biologisissa hapetus-pelkistysreaktioissa.

Nikotiiniamidiadeniinidinukeotidi muistuttaa kemialliselta rakenteeltaan toista tärkeää koentsyymiä, nikotiiniamidiadeniinidinukleodifosfaattia (NADP+). NAD+ osallistuu katabolisiin aineenvaihduntareaktioihin ja NADP+ on tärkeä koentsyymi anabolisissa reaktioissa.

Kataboliset aineenvaihduntareaktiot pilkkovat monimutkaisia molekyylejä yksinkertaisemmiksi ja anaboliset aineenvaihduntareaktiot rakentavat yksinkertaisemmista molekyyleistä suurempia ja monimutkaisempia molekyylirakenteita.

Eliöt tuottavat NAD+:a kahdella tavalla:

1. Geenien säätelemässä de novo-synteesissä tryptofaanista (aminohappo) syntetisoidaan ensin kinoliinihappoa, joka muutetaan nikotiinihappomononukleotidiksi ja edelleen nikotinaattinukleotidiadenyylitransferaasientsyymin avulla desamino- NAD+:ksi.
NAD+ syntaasientsyymi muuttaa desamino- NAD+:n nikotiiniamidiadeniinidinukleotidiksi.

2. NAD+-biosynteesiä tapahtuu myös nikotiiniamidista, joka prosessoidaan nikotiiniamidaasientsyymin avulla nikotiinihapoksi. Nikotiinihaposta muodostetaan nikotiinihappomononukleotidia, joka muokataan NAD+:ksi kuten de novo -synteesissä.

Proteiiniasetylaasit ovat asetyyliryhmään kiinnittyviä proteiineja. Deasetylaasit poistavat osia asetyyliryhmästä. Nisäkkäillä tunnetaan seitsemän erilaista ja erilaisiin reaktioihin osallistuvaa sirtuiinia. Esimerkiksi SIRT1-3 ja SIRT5 ovat deasetylaaseja. Solun tumassa on SIRT1:tä, SIRT6:ta ja SIRT7:ää. Mitokondrioissa on puolestaan SIRT3-5:tä ja solulimassa SIRT2:ta.

Mitä ne sirtuiinit siellä soluissa tekevät?

SIRT1 säätelee aineenvaihduntaa ja solujen elinkaarta
SIRT2 ja SIRT6 saattavat vaikuttaa kasvaimien kehittymiseen ja syöpään
SIRT3 ja SIRT4 osallistuvan aineenvaihdunnan säätelyyn
SIRT4 liittyy aminohappovälitteiseen insuliinin eritykseen

SIRT1 vaikuttaa erityisesti energia-aineenvaihdunnan kannalta keskeisissä kudoksissa, kuten haimassa, maksassa ja rasvakudoksessa. SIRT1:n aktivoituminen lisää insuliiniherkkyyttä ja laskee glukoosi- ja insuliinipitoisuuksia.

Koska SIRT1 on PPAR*-estäjä (*peroxisome proliferator-activated receptor), se kiihdyttää rasvakudoksen lipolyysiä vapauttamalla rasvakudoksiin varastoituja rasvahappoja verenkiertoon.


Lipolyysi vs. lipogeneesi

Lipolyysi pilkkoo rasvasoluihin varastoituja triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu verenkierron mukana maksaan, ja rasvahapot energialähteiksi luurankolihaksille, maksalle ja sydämelle.

Lipolyysi aktivoituu paaston ja vähän hiilihydraatteja sisältävän ruokavalion yhteydessä hormonaalisesti lipolyyttisten hormonien: glukagonin, kortikotropiinin, adrenaliinin ja noradrenaliinin vaikutuksesta.

Lipolyysin tarkoitus on säästää glukoosia punasoluille ja hermosoluille, jotka eivät pysty käyttämään rasvahappoja energiantuotannossa. Lipolyysille vastakkainen aineenvaihduntareaktio on lipogeneesi, joka prosessoi ja varastoi ylimääräisiä sokereita rasvahapoiksi.

Insuliini osallistuu ravinnon soluun pääsyyn sekä ravinteiden varastoimiseen lihas-, maksa- ja rasvasoluihin. Glukagoni ja muut lipolyyttiset hormonit purkavat solujen sokeri- ja rasvavarastoja verenkiertoon, jolloin niitä voidaan käyttää solujen energiantuotannossa.

Lipolyysiä ohjaa lipaasi. Kun haima erittää vereen insuliinia, lipolyysi estyy. Rasvakudos on herkkä insuliinin säätelylle. Kun veren insuliinipitoisuus laskee, lipolyyttiset hormonit ohjaavat lipaasin toimintaa. Tämä käynnistää lipolyysin ja rasvahappoja vapautuu rasvasoluista vereen.

Veren mukana soluihin kulkeutuneista rasvahapoista tuotetaan beetaoksidaatiossa asetyylikoentsyymi-A:ta, joka on kaikille energiaravinteille yhteinen väliaine sitruunahappokierrossa. Asetyylikoentsyymi-A voi jatkaa solujen energiantuotantoa mitokondrioissa tapahtuvassa sitruunahappokierrossa, jos glukoneogeneesi ei ole käynnissä.

Kun SIRT1 aktivoituu, insuliinin eritys haimasta lisääntyy. SIRT1myös suojaa haiman beetasoluja oksidatiiviselta stressiltä.

PCG-1:n*-aktivoituminen (*peroxisome proliferator-activated receptor gamma coactivator-1) lisää glukoosin syntetisoimista maksassa osana SIRT1-aktivaatiota. PCG-1 kasvattaa mitokondrioiden määrää ja kokoa sekä kiihdyttää rasvahappojen hapettumista beetaoksidaatiossa. Nämä tekijät yhdessä vaikuttavat suotuisasti glukoosin aineenvaihduntaan.

SIRT1 suojaa keskushermoston soluja neurodegeneratiivisilta prosesseilta. Punaviinin, mustikoiden, viinimarjojen ja karpaloiden sisältämä fenoliyhdiste resveratroli on SIRT1-aktivaattori, joka lisää PCG-1-aktivaatiota. Tämä on tutkimuksissa tehostanut mitokondrioiden toimintaa, energiankulutusta ja hapenottokykyä. Se voi lisätä myös solujen insuliiniherkkyyttä ja laskea rasvamaksaan sairastumisen riskiä.

Resveratroli on eläinkokeissa suojannut runsaasti energiaa ravinnosta saavia hiiriä lihomiselta estämällä PPAR:n* (*peroxisome proliferator-activated receptor) aktivaation. SIRT1 voi vaikuttaa suotuisasti aikuistyypin diabetekseen, sillä se lisää solujen insuliiniherkkyyttä ja haiman insuliinin eritystä, sekä laskee painoa ja kehoon varastoituneen rasvan määrää.

Yhteenveto

SIRT1 (Silent Information Regulator 1) osallistuu useisiin aineenvaihduntaprosesseihin ja energia-aineenvaihdunnan säätelyyn. SIRT1 vaikuttaa lihavuuteen ja aikuistyypin diabetekseen säätelemällä rasvojen aineenvaihduntaa ja mitokondrioiden biogeneesiä.

Sirtuiinien hermoja ja aivosoluja suojaava vaikutus perustuu toisaalta SIRT1:n oksidatiivista stressiä vähentävään vaikutukseen ja toisaalta SIRT1:n kykyyn vähentää tulehdusvastetta sitoutumalla NF-kB*:en (Nuclear Factor-kappaB) ja siten ehkäistä hermosoluissa tapahtuvaa neurodegeneraatiota ja atrofiaa.


NF-kB


Hiirikokeissa sekä akuutit, että pitemmän ajan kuluessa syntyvät hermosoluvauriot johtavat lähes aina aivojen mikrogliasolujen aktivaatioon. M1-tyypin mikrogliat erittävät tulehdusta edistäviä sytokiineja, jotka lisäävät osaltaan hermosolujen atrofiaa, kun taas M2-tyypin solut poistavat kuolleita soluja ja erittävät vaurioituneisiin hermoston osiin erilaisia kasvutekijöitä.

Keskeisenä tulehdusreaktioiden välittäjänä toimii transkriptiotekijä, tumatekijä kappaB (NF-kB) ja erityisesti sen p50/105-alayksikkö. Hiirikokeissa havaittiin, että NF-kB p50/105-alayksiköllä on merkittävä rooli aivojen tulehdusreaktioiden välittäjänä ja sitä kautta aivojen uusien hermosolujen muodostumisessa. NF-kB p50/105-alayksikön puuttumisen vaikutus vaihtelee eri tautimalleissa ja eri ikäisillä hiirillä.  (Taisia Rõlova)

”Tulehdus on immuunijärjestelmän aikaansaama reaktio, jonka avulla elimistö pyrkii vastaamaan infektioon tai kudosvaurioon ja korjaamaan sen. Matala-asteinen krooninen tulehdus on häiriötila, joka voi ylläpitää tulehdusvasteita kudoksissa aineenvaihdunnan muutosten kautta ja johtaa edelleen kudosvaurioihin sekä altistaa monille sairauksille, kuten astmalle, Alzheimerin taudille, sydän- ja verisuonitaudeille ja erilaisille syöville.”- Anu Wiklund

VIDEO


OSA 1: Energia-aineenvaihdunnan perusteet


Evoluution seurauksena ihmiselle on kehittynyt tehokkaita selviytymismekanismeja toisaalta adaptiivisen immuunijärjestelmän kautta erilaisia taudinaiheuttajia vastaan, ja toisaalta turvaamaan välttämättömät elintoiminnot silloinkin, kun ravintoa ei ole riittävästi saatavilla.

Terve nuori aikuinen selviää pelkällä vedellä kolmisenkymmentä vuorokautta. Aineenvaihdunta käyttää energianlähteenä ensimmäiseksi elimistön sokeri- ja rasvavarastot, mutta ravinnonpuutteen jatkuessa myös lihasten proteiineja käytetään energian lähteenä välttämättömien elintoimintojen turvaamiseksi.

Nykyinen yltäkylläisyys ja ravinnon helppo saatavuus on uusi ilmiö. Meille ruoka ja sen vaivaton saatavuus on itsestäänselvyys, mutta kaukaiset esivanhempamme joutuivat elämään pitkiäkin aikoja hyvin niukalla ravinnolla tai kokonaan ilman ruokaa.

Varhaiset ihmiset söivät silloin, kun ravintoa oli tarjolla ja paastosivat, kun ruokaa ei ollut. Ravinnosta saatu ylimääräinen energia varastoitiin rasva- ja lihassoluihin. Lihominen auttoi ihmisiä selviämään niukoista ajoista.

Toisaalta ravinnon saatavuuden epävarmuus on ilmeisesti vaikuttanut erilaisten biologisten selviytymismekanismien kehittymisen lisäksi eräänlaisen psykologisen selviytymismoodin syntymiseen. Nälkäinen ihminen valpastuu, aistit tarkentuvat, keskittymiskyky paranee, ympäristön hahmottaminen tehostuu, päätöksenteko nopeutuu jne. Tälle on biokemialliset ja hormonaaliset syyt. Väitän, että hieman nälkäinen ihminen on älyllisesti ja fyysisesti parhaimmillaan. Se on asia, josta toki voi kiistellä.

Sokeria vai rasvaa? Kuinka solut saavat energiaa?

Kaikki solut voivat käyttää glukoosia energianlähteenä. Solujen sytoplasmassa tapahtuva glykolyysi pilkkoo glukoosimolekyylin kahdeksi pyruvaatiksi, mikä tuottaa kaksi runsasenergistä ATP-molekyyliä. Kummastakin pyruvaatista saadaan oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta.

Aminohapot, hiilihydraatit ja rasvahapot on muutettava asetyyliryhmiksi ja liitettävä koentsyymi-A:han, jotta ne pääsevät mitokondriossa tapahtuvaan sitruunahappokiertoon. Sitruunahappokierrossa pyruvaateista saadaan vielä kolmisenkymmentä ATP-molekyyliä. Tämän soluhengityksen lopputuotteena on vettä ja hiilidioksidia.

Myös rasvaa (ja proteiineja) voidaan käyttää energian tuottamiseen. Aineenvaihdunta osaa käyttää esimerkiksi eräitä proteiineista saatavia ja vapaita aminohappoja glukoosia tuottavassa glukoneogeneesissä.

Rasvojen energia-aineenvaihdunnan perusta on beetaoksidaatio, ketoosi ja ketogeneesi. Solujen kannalta hiilihydraateista saatava glukoosi on kaikkein helpoin ja nopein energianlähde. Siihen aineenvaihduntamme on totutettu lapsesta alkaen. Rasvan ja proteiinien muuttaminen energiaksi kelpaavaan muotoon edellyttää useita aineenvaihduntareaktioita.

Lähtökohtaisesti keho suosii siis hiilihydraatteja energianlähteenä. Hiilihydraatit pilkotaan sokereiksi, jotka imeytyvät ohutsuolen epiteelin läpi verenkiertoon. Glukoosi kohottaa verensokeria ja haima reagoi glukoosipitoisuuden kasvuun erittämällä vereen insuliinia. Insuliinimolekyyli kiinnittyy solun pinnassa olevaan insuliinireseptoriin ja toimii kuin avain, joka avaa solun glukoosimolekyyleille.

Fruktoosi prosessoidaan maksassa ensisijaisesti glykogeeneiksi eli kymmenistä tuhansista glukoosimolekyyleistä muodostuviksi polysakkarideiksi. Nämä ovat nopeita varastosokereita. Osa fruktoosista muutetaan glukoosiksi, joka vapautuu verenkiertoon ja 1-2 % fruktoosista muutetaan triglyserideiksi.

Myös veressä oleva ylimääräinen glukoosi muutetaan mahdollisuuksien mukaan lihasten glykogeeneiksi. Glykogeenivarastojen rajallisen koon vuoksi osa glukoosista varastoidaan rasvasoluihin ja muutetaan rasvasolussa tapahtuvassa lipogeneesissä triglyserideiksi.

Veren glukoosipitoisuuden laskiessa haiman alfasolut erittävät vereen glukagonia, joka vapauttaa maksan glykogeenivarastoista glukoosia vereen ja lihasten glykogeeneistä glukoosia lihasten käyttöön. Näin verensokeri pysyy tasaisena myös aterioiden välillä.



Entä sitten kun sokerivarastot loppuvat?


Maksan ja lihasten sokerivarastot voivat loppua paastotessa, hyvin niukkaenergisellä ruokavaliolla tai hiilihydraattien saantia rajoitettaessa. Tällöin elimistön on turvauduttava varastoimaansa energiaan eli läskiin.

Veren glukoosipitoisuuden laskun seurauksena vereen erittyy lipolyyttisiä hormoneja: glukagonia, kortikotropiinia, adrenaliinia ja noradrenaliinia. Näiden vaikutuksesta elimistön rasva-aineenvaihdunta tehostuu.

Ketoaineiden tuotanto

Lipolyysi purkaa rasvasolujen triglyseridejä glyseroliksi ja vapaiksi rasvahapoiksi. Glyseroli kulkeutuu maksaan, jossa sitä voidaan hyödyntää mm. glukoosia syntetisoivassa glukoneogeneesissä.

Soluihin kulkeutuvat vapaat rasvahapot pilkotaan beetaoksidaatiossa asetyylikoentsyymi-A:ksi. Glukoneogeneesin yhteydessä asetyylikoentsyymi-A:ta ei voida hapettaa normaalisti mitokondrioissa, vaan ylimääräisestä asetyylikoentsyymi-A:sta muodostetaan 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-syntaasin katalysoimana 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A:ta (HMG-KoA) ja edelleen mitokondrioissa 3-hydroksi-3-metyyliglutaryyli-koentsyymi-A-lyaasin (HMG-KoA-lyaasi) katalysoimassa reaktiossa ketoaineita: asetoasetaattia ja siitä edelleen betahydroksibutyraattia ja asetonia.

Asetyylikoentsyymi-A on kaikille ravintoaineille yhteinen väliaine solun valmistaessa energiaa. Sen asetyyliryhmän hiilet hapettuvat hiilidioksidiksi sitruunahappokierrossa (Krebsin sykli) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio

Oksidatiivinen fosforylaatio on elektroninsiirtoketjusta ja ATP-syntaasista koostuva aineenvaihduntareitti. Happea käyttävien solujen ATP-energiasta noin 90 % syntyy oksidatiivisessa fosforylaatiossa eli kun ravintoaineet hapettuvat ja energia sitoutuu suurienergisiin fosfaattiyhdisteisiin, kuten ATP.

Oksidatiivinen fosforylaatio, glykolyysi ja sitruunahappokierto päättävät solun katabolisen energiantuotannon. Glykolyysissä, rasvahappojen oksidaatiossa ja trikarboksyylihappokierrossa muodostuneiden pelkistyneiden koentsyymien (NADH ja FADH2) elektronit siirtyvät oksidatiivisen fosforylaation elektroninsiirtoketjuun. Nämä elektronit pelkistävät happimolekyylit vedeksi, jolloin vapautuva energia sitoutuu ATP:nä.

Yhdestä glukoosimolekyylistä saadaan noin 30 suurienergistä ATP-molekyyliä.

Katabolisessa aineenvaihdunnassa pienimolekyyliset yhdisteet (aminohapot, monosakkaridit, rasvahapot) pilkotaan ja ”poltetaan” solujen energiaksi. Kaikkien energiaravinteiden yhteinen väliaine on asetyylikoentsyymi-A.

Asetyylikoentsyymi-A voidaan pilkkoa sitruunahappokierrossa, jossa sen hiiliatomit hapettuvat hiilidioksidiksi ja vetyatomit siirtyvät hapetus-pelkistysreaktioissa keoentsyymeille (NADH ja FADH2) Nämä siirtävät vetyä sitruunahappokierron ja elektroninsiirtoketjun välillä. Koentsyymit menettävät elektronit ja hapettuvat NAD+:ksi ja FAD:ksi, jotka jatkavat kiertoa.

Osa 2: Ketoosi ja sirtuiinit

Ketoosi kiihdyttää sirtuiinien aktivaatiota soluissa. Sirtuiinit kuuluvat histonideasetylaaseihin (HDAC). Ne ovat proteiineja, jotka poistavat asetyyliryhmän geenin histonista ja näin ”sammuttavat” geenin ilmentymisen eli ekspression.

Jokainen solu sisältää yksilön jokaisen geenin, mutta geeni ilmentyy vain tietyissä soluissa, ja joskus vain tiettyyn aikaan. Sammutettua geeniä ei lueta proteiinin valmistuksessa.

Ketoosi lisää sirtuiini1:en (SIRT1) määrää hippokampuksen eli aivoturson alueella ohimolohkojen sisäosissa korvien lähellä. Kummankin ohimolohkon hippokampus on yhteydessä toiseen ja hypotalamukseen aivokaaren välityksellä.

Nyt liikutaan kiistanalaisilla vesillä. Vuosittain arviolta 2,8 miljoonaa ihmistä kuolee lihavuuden aiheuttamiin komplikaatioihin. Tutkimuksissa on havaittu, että väestöjen keskimääräinen älykkyys laskee. Voisiko olla niin, että runsasenerginen ravinto ei tuhoa vain terveyttämme, vaan myös kognitiiviset kykymme? Voisimmeko elää nälässä terveempinä ja älykkäämpinä. Siinä on provokatiivinen keskustelunaihe kahvipöytään.


Hippokampus ja deklaratiivinen muisti



Hippokampus osallistuu muistitoimintoihin. Erityisen tärkeä hippokampus on deklaratiivisen muistin eli säilömuistin toiminnassa. Deklaratiivinen muisti jakautuu semanttiseen ja episodiseen muistiin. Semanttiseen muistiin tallentuvat asiat, joiden merkitys ymmärretään. Episodimuistiin tallentuu välähdyksenomaisia muistoja tapahtumista. SIRT1-puutos aiheuttaa kognition, muistin ja suunnitelmallisuuden häiriötilan.

”Li-Huei Tsai’s group found that Sirt1 regulates memory by forming a complex that downregulates microRNA miR-134.  This microRNA targets mRNA transcripts for the key learning and memory genes CREB and BDNF, so by keeping miR-134 low, Sirt1 promotes memory formation by keeping CREB and BDNF levels high.”

2016 tehdyssä tutkimuksessa (Heyward et al.) havaittiin, että jatkuvasti liikaravittujen hiirien muistitoiminnot heikkenivät ja hippokampuksen sirt1-pitoisuudet laskivat. Muistia ja oppimista säätelevien geenien ekspression heikkeneminen assosioitui DNA:n lisääntyneeseen metylaatioon.

Tutkijat raportoivat myös SIRT1-geeniin liittyvän DNA:n hydroksimetylaation vähenemisestä. Runsaasti energiaa sisältävän ravinnon aiheuttama DNA:n metylaatio hiirillä alleviivaa ympäristövälitteisten epigeneettisten muutosten vaikutuksia geenin ilmentymiseen.

Hydroksimetylaation merkitys aivojen toiminnalle on yhä arvailujen varassa, mutta tutkijat uskovat, että hydroksimetyloitunut DNA estää eräiden repressiivisten kompleksien sitoutumisen DNA:han.

Kolmas ruokavalioon liittyvä havaittu epigeneettinen mekanismi on, että yksi kolmesta ketoainetyypistä, betahydroksibutyraatti on itsessään endogeeninen HDAC-estäjä. Vaikka sirtuiinit estävät muistin repressoreita (torjujat?), toiset HDAC-luokan histonideasetylaasit voivat estää muistia parantavien geenien toimintaa. Tällaisten histonideasetylaasien estäjät parantavat muistin toimintaa ja niillä on suuri terapeuttinen potentiaali.

Moses Chaon tutkijaryhmä havaitsi, että betahydroksibutyraatti lisää hippokampuksen BDNF-expressiota estämällä HDAC2:ta ja HDAC3-5:tä. Käänsin edellisen kappaleen niin sekavasti, että täsmennetään: betahydroksibutyraatti parantaa muistiin vaikuttavien geenien ilmentymistä estämällä eräitä histonideasetylaaseja.

Eläinkokeiden perusteella ravinnosta saadun energian rajoittaminen ja ketogeeninen ruokavalio suojaavat aivojen soluja, tehostavat muistia ja parantavat kognitiivisia toimintoja. Vastaavasti runsasenerginen ja hiilihydraattipainotteinen ravinto ylläpitää oksidatiivista stressiä ja kasvattaa neurodegeneratiivisten muutosten riskiä.  Eräässä lievistä muistivaikeuksista kärsivillä vanhuksilla toteutetussa tutkimuksessa kuuden viikon vähähiilihydraattinen ruokavalio paransi koehenkilöiden verbaalista muistia. Toisessa kokeessa terveille nuorille aikuisille annettiin annos glukoosia. Kognitiivisia kykyjä mitattiin ennen glukoosia ja sen jälkeen. Tässä tutkimuksessa nuorten kognitiiviset kyvyt heikkenivät 20 minuuttia glukoosiannoksen jälkeen.

Ketogeeninen ruokavalio säätelee NAD+-riippuvaisia entsyymejä ja vähentää DNA:n vaurioita hippokampuksen alueella

Ketogeenisen ruokavalion (KD) epileptisia kohtauksia vähentävät vaikutukset on hyvin dokumentoitu. Ketogeeninen ruokavalio on joillain lapsilla ainoa tehokas keino vähentää epilepsiaan liittyviä kohtauksia.

Hiljattain on havaittu ketogeenisen ruokavalion terapeuttinen potentiaali useiden neurodegeneratiivisten sairauksien hoidossa. Kokeellinen todistusaineisto ketoruokavalion hyödyistä on kuitenkin edelleen puutteellista.

Rotilla tehdyssä tutkimuksessa on osoitettu, että ketogeenistä ravintoa saavien rottien hippokampuksen alueen solujen nikotiiniamidiadeniinidinukleotidi+ (NAD+) -tasot kasvavat.

NAD+ on soluaineenvaihdunnan toiminnalle välttämätön koentsyymi, signalointimolekyyli, soluterveyden markkeri sekä pitkäikäisyyteen ja DNA:n vaurioiden korjaamiseen osallistuvien entsyymien, kuten sirtuiinien ja poly-ADP riboosi polymeraasi-1:n (PARP-1) substraatti.

NAD+-riippuvaisten entsyymien aktivaatio voi selittää laajemminkin ketogeenisen ruokavalion hyödyllisiä vaikutuksia. En mene tarkemmin tuon rottakokeen arviointiin, mutta sen tulokset olivat hyvin rohkaisevia aivojen terveyden osalta.

Miten ketogeeninen ruokavalio suojaisi aivoja?

Ketogeeninen (KD) eli LCHF-ruokavalio sisältää hyvin niukasti hiilihydraatteja, runsaasti rasvoja ja kohtuullisesti proteiineja. Hiilihydraattien määrä rajoitetaan noin 10 prosenttiin päivittäisestä energiansaannista. Suurin osa päivittäisestä energiasta saadaan rasvasta, jonka määrä voi olla 60-70 % päivittäisestä energiansaannista. Proteiinien saanti pidetään 20-30 prosentin tasolla päivittäisestä energiansaannista.

KD ohjaa energia-aineenvaihdunnan helpoista ja nopeista hiilihydraateista (glukoosista) enemmän energiaa kuluttavaan rasva-aineenvaihduntaan, jossa vapaista rasvahapoista valmistettuja ketoaineita käytetään solujen ATP:n lähteenä.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio on ainoa tehokas hoitomuoto lasten lääkeresistentin epilepsian epileptisten kohtausten hillitsemiseen. (Neal et al., 2009; Sharma et al., 2013; Cervenka et al., 2017)

Jatkuvasti kasvava tutkimusnäyttö osoittaa, että ketogeenisella ruokavaliolla on suotuisia vaikutuksia terveyteen (Yang and Cheng, 2010; Winter et al., 2017; Augustin et al., 2018) sekä pitkäikäisyyteen (Newman et al., 2017; Roberts et al., 2017).

Tuoreissa tutkimuspapereissa ketogeenisen ruokavalion terveysvaikutukset assosioituvat vahvasti NAD -koentsyymiin (Elamin et al., 2017), joka on välttämätön ATP:n prosessoinnille ja hapetus-pelkistys-reaktiolle. Ketoaine-perusteisessa aivosolujen energia-aineenvaihdunnassa pelkistyy vähemmän NAD-molekyylejä, kuin glukoosiin perustuvassa energia-aineenvaihdunnassa. Tämän seurauksena aivosoluihin jää korkeampia pitoisuuksia hapettuneita NAD+ -molekyylejä.

Ketogeeninen ruokavalio voi havaintojen perusteella indusoida nopeita ja pysyviä muutoksia NAD+ / NADH -suhteissa aivojen runsaasti energiaa kuluttavalla hippokampuksen alueella. Tämä aivojen osa tunnetaan leikkimielisellä nimellä – kohtausportti (seizure gate). Vastaavia havaintoja on tehty ikääntyneillä hiirillä. Sen sijaan ketoaineisiin nojaavan energia-aineenvaihdunnan ei havaittu vaikuttavan aivokuoren alueella.

Korkeammat NAD+ -tasot rajoittavat epileptisia kohtauksia ja kasvattavat koe-eläinten elinajan odotetta (Lin and Guarente, 2003; Mills et al., 2016; Liu et al., 2017). Kokeellisesti kohotetut NAD+ -arvot tehostavat mitokondrioiden toimintaa, suojaavat oksidatiivisen stressin aiheuttamilta vaurioilta ja vähentävät solujen kuolemaa (Kussmaul and Hirst, 2006). Nämä vaikutukset palautuvat alemman tason aineenvaihduntareitteihin.

NAD+ on kahden entsyymiryhmän, sirtuiinien ja poly-(ADP-riboosi) polymeraasien eli PARP:ien substraatti. Nämä entsyymiryhmät vaikuttavat solujen toimintaan geenien ilmentymisestä DNA:n vaurioiden korjaamiseen (Belenky et al., 2007).

NAD+-riippuvaiset sirtuiini-entsyymit ovat tärkeitä aineenvaihdunnan, tulehdusvasteiden ja DNA:n vaurioiden korjaamisen säätelijöinä. Sirt1 osallistuu transkriptiotekijöiden, kasvutekijöiden, anti-apoptisten (ohjattua solukuolemaa estävien) ja anti-inflammatoristen proteiinien deasetylaatioon, eli asetyyliryhmien purkuun.

Sirt1 on välttämätön kognitiivisten toimintojen, muistin ja neuroplastisuuden normaalille toiminnalle (Michan et al., 2010) ja sillä on havaittu epileptisia kohtauksia ehkäiseviä vaikutuksia. Ravinnosta saatavan energian (kaloreiden) rajoittaminen ja ketogeeninen ruokavalio assosioituvat solujen parempaan terveyteen ja ainakin eläinkokeissa odotettavissa olevan elinajan pidentymiseen. Sirt6 ja Sirt7 osallistuvat suoraan DNA:n emäsjaksojen korjaamiseen, mikä vähentää ikääntymisen aiheuttamia DNA-vaurioita.

Lopuksi

On kiinnostavaa seurata sirtuiinien ja ketogeenisen ruokavalion tutkimuksia. Väitteet karppauksen, rasvojen ja ketogeenisen ruokavalion haitallisuudesta ovat vähintäänkin liioiteltuja ja todennäköisesti jopa haitallisia. Tutkimusaineisto sirtuiinien molekyylibiologisesta roolista ja ketogeenisen ruokavalion terveysvaikutuksista karttuu vauhdilla. Minä palaan tähän aiheeseen Ruokasodassa varmasti vieläkin täsmällisempien tutkimusten kautta. Omalla kohdallani olen havainnut, että vähäisempi ravinnonsaanti kasvattaa motivaatiota, muistia ja aktiivisuutta. Nämä tutkimukset näyttävät vahvistavan omia huomioitani.

PS. Iloista ja rauhallista joulua!

Lähteinä olen käyttänyt erikseen ilmoitettujen lähteiden lisäksi mm. Duodecimia ja Wikipdiaa yleisimpien aineenvaihduntareaktioiden osalta. Kuvien lähde: Pixabay

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2928875/

https://www.jneurosci.org/content/36/4/1324.long

https://elifesciences.org/articles/15092

https://www.frontiersin.org/articles/10.3389/fncel.2018.00263/full

https://www.duodecimlehti.fi/lehti/2007/19/duo96781




Esidiabetes, diabetes ja ketoilu

Esidiabeteksessa verensokeri on selvästi koholla, mutta ei vielä niin korkea kuin diabetekseen sairastuneilla. Esidiabeteksen toteamisen jälkeen on tärkeää kiinnittää ravintoon ja elintapoihin enemmän huomiota. Todetuista esidiabetes-tapauksista jopa seitsemän kymmenestä johtaa aikuistyypin diabetekseen. Lue tästä.

Ruokavalio- ja elämäntapamuutokset pienentävät esidiabetes-diagnoosin saaneiden riskiä sairastua aikuistyypin diabetekseen jopa 40-75%.

Elämäntapamuutoksiin kuuluvat säännöllinen liikunta ja terveellinen ruokavalio. Terveellisestä ruokavaliosta on useita keskenään ristiriitaisia näkemyksiä. Eräiden tutkimusten mukaan ketogeeninen ruokavalio voi pienentää diabetekseen sairastumisen riskiä. Onko näin?


Uhkakuvia ja pelkokertoimia


Olen ketoillut alun kolmatta viikkoa. Sitä voi verrata laskuvarjohyppyyn ilman laskuvarjoa. Ketoilu tappaa yhtä varmasti kuin ydinsota ja marraskuun märkä pimeys Helsingissä. En laske leikkiä. Kaikki vähähiilihydraattista ruokavaliota noudattavat kuolevat sataprosenttisen varmasti.

Tämä on pelottavaa, sillä edes täyskäännös ruisleipään, vähärasvaisiin ruokiin, pehmeisiin rasvoihin ja kasviksiin ei pelasta kerran ketoillutta harhaoppista mitenkään. Vain Jumbo voi pelastaa.

Maailman yli 400 miljoonasta diabeetikosta ja 2,8 miljoonaa lihavuuteen vuosittain kuolevasta vain kourallinen sairastui tai kuoli vähähiilihydraattisen ruokavalion vuoksi. He sairastuivat ja kuolivat, koska se on Jumbon tahto. Tai ehkäpä ei.

LCHF-ruokavaliot eivät uhkaa kansallista tai edes monikansallista turvallisuutta. Joidenkin pohdintojen mukaan ketogeeninen ruokavalio voi tosin olla uhka sokeri-, lääke- ja elintarviketeollisuudelle. Se on kaiketi lööperiä.

Vähähiilihydraattista ruokavaliota demonisoidaan osin aiheettomasti. The Lancet julkaisi hiljattain tutkimuskatsauksen, jonka mukaan vähiten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi kohtuullisesti hiilihydraatteja syöviä verrokkeja enemmän. Clickbait-uutisen lopuksi mainittiin lyhyesti, että tosiasiassa U-käyrän toisella puolella myös eniten hiilihydraatteja syövien kuolleisuus kaikkiin syihin kasvoi.

Miksi näin on? Mitä uutisella haluttiin kertoa?

Enkä sillä haluttiin kertoa, että ketoilu on helvetin vaarallista, moraalitonta ja halveksittavaa ja sitä vastaan on taisteltava kaikin kuviteltavissa olevin keinoin.

Kaikista uusitupalaisimpien näkemysten mukaan karppaus aiheuttaa, jos ei maailmanloppua, niin ainakin 10-15 miljoonaa uutta sydäntautitapausta pelkästään Suomessa. Näistä arviolta 83 % kuolee seuraavien 3-5 kuukauden sisällä. Jotkut onnettomuuksiin, toiset itsemurhiin ja useimmat hiilihydraattien välttämisen aiheuttamiin komplikaatioihin ja yleisvitutukseen. No niin. Siinäpä tuo saatanan sarkasmi taas tuli. Anteeksi.

Ehkäpä tärkeää ei ole niinkään makroravinteiden osuudet, vaan tasapuolinen ruokavalio ja mikroravinteiden  riittävä saanti. Sitä sietää harkita. Laihtumisen kannalta tällaiseen viittaa Stanfordissa tehty tutkimus, jossa verrattiin LCHF-ruokavaliota vähän kaloreita sisältävään ruokavalioon. Osallistujat laihtuivat molemmilla dieeteillä, mutta seuratuissa ryhmissä oli laihtumisen suhteen suuria sisäisiä eroja.


Ei ole vain yhtä tapaa syödä oikein tai väärin


Ihmiset syövät väärin ja sairastuvat. Se ei ole varsinaisesti kenenkään syy. Se on ennemminkin seuraus siitä, että ruokateollisuus tarjoaa yhä enemmän korkean glykeemisen kuorman ruokia, jotka sisältävät hyvin vähän elimistön tarvitsemia mikroravinteita.

Markkinointi ohjaa kuluttajat syömään halvemmalla, nopeammin, mutta laadullisesti heikompitasoista ruokaa. Sellainen maistuu lisättyjen sokereiden, transrasvojen ja viljojen ansiosta helvetin paljon paremmalta kuin parsa tai porkkana. Tämä johtaa lihomiseen ja kasvattaa sairastumisen riskiä.

Runsaasti energiaa sisältävä ruoka on helppoa, halpaa ja nopea valmistaa. Välttämättömiä ravinteita sisältävä ruoka vaatii enemmän työtä ja suunnittelua.  Kaikilla ei yksinkertaisesti ole aikaa ja energiaa valmistaa ruokaa itse, jolloin on houkuttelevaa turvautua nopeisiin ja halpoihin vaihtoehtoihin.

Ketogeeninen LCHF-ruokavalio ei ole täydellinen tai ainoa terveyttä ja painonhallintaa ylläpitävä ruokavalio, mutta jos sen toteuttaa monipuolisesti, se on ihan pätevä ja harkitsemisen arvoinen vaihtoehto.

Hiilihydraatit eivät pidä kylläisenä yhtä hyvin kuin rasvat. Hiilihydraatteja ja runsaasti huonoja rasvoja sisältävät herkut hampurilaisista donitseihin ja makeisista virvoitusjuomiin vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin päihteet.

On esitetty, että käytännöllisesti katsoen kaikkien riippuvuutta aiheuttavien aineiden addiktoiva vaikutus selittyy viime kädessä niiden kyvyllä vapauttaa dopamiinia aivojen nk. mielihyväkeskuksessa nucleus accumbensissa. (Duodecim)” Sokeri ja erityisesti fruktoosi vaikuttavat aivojen mielihyväkeskukseen samaan tapaan kuin kokaiini tai alkoholi. Sokeririippuvuus on kokonaan toinen juttu.

Lihominen on vain yksi oire aineenvaihdunnan särkymisestä. Muita oireita ovat metabolinen oireyhtymä, aikuistyypin diabetes, tulehdukselliset suolistosairaudet ja alkoholista riippumaton rasvamaksa. Kaikki ovat lisääntyneet räjähdysmäisesti 1970-luvun jälkeen.

Melkein kaikki lihavat sairastuvat metaboliseen oireyhtymään, joka johtaa yleensä aikuistyypin diabetekseen. Useimmille diabetesta sairastaville kehittyy rasvamaksa. Huonot ravitsemustottumukset edesauttavat yleensä jonkin tulehduksellisen suolistosairauden kehittymistä. Näitä voi käsitellä yksittäisinä ilmiöinä, mutta mielestäni ne ovat osa laajempaa ravitsemukseen liittyvää ongelmaa. Kardiometabolisten sairauksien epidemia uhkaa jo terveydenhoidon kantokykyä ja kansantaloutta.


Oikotietä terveyteen ei ole, mutta jotain on syötävä


En laske hiilihydraatteja. Tiedän, että niiden määrä jää kohdallani 20-50 grammaan päivässä. Rasvaa voisin syödä ehkä hieman enemmän, mutta proteiinien saanti saattaa kohdallani olla hieman tarvetta runsaampaa. Haluan välttää lihomisen ja erityisesti vyötärölihavuuden aiheuttamat sairaudet. Yritän siis laihtua paetakseni aikuistyypin diabetesta. Multippeliskleroottisena en haluaisi uusia taakkoja kannettavakseni.

Näin ketoilun kolmannella viikolla huomaan noudattavani jonkinlaista 6:1-variaatiota. Syön siis kuutena päivänä vähähiilihydraattisesti ja yhtenä päivänä melkein mitä vain kohtuuden ja järjen sallimissa puitteissa. Tämä ei mene kirjan mukaan, mutta katsellaan mihin tämä johtaa.

Ketopäivinä syön kahdesti päivässä ja oloni on koko ajan kylläinen ja energinen. En kaipaa aamu- ja iltapalaa, välipaloja tai herkkuja. Juon vettä, kahvia ja teetä (tarvittaessa punaviiniä tai sokeritonta lonkeroa). Aiemmin napostelin pitkin päivää jotakin ja energiatasot olivat koko ajan aivan nollassa.

Ketogeenisen ruokavalion suuri hyöty laihtumisen kannalta onkin juuri siinä, että rasva pitää kylläisenä pidempään ja naposteluhalu vastaavasti vähenee. Näin päivittäinen energiansaanti laskee ilman näläntunnetta ja suuria uhrauksia.

Varoitus: Ketogeeninen LCHF-ruokavalio ei välttämättä sovi kaikille. Pitkäaikaistutkimuksia LCHF-ruokavalion vaikutuksista terveydelle ei ole. En halua hehkuttaa ketogeenistä ruokavaliota minään muuna kuin mitä se on.

Parantaako ketogeeninen ruokavalio kaikki vaivat? Ei helvetissä paranna. Sellaista väittävät puhuvat paskaa ja myyvät jotain. Aineenvaihdunnan tasolla ketogeenisen ruokavalion toiminta tunnetaan ja se on hyvin tehokas laihdutusruokavalio kahdesta syystä:

1) rasva pitää kylläisenä, jolloin kokonaisenergiansaanti laskee, ja
2) ketogeeninen ruokavalio pakottaa elimistön turvautumaan läskivarastoihin energian saamiseksi, jolloin rasvan ”poltto” tehostuu.

Viralliset mallit, kuten ruokapyramidit eivät ole aivan huonoja, mutta niissä hiilihydraattien eli sokereiden määrä pidetään tarpeettoman korkeana ja rasvojen saantia kehotetaan välttämään tai suosimaan rasvattomia tai vähärasvaisia elintarvikkeita, vaikka rasvat ovat solujen uusiutumiselle sekä aivojen ja hermoston toiminnalle välttämättömiä ravintoaineita. Aivojen kuivapainosta 60 prosenttia on rasvaa. Kolesterolista – jota elimistö tuottaa itse kolesterolisynteesissä, 25 prosenttia on aivoissa. Rasva ja kolesteroli ovat mm. hermoratoja suojaavien myeliinieristeiden rakennusaineita.

Vähän hiilihydraatteja sisältävään ravintoon liittyy monenlaisia ennakkoluuloja, joiden mukaan LCHF-ruokavaliolla syödään vain proteiinia ja rasvaa. Se ei ole aivan totta. Ketogeenisellä ruokavaliolla on mahdollista syödä terveellisesti ja monipuolisesti, jos vain jaksaa nähdä vaivaa ja valmistaa terveellistä ja monipuolista ruokaa.

Usein ketoilija korvaa paljon tärkkelystä sisältävät korkean glykeemisen kuorman hiilihydraatit, kuten perunat ruokavalion sallimilla vihanneksilla. Terveellisten vihannesten ja kasvisten päivittäinen saanti todennäköisesti kasvaa LCHF-ruokavaliolla aiempaan verrattuna.


Diabetes: 1 & 2


Hölöttäminen sikseen. Aiheena on diabetes ja erityisesti ketogeenisen ruokavalion vaikutus diabetesta ehkäisevänä ruokavaliona. Tyypin 1 ja typin 2 diabetes ovat hyvin erilaisia sairauksia.

Tyypin 1 diabeetikon kohdalla hiilihydraattien välttämisen tuottama ketoosi voi johtaa hengenvaaralliseen ketoasidoosiin. Ketogeeninen ruokavalio ei siis sovi tyypin 1 diabetesta sairastavalle, mutta voi vähentää lääkityksen tarvetta tyypin 2 diabetesta sairastavilla.

Diabetekseen sairastuvan sokeriaineenvaihdunta on häiriintynyt. Insuliinintuotanto on loppunut tai solujen insuliinisensitiivisyys on heikentynyt. Haiman Langerhansin saarekkeiden beetasolujen tuottama elintärkeä insuliini on eräänlainen avain, jonka glukoosi tarvitsee päästäkseen solun sisälle.


Insuliinin ja glukagonin vaikutus


Ruokailun jälkeen veren sokeripitoisuus kasvaa. Haima reagoi tähän erittämällä vereen insuliinia. Solujen pinnalla on insuliinireseptoreita, joihin kiinnittyvä insuliinimolekyyli tuo solun läpäisevän kanavamolekyylin solukalvolle. Näin glukoosimolekyyli pääsee soluun, jossa se muutetaan solun tarvitsemaksi energiaksi solulimassa tapahtuvassa glykolyysissä ja mitokondrioissa tapahtuvassa sitruunahappokierrossa. Aerobisessa energiantuotannossa eli soluhengityksessä sokerit (ja rasvat) poltetaan vedeksi ja hiilidioksidiksi.

Kun veren glukoosipitoisuus laskee, haiman alfasolut erittävät vereen glukagonia. Se on insuliinin vastavaikuttajana energia-aineenvaihdunnan kannalta elintärkeä hormoni. Glukagoni aktivoi maksan ja lihasten sokerivarastojen eli glykogeenien purkamisen. Näin veren sokeripitoisuus pysyy tasaisena myös aterioiden välillä.

Mitä tapahtuu, jos ja kun elimistön sokerivarastot loppuvat? Kuoleeko ihminen? Ei. Glukagoni purkaa rasvasoluista rasvahappoja vereen. Se käynnistää maksan ja munuaisten soluissa ketogeneesin ja glukoneogeneesin.

Ketogeneesi ja glukoneogeneesi

Ketogeneesi tuottaa vereen vapautuneista rasvahapoista ketoaineita, joita solut voivat käyttää energianlähteenä. Tähän täysin arkiseen aineenvaihduntaprosessiin ei liity mitään mystiikkaa. Se on elimistön eräs luonnollinen selviytymismekanismi.

Glukoneogeneesi tuottaa mm. sitruunahappokierron väliaineista ja eräistä vapaista aminohapoista glukoosia.

Glukagoni käynnistää beetaoksidaation, glukoneogeneesin ja ketogeneesin. Insuliini keskeyttää nämä aineenvaihduntaprosessit.

Glukagonin vaikutuksesta soluissa käynnistyvässä beetaoksidaatiossa rasvahapot pilkotaan asetyylikoentsyymi-A:ksi eli aktiiviseksi etikkahapoksi. Se on kaikkien energiaravinteiden yhteinen väliaine sitruunahappokierrossa.

Näin rasvasolujen sisältämä rasva muutetaan solujen energiaksi kelpaavaan muotoon ja rasvaa aletaan polttaa solujen energiaksi. Atkinsin hypoteesin mukaan jatkuvasti korkeat insuliinitasot estävät elimistön rasvavarastojen tehokkaan käyttämisen, koska beetaoksidaatio, ketogeneesi ja glukoneogeneesi eivät ehdi kuluttamaan rasvoja, kun tarjolla on jatkuvasti helppoja ja nopeita hiilihydraatteja.

Tyypin 1 diabetes on autoimmuunitauti, jossa kehon oma immuunijärjestelmä tuhoaa insuliinia valmistavat Langerhansin saarekkeiden beetasolut. Tämän seurauksena haima ei pysty tuottamaan riittävästi elintärkeää insuliinia.

Ennen insuliinilääkityksen keksimistä tyypin 1 diabetes oli käytännössä kuolemantuomio. Insuliinilääkityksen ansiosta diabeetikot saavat elää melko normaalisti, mutta se edellyttää jatkuvaa tasapainoilua veren glukoosipitoisuuden tasaisena pitämiseksi. Liian korkea ja liian matala veren glukoosipitoisuus aiheuttavat diabeetikoille jopa hengenvaarallisia komplikaatioita. Diabetesta kutsuttiin aiemmin sokeritaudiksi, koska se vaikuttaa sokerin aineenvaihduntaan.

Tyypin 2 diabeteksessa solujen insuliinireseptorien ”lukkomekanismi” rikkoutuu niin, että vaikka insuliinimolekyylit koettavat kiinnittyä insuliinireseptoreihin, ne eivät kiinnity siihen toivotulla tavalla. Haima voi tuottaa yhä insuliinia, mutta solut eivät reagoi insuliiniin niin kuin niiden pitäisi reagoida. Tätä kutsutaan insuliiniresistenssiksi.

Tyypin 1 diabetes on erityisesti lasten ja nuorten sairaus, vaikka siihen voi sairastua vanhempanakin. Se edellyttää perinnöllisen alttiuden sekä yhden tai useamman sairastumisen laukaisevan tekijän. Tyypin 1 diabetes on hoidettavissa insuliinilääkityksellä, mutta ei parannettavissa. Se on elinikäinen sairaus. Diabetesta sairastavista noin 5 % sairastaa tyypin 1 diabetesta.

Tyypin 2 diabetes on elämäntapoihin liittyvä sairaus, johon sairastutaan yleensä aikuisena. Tosin se yleistyy pelottavan nopeasti myös ylipainoisten lasten parissa. Myös tyypin 2 diabetekseen liittyy perinnöllinen alttius, mutta siihen sairastumista voidaan ehkäistä ja oireita helpottaa elämäntapamuutoksilla.

Molemmissa tapauksissa diabetes voi johtaa erilaisiin komplikaatioihin, kuten sydän- ja verisuonitauteihin, munuaisten sairauksiin, sokeuteen, erilaisiin neurologisiin häiriöihin sekä verisuoni- ja elinvaurioihin.

Yhdysvalloissa jo lähes joka kymmenes ihminen (noin 30 miljoonaa) sairastaa diabetesta, mutta sairastuneista 25 % ei tiedä sairastavansa.

Paistettua chilillä maustettua kanaa ja kasviksia, porkkanaraaste ja jogurttikastike

Raskausaikainen diabetes paranee usein synnytyksen jälkeen, mutta joissain tapauksissa se voi johtaa aikuistyypin diabetekseen myöhemmin elämässä.


Diabeteksen syyt


Tyypin 1 ja tyypin 2 diabetes johtuvat eri syistä, mutta molempiin liittyy insuliini. Insuliini on haiman tuottama sokeriaineenvaihdunnalle elintärkeä hormoni.

Tyypin 1 diabetes

Autoimmuunitautien tarkkaa syntytapaa ei tunneta. Niissä immuunijärjestelmän virheellinen toiminta kohdistaa aktivaation kehon omia kudoksia vastaan. Diabeteksessa immuunijärjestelmä tuhoaa haiman Langerhansin saarekkeiden insuliinia tuottavia beetasoluja. Autoimmuunitaudit edellyttävät perinnöllisen sairastumisalttiuden sekä yhden tai useamman sairastumisen laukaisevan ympäristötekijän. Tyypin 1 diabeteksen saattaa laukaista jokin lapsuudessa sairastettu infektio. Tutkimus.

Sairastumisen riskiin vaikuttavat mahdollisesti:

  • perinnölliset tekijät; suvussa esiintyy diabetesta
  • eräät geenimuutokset
  • muut sairaudet, kuten kystinen fibroosi ja perinnöllinen hemokromatoosi
  • altistuminen infektioille, kuten sikotaudille, vihurirokolle ja tavalliselle herpesvirukselle (cytomegalovirus)
  • matalat sikiöaikaiset D-vitamiinitasot

Tyypin 2 diabetes

Aikuistyypin diabeteksessa solut alkavat vieroksua insuliinia. Hiljalleen tauti etenee pisteeseen, jossa insuliinin tuotanto vähenee ja solut eivät pysty käyttämään glukoosia tehokkaasti. Glukoosi ei pääse soluihin ja sitä alkaa kerääntyä verenkiertoon. Insuliiniresistanssi ilmenee mittauksissa selvästi kohonneena verensokerina.

Insuliiniresistenssi voi syntyä, jos veren glukoosipitoisuus on jatkuvasti korkea ja veressä on runsaasti insuliinia. Solut ylikuormittuvat ja ”kyllästyvät” insuliiniin, jolloin ne reagoivat insuliinin vaikutuksiin huonommin.

Tyypin 2 diabeteksen selkeiden oireiden ilmenemiseen voi mennä vuosia. Taudin varhaisvaiheessa sairauden etenemistä voi vielä hidastaa ja oireita hillitä lääkkeiden, ruokavalion ja liikunnan avulla. Insuliinia ei sairauden alkuvaiheessa tarvita, mutta taudin edetessä insuliinin tarve kasvaa veren glukoosipitoisuuden tasaisena pitämiseksi.

Tyypin 2 diabeteksen riskitekijöihin kuuluvat:

  • perinnöllinen alttius; suvussa esiintyy aikuistyypin diabetesta
  • ylipaino ja lihavuus
  • tupakointi
  • huonot ruokatottumukset
  • liikunnan puute
  • eräät lääkkeet

Riskitekijät

Geneettiset tekijät sekä eräät ympäristömuuttujat voivat laukaista tyypin 1 ja tyypin 2 diabeteksen, mutta aikuistyypin diabeteksen voi välttää laihduttamalla, syömällä terveellisesti ja liikkumalla riittävästi. JAMA Oncology -julkaisu kertoo, että kuitujen ja maustamattoman jogurtin saanti laskee keuhkosyövän riskiä merkittävästi. Aiemmissa tutkimuksissa on havaittu jogurtin ja kuitujen vähentävän aikuistyypin diabeteksen riskiä.

D-vitamiini

On jonkin verran tutkimusnäyttöä siitä, että riittävä D-vitamiinin saanti laskee diabetekseen sairastumisen riskiä. Erityisesti odottavan äidin ja sikiön matalat D-vitamiinitasot voivat altistaa sairastumiselle myöhemmin elämässä. 2017 julkaistun tutkielman mukaan D-vitamiinin vajaus heikentää mm. immuunijärjestelmän säätelyä ja solujen insuliiniherkkyyttä; tämä puolestaan lisää diabetekseen sairastumisen riskiä.

Rintaruokinta

Rintaruokinta voi laskea lapsen riskiä sairastua tyypin 1 diabetekseen. 2012 julkaistu tutkimus tulkitsi rintaruokinnan suojaavan lasta tyypin 1 diabetekseen sairastumiselta, mutta tieteellinen näyttö rintaruokinnan suojaavasta vaikutuksesta jäi melko ohueksi.

Oireet

Diabeetikko voi kärsiä monenlaisista alhaisen verensokerin aiheuttamia oireita ja komplikaatioita.

Aikuistyypin diabetekseen liittyy metaboliseen oireyhtymään viittaavia piirteitä, kuten lihavuutta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja. Inflammaatio vaikuttaa metaboliseen oireyhtymään ja aikuistyypin diabetekseen.

Ketoilijan jauhelihasalaattia

Tyypin 1 diabetes Tyypin 2 diabetes
Ennen tautia Painoindeksi on tasolla (19–24.9) Painoindeksi (25 tai suurempi)
Taudin aikana Useita viikkoja jatkuva nälän- ja janontunne sekä lisääntynyt virtsaamisen tarve, näön hämärtyminen.

Näön hämärtyminen, väsymys, käsien ja jalkojen puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon äkillinen putoaminen.

Lisääntynyt janon- ja nälän tunne, lisääntynyt virtsaamisen tarve, näön hämärtyminen

Väsymys, jalkojen ja käsien puutuminen ja kihelmöinti, hitaasti paranevat haavat, painon selittämätön lasku.

 

Komplikaatiot

Riskinä sydän- ja verisuonitaudit, sydänkohtaus, halvaus, munuaistauti ja munuaisen vajaatoiminta.

Silmävauriot ja sokeus, hermovauriot, hitaasti paranevat haavat, ketoasidoosi

Riskinä sydän- ja verisuonitaudit, sydänkohtaus ja halvaus, munuaistauti ja munuaisten vajaatoiminta, näön heikkeneminen, hermovauriot.
Hitaasti paranevat haavat, kuoliot (amputaation riski), ketoasidoosi.

Hyperglykemia

Jos diabeetikon veren sokeripitoisuus kasvaa liian korkeaksi, seurauksena on hyperglykemia. Tämä voi johtaa pitkäkestoisiin komplikaatioihin, sokeutumiseen, sydän- ja verisuonitauteihin ja elinvaurioihin. Hyperglykemiaan liittyy usein lisääntynyt virtsaamisen tarve ja kova jano.

Hyperglykemia voi johtaa ketoasidoosiin, eli happomyrkytykseen, joka on diabeetikoilla hengenvaarallinen ja lääkärin hoitoa vaativa tila.

Ketoasidoosin yleiset oireet:

  • hengitysvaikeudet
  • makealta ja hedelmäiseltä haiseva hengitys
  • pahoinvointi ja oksentelu
  • kuiva suu
  • kooma

Hypoglykemia

Diabetesta sairastavien pitää seurata veren sokeritasoja säännöllisesti. Diabetesta sairastavan verensokerin lasku liian alhaiselle tasolle viittaa hypoglykemiaan. Hypoglykemian voi aiheuttaa liian suuri annostus insuliinia tai insuliinia tuottavaa lääkettä.

Hypoglykemian oireita ovat:

  • hikoilu, vilunväreet, kalpeus
  • heikotus, vapina, hermostuneisuus, ahdistus
  • kiihtynyt pulssi
  • huimaus
  • pahoinvointi
  • väsymys
  • päänsärky
  • kihelmöinti

Hypoglykemian hoitamiseksi diabetesta sairastavan on saatava jotakin nopeaa hiilihydraattia, sokerivettä, makeisia tai glukagonitabletti. Hypoglykemia on hengenvaarallinen tila, jossa potilas tarvitsee nopeasti lääkärin apua.

Ilman asianmukaista hoitoa hiilihydraateilla tai glukagonilla hypoglykemia voi aiheuttaa:

  • kohtauksia
  • tajunnan menetyksen
  • kooman

Diagnoosi

Tyypin 1 diabetes alkaa usein nopeasti ja varoittamatta. Kun oireita ilmenee, potilaan on syytä hakeutua lääkärin vastaanotolle, jotta diagnoosi varmistuu ja asianmukainen hoito voidaan aloittaa.

Esidiabetesta ja alkavaa tyypin 2 diabetesta sairastavalla ei välttämättä ole minkäänlaisia sairauteen viittaavia oireita. Aikuistyypin diabetes varmistuu verikokeilla mitattavalla glukoosilla.

Lihavien sekä muiden aikuistyypin diabeteksen riskiryhmään kuuluvien olisi hyvä tarkistuttaa veren glukoosipitoisuus säännöllisesti. Kohonneisiin glukoositasoihin on tärkeää reagoida nopeasti, koska näin taudin kehittymisen voi parhaimmillaan estää ja usein ainakin hidastaa. Testejä:

Verikokeiden tulosten perusteella tutkittavan verensokeritaso selvittää mahdollisen esidiabeteksen tai aikuistyypin diabeteksen.

Tyypin 1 diabeteksen hoitomahdollisuuksia immunosuppressiivisilla lääkkeillä tutkitaan, mutta vaikutukset ovat vielä epäselviä. Myöskään aikuistyypin diabetekseen ei tunneta parantavaa hoitoa, mutta elämäntapamuutokset ja suolen ohitusleikkaus voivat kääntää taudin suunnan ja johtaa remissioon.

Silputtu paprika, sipuli, valkosipuli ja chili


Kannattaisiko ketoilu?


1. Vähähiilihydraattinen ruokavalio auttaa painonpudotuksessa

Rasvan muuttaminen energiaksi edellyttää enemmän työtä kuin hiilihydraattien käyttäminen energiaksi. Kun elimistölle ei tarjota helppoa energiaa hiilihydraattien muodossa, elimistön on turvauduttava rasvavarastoihin. Tämä nopeuttaa laihtumista. Rasva myös pitää kylläisenä, mikä vähentää kokonaisenergian saantia. Brasilialaistutkimus osoitti, että vähän hiilihydraatteja sisältävä ruokavalio on kaloreita rajoittamista tehokkaampi laihduttamisessa:

”The role of very-low-carbohydrate ketogenic diets (VLCKD) in the long-term management of obesity is not well established. The present meta-analysis aimed to investigate whether individuals assigned to a VLCKD (i.e. a diet with no more than 50 g carbohydrates/d) achieve better long-term body weight and cardiovascular risk factor management when compared with individuals assigned to a conventional low-fat diet (LFD; i.e. a restricted-energy diet with less than 30% of energy from fat). Through August 2012, MEDLINE, CENTRAL, ScienceDirect,Scopus, LILACS, SciELO, ClinicalTrials.gov and grey literature databases were searched, using no date or language restrictions, for randomised controlled trials that assigned adults to a VLCKD or a LFD, with 12 months or more of follow-up. The primary outcome was bodyweight. The secondary outcomes were TAG, HDL-cholesterol (HDL-C), LDL-cholesterol (LDL-C), systolic and diastolic blood pressure,glucose, insulin, HbA1c and C-reactive protein levels. A total of thirteen studies met the inclusion/exclusion criteria. In the overall analysis,five outcomes revealed significant results. Individuals assigned to a VLCKD showed decreased body weight (weighted mean difference -0·91 (95% CI -1·65, -0·17) kg, 1415 patients), TAG (weighted mean difference -0·18 (95% CI -0·27, -0·08) mmol/l, 1258 patients) and diastolic blood pressure (weighted mean difference -1·43 (95% CI -2·49, -0·37) mmHg, 1298 patients) while increased HDL-C(weighted mean difference 0·09 (95% CI 0·06, 0·12) mmol/l, 1257 patients) and LDL-C (weighted mean difference 0·12 (95% CI 0·04,0·2) mmol/l, 1255 patients). Individuals assigned to a VLCKD achieve a greater weight loss than those assigned to a LFD in the longterm; hence, a VLCKD may be an alternative tool against obesity.”

2. LCHF voi suojata aivoja

Joidenkin tutkimusten mukaan ketoilu suojaa aivoja mm. ikääntymiseen liittyviltä muistisairauksilta kuten dementialta ja Alzheimerin taudilta sekä neurodegeneratiiviselta Parkinsonin taudilta. Kirjoitin aiemmin tutkimuksesta, jonka mukaan vähän hiilihydraatteja ja runsaasti rasvaa sisältävä ruokavalio voi vaikuttaa suotuisasti etenevään multippeliskleroosiin. Tutkimuksia tarvitaan enemmän. On kuitenkin viitteitä siitä, että ketogeenisellä ruokavaliolla on aivojen hyvinvointia suojaavia ominaisuuksia. Tutkimuksissa on havaittu, että ketogeeninen ruokavalio parantaa unen laatua ja lisää lasten tarkkaavaisuutta ja oppimiskykyä. Kyllä vain. En keksinyt omasta päästäni. Lue tästä.

Entä se diabetes ja ketoilu?

Ketogeeninen LCHF-ruokavalio auttaa aikuistyypin diabetesta sairastavaa ylläpitämään terveitä verensokeritasoja.

Hiilihydraatit kohottavat veren glukoosipitoisuutta enemmän kuin muut ruoat ja sen vuoksi haiman on eritettävä vereen enemmän insuliinia.

Hiilihydraattien vähentäminen auttaa tasapainottamaan veren glukoositasot ja estämään verensokerin suuria heilahduksia. LCHF ruokavalio laihduttaa ja vaikuttaa myös elimistön hiljaista tulehdusta (inflammaatio) hillitsevästi.

Tästä huolimatta LCHF ei ole yksinkertaisesti helvetin hyvä ruokavalio. Se voi helposti johtaa välttämättömien vitamiinien, mineraalien, kuitujen ja antioksidanttien liian vähäiseen saantiin, mikä voi aiheuttaa monia muita terveysongelmia. Tähän jokaisen ketoilijan on syytä suhtautua riittävällä hartaudella ja vakavuudella. Välttämättömät ravintoaineet ovat välttämättömiä, koska elimistö ei toimi oikein ilman niitä.

Yleisesti ottaen erittäin vähän hiilihydraatteja sisältävä ruokavalio sisältää vain 10-50 grammaa hiilihydraatteja vuorokaudessa, vähän hiilihydraatteja sisältävä ruokavalio on sellainen, jossa hiilihydraattien saanti rajoitetaan 50-100 grammaan päivässä ja kohtuullisesti hiilihydraatteja sisältävä ruokavalio sisältää 100-225 g hiilihydraatteja päivässä. Nämä ovat lukuja ja luvut ovat abstrakteja. Ihmisten tarpeet vaihtelevat ja omaa kehoa on syytä kuunnella tarkasti. Ilman varavarjoa ei pidä hypätä tuntemattomaan. On ihan järkevää ensin selvittää mistä on kyse ja millaisia mahdollisia riskejä radikaaliin ruokavaliomuutokseen voi liittyä.

Eräs varteenotettava vaihtoehto on laskea päivittäistä hiilihydraattien saantia tasaisesti ja seurata samalla millaisia vaikutuksia hiilihydraattien vähentämisellä on veren glukoositasoihin, verenpaineeseen, painoon, yleiseen jaksamiseen jne. Tällaiseen päästään pienillä muutoksilla. Lisätyistä sokereista, valkoisista jauhoista, makeisista, virvoitusjuomista, mehuista yms. on helppo luopua, eikä se edellytä radikaalia elämäntapamuutosta. Leivän voi korvata täysjyväleivällä, pastan ja riisin täysjyväversioilla ja runsaasti tärkkelystä sisältäviä perunoita voi vähentää.

Mitä sitten saa syödä ja mitä ei?

Tästä vallitsee lukemattomia koulukuntia ja jokainen on aivan ehdottomasti omasta mielestään täysin oikeassa. Viime aikoina LCHF-skeneen on liittynyt virallisia ravitsemussuosituksia painottavia virallis-vähähiilihydraattisia tendenssejä.  Eli hiilihydraattien rajoittamisen ohella kehotetaan myös välttämään rasvoja ja suosimaan rasvattomia lihoja. Ei kai siitä haittaa ole, mutta LCHF-ruokavalio lähtee ajatuksesta, että hiilihydraateista saatava energia korvataan rasvasta saatavalla energialla. Siihen ei vähärasvaiset tuotteet sovi.

  • sallittuja vihanneksia (kaalit, parsa, vihreät lehtivihannekset, kesäkurpitsa, tomaatit, paprika jne.)
  • esimerkiksi liha, kana, kala, pähkinät,
  • virallisesti suositellaan rasvoiksi margariinia, oliiviöljyä, rypsiöljyä, mutta minä syön myös voita
  • chia-siemenet (kuituja, proteiinia ja hyviä rasvoja)
  • lanttu

Ruokavalion tavoitteista riippuen hedelmiä voi syödä niukasti. Hedelmät sisältävät sokeria, mutta myös monia kehon tarvitsemia ravintoaineita hyvässä muodossa. Hedelmä on kuitenkin terveellisempi vaihtoehto kuin makeiset.

Ruokavaliossa tulisi välttää:

  • valmisruokia ja suolaisia snacksejä
  • runsaasti sokeria sisältäviä herkkuja: kakkuja, makeisia, leivoksia, keksejä, virvoitusjuomia, mehuja
  • tärkkelystä sisältäviä vihanneksia: peruna, maissi, riisi
  • olutta ja alkoholia, mutta erityisesti olutta ja sokeria sisältäviä alkoholeja
  • valkoista pastaa

Täysjyväleivät, linssit ja pavut sisältävät runsaasti hiilihydraatteja, mutta ruokavalion tavoitteista riippuen niitä voi satunnaisesti syödä niiden sisältämien tärkeiden ravintoaineiden vuoksi.


Kuinka hiilihydraatit vaikuttavat diabetekseen?


Vähähiilihydraattinen ruokavalio on eräs tehokkaimmista tavoista hallita verensokeria aikuistyypin diabeteksessa. Insuliiniresistenteillä ihmisillä veren glukoositasot voivat pysyä korkeina tunteja syömisen jälkeen. Runsaasti hiilihydraatteja sisältävä ruoka ei pidä kylläisenä, vaan ruokahalu palaa pian, vaikka elimistöllä ei olisi energiantarvetta. Tämä johtaa helposti naposteluun ja lihomiseen. Lue tästä.

LCHF

  • lisää energiaa, tarkkaivaisuutta ja parantaa unenlaatua
  • laskee veren keskimääräistä glukoositasoa ja HbA1c-tasoja
  • vähentää napostelua ja makeanhimoa
  • pienentää hypoglykemian riskiä
  • auttaa pudottomaan painoa tehokkaasti ja ilman nälkää
  • laskee diabetekseen liittyvien komplikaatioiden riskiä
  • laskee kolesterolia

Ketoosi on normaali aineenvaihduntaprosessi. Kun elimistöllä ei ole riittävästi glukoosia solujen energian tuotantoon, aineenvaihdunta turvautuu varastorasvoihin, joista valmistetaan energiantuotantoon kelpaavia ketoaineita.

Ketogeenisellä ruokavaliolla (kuten Atkinsin ruokavalio) tavoitellaan ketoosia, jossa keho pakotetaan käyttämään läskiä polttoaineena. Hiilihydraatit ovat elimistön tärkein polttoaine, koska olemme opettaneet kehon käyttämään hiilihydraatteja energianlähteenä.

Elimistö osaa kuitenkin tuottaa energiaa varastoimastaan rasvasta. Se on oikeastaan rasvan keräämisen eli lihomisen tärkein pointti: rasva on varastoenergiaa.

Elimistö käyttää varastoenergiaa sitten, kun helppoja hiilihydraatteja ei ole saatavilla. Niin pitkään, kun elimistöä hemmotellaan herkullisilla sokereilla, rasvasolujen purkaminen energiaksi ei pääse alkamaan. Oleellista on veren insuliinipitoisuus. Kun veressä on insuliinia, glukagonia ei vapaudu. Glukagoni kuitenkin on välttämätön hormoni sokeri- ja rasvavarastojen purkamisessa. Vasta kun glukoosi loppuu ja insuliinin määrä laskee, glukagoni aloittaa rasvan muuttamisen energianlähteeksi kelpaavaan muotoon.

Käytännössä myös kaloreita rajoittamalla (vähärasvaisella) ruokavaliolla päästään samaan, mutta siinä hiilihydraateilla ”tekohengitetään” sokeripolttoista konetta, joten laihtuminen on ensimmäisten kuukausien aikana hitaampaa, ja nälkä sekä ruokaan liittyvät mielihalut suurempia. Myös vähärasvainen ruokavalio pakottaa elimistön turvautumaan varastorasvoihin, mutta hitaammin, koska helppoa glukoosia tarjotaan kokoa ajan.

Totesin aiemmin, että ketogeeninen ruokavalio ei ole suositeltava tyypin 1 diabetesta sairastaville. Ketoasidoosin riski siinä on suurempi kuin terveillä ja tyypin 2 diabetesta sairastavilla.

Tyypin 1 diabetesta sairastavat voivat hieman vähentää hiilihydraattien saantia välttääkseen verensokerin piikkejä, mutta vähähiilihydraattisella ruokavaliolla ei kannata leikkiä. Diabetes on hyvin vakava sairaus ja hiilihydraatit tyypin 1 diabeteksessa voivat olla elämän ja kuoleman asia.

Ketoosi

  • Ketoosi käynnistyy, kun elimistöllä ei ole riittävästi glukoosia solujen energiantuotantoon
  • Ketoosissa varastorasvoja muutetaan solujen energianlähteeksi kelpaaviksi ketoaineiksi
  • Ketoaineet ovat happoja ja niiden lisääntyminen lisää veren happamuutta
  • Hallitsematon ketoosi tyypin 1 diabetesta sairastavilla voi johtaa ketoasidoosiin eli happomyrkytykseen, joka on diabetesta sairastavalle hengenvaarallinen tila.

Onko LCHF sitten terveellistä?

On ja ei ole. Jos ketogeeniseen ruokavalioon saa lisättyä välttämättömät ravintoaineet, kuituja ja antioksidantteja, ketogeeninen ruokavalio voi olla hyvin terveellinen. Jos ruokavaliosta karsii kaikki kasvikset ja syö vain rasvaa ja proteiineja, se ei ole pidemmän päälle hyväksi. LCHF saattaa vaikuttaa suotuisasti esimerkiksi:

  • sydän- ja verisuonitauteihin
  • diabetekseen
  • metaboliseen oireyhtymään
  • aivojen terveyteen
  • kolesteroliarvoihin
  • verensokeriarvoihin
  • verenpaineeseen

Terveyshyödyt ovat seurausta terveellisempien ruokavalintojen, laihtumisen ja elimistön hiljaisen tulehduksen helpottamisen yhteisvaikutuksesta. Kuitujen ja hyvien rasvojen lähteeksi suosittelen esimerkiksi chia-siemeniä.

Ketogeenistä ruokavaliota hyödynnetään lääkärin valvonnassa epilepsiaa sairastavien lasten hoidossa, sillä se vähentää sellaisten lasten epileptisiä kohtauksia, joilla muista hoidoista ja lääkkeistä ei ole apua. On jonkin verran tutkimusnäyttöä myös siitä, että aikuiset epileptikot hyötyvät ketogeenisen ruokavalion noudattamisesta, mutta tämä edellyttää laajempia ja kattavampia tutkimuksia.

Ketoosi ja diabetes

Diabeetikoilla ketoosi kertoo siitä, että veressä ei ole riittävästi insuliinia glukoosin prosessoimiseen. Virtsanäytteen ketoaineet kertovat, että potilaan diabetes-hoidot eivät pure toivotulla tavalla.

Tyypin 2 diabetesta (non-insulin dependent diabetes eli NIDDM) sairastaville voidaan suositella ketogeenistä ruokavaliota. Heillä haima tuottaa yhä jonkin verran insuliinia, mutta solut eivät pysty hyödyntämään insuliinia tehokkaasti sokeriaineenvaihdunnassa.

Ketogeenisessä ruokavaliossa ravinnon sisältämien hiilihydraattien määrää vähennetään. Hiilihydraattien vähentämisen tarkoitus on laskea veren glukoositasoja. Kaikki hiilihydraatit muutetaan glukoosiksi tai tuhansista glukoosimolekyyleistä muodostuviksi glykogeeneiksi. Hiilihydraatit siis kohottavat veren sokeripitoisuutta.

Ketogeenistä ruokavaliota noudattavien diabeetikkojen on seurattava tunnollisesti veren ketoaineiden tasoja. Jos ketoaineiden määrä nousee liian korkeaksi, seurauksena voi olla ketoasidoosi.

Ketoosissa ketoaineiden määrä on noin kymmenesosa ketoasidoosiin verrattuna. Tyypin 1 diabetesta sairastavien riski saada ketoasidoosi on merkittävästi suurempi kuin tyypin 2 diabetesta sairastavilla.

Ketoasidoosi

Ketoasidoosissa veren ketoaineiden määrät nousevat poikkeuksellisen korkeiksi ja myrkyttävät elimistöä. Tämä on äärimmäisen vakava tila, joka diabeetikoilla edellyttää lääkärin hoitoa.

Ketoasidoosin voi laukaista useampikin tekijä. Usein siihen vaikuttaa jokin sairaus ja sen seurauksena häiriintynyt hormonien tuotanto, jolloin insuliinin vastavaikuttajia voi muodostua normaalia enemmän.

Ketoasidoosi voi myös aiheutua liian vähäisestä insuliinilääkityksestä tai

  • huumeiden käytön
  • stressin
  • fyysisen vamman
  • leikkauksen

seurauksena. Ketoasidoosi on selvästi yleisempi tyypin 1 diabetesta sairastavilla, koska näillä haima ei tuota insuliinia.

Ketoasidoosin varhaisia oireita ovat:

  • vatsakipu
  • sekavuus ja keskittymisvaikeudet
  • kuiva ja punoittava iho
  • kova jano ja kuiva suu
  • makeahkolta tai hedelmäiseltä haiseva hengitys
  • lisääntynyt virtsaamistarve
  • pahoinvointi ja oksentelu
  • hengen ahdistus, nopea hengitys

Esidiabetes: Mitä syödä ja mitä vältellä?

Diabeteksen ehkäisyyn tähtäävä ohjelma (Diabetes Prevention Program) on osoittanut, että laihtuminen laskee diabeteksen riskiä 16 % jokaista vuodessa laihdutettua painokiloa kohden.

Perinteisesti esidiabetekseen sairastuneita kehotetaan syömään vähärasvaisia, vähäkalorisia ja runsaasti kuituja sisältäviä ruokia. Onko sellainen hyvä ruokavalio? Ravinnosta saadun kokonaisenergian vähentäminen laihduttaa ja ylläpitää kyllä terveyttä.

Jo muutaman kilon karistaminen elopainosta laskee huomattavasti diabeteksen riskiä. Vuonna 2001 julkaistu suomalainen diabeteksen ehkäisytutkimus osoitti, miten esidiabetes-vaiheessa diabeteksen syntyä voidaan ehkäistä. Tutkimuksessa seurattiin 500 esidiabetes-diagnosoitua lihavaa henkilöä. Puolet heistä sai ohjausta- ravinto ja liikuntatottumuksiin ja puolet toimi vertailuryhmänä. Koeryhmän tavoitteina oli: 5 prosentin painonpudotus, ruoan rasvan vähentäminen (alle 30 prosenttiin päivittäisestä energiasta), kovien rasvojen välttäminen ja vähärasvaisten tuotteiden suosiminen, ravinnon kuitujen lisääminen (täysjyväviljat) ja kohtuullinen liikkuminen (esim. puolen tunnin kävelylenkki päivittäin). Vuoden seurannan jälkeen koeryhmä oli laihtunut 4 kiloa enemmän kuin vertailuryhmä. Neljän vuoden seurannan jälkeen diabetes todettiin koeryhmässä 11:lla ja vertailuryhmässä 23:lla.

Esidiabetes ja diabetes

Terveillä paaston verensokeri on aamulla vähintään 8 tunnin syömättömyyden jälkeen alle 6 mmol/l tasolla, eikä verensokeri nouse laboratoriossa tehtävässä sokerirasitustestissä yli 7,7 mmol/l.

Esidiabeteksessa aamun paastoverensokeri on välillä 6,1-6,9 mmol/l tai kun verensokeri nousee sokerirasitustestissä välille 7,8-11,0 mmol/l.

Diabeteksessa paaston verensokeri (IP-gluc) on aamulla 7 mmol/l tai korkeampi kahtena eri päivänä tai verensokeri sokerirasitustestissä ylittää arvon 11,0 mmol.

Niin kutsuttu ”pitkäaikaissokeri” voidaan mitata verinäytteestä määrittämällä veren punasolujen hemoglobiinin sokeroituminen sokerihemoglobiini- eli HBA1c-kokeessa. Tämä kuvaa noin parin kuukauden verensokeritasoa. Jos HBA-1c on yli 48 mmol/mol, todetaan diabetes.

Glykeeminen indeksi ja glykeeminen kuorma

Glykeeminen indeksi (GI) kuvaa ruoka-aineen imeytyvien hiilihydraattien aiheuttamaa muutosta verensokerissa verrattuna referenssiruoka-aineeseen. Tällä pyritään seuraamaan hiilihydraattien imeytymisnopeutta. Suuri GGI tarkoittaa sitä, että verensokeri nousee nopeasti ja vereen vapautuu paljon insuliinia. Pieni GI kertoo hiilihydraatin tasaisemmasta imeytymisestä ja vähäisemmästä vaikutuksesta verensokeriin. Korkean glykeemisen indeksin elintarvikkeita ovat mm. perunat, valkoinen riisi, leipä, keksit, makeiset, sokeri jne.

Verensokeria säätelee monet tekijät. Elimistö pyrkii ylläpitämään tasaista verensokeria sillä, että maksan glykogeeneista vapautuu glukagonin vaikutuksesta glukoosia verenkiertoon aterioiden välillä. Syöminen kohottaa verensokeria, jolloin haimasta vapautuu insuliinia verenkiertoon. Insuliini pysäyttää maksan glykogeenien purkamisen ja käynnistää sokerivarastojen täydentämisen.

GI-taulukko (100 kuvaa suurinta vaikutusta verensokeriin. GI 0 ei vaikuta verensokeriin)

Ruoka-aine GI Ruoka-aineen määrä, joka
sisältää 50 g hiilihydraattia
Hiilihydraattien määrä
100 g:ssa ruoka-ainetta
GK/ 100 g ruoka-ainetta
A                   
Ananas 81 462 11 9
Appelsiini 58 545 9 5
Appelsiinimehu 63 481 10 6
B
Banaani 72 250 20 14
Bataatti 77 268 19 15
C
Cashewpähkinät 30 192 26 8
Cornflakes 112 58 87 97
Croissant (voisarvi) 92 110 46 43
D
Dextrosol-rypälesokeri 146 55 91 133
G
Greippi 35 545 9 3
Greippimehu 66 625 8 5
H
Hapanleipä, ruis- 83 100 50 42
Hedelmäsokeri (fruktoosi) 26 50 100 26
Herneet, tuoreet 66 571 9 6
Hunaja 76 69 72 55
J
Jogurtti, kevyt,
hedelmiä ja sokeria
46 323 16 7
K
Kaali 99 750 7 7
Kauralese 76 100 12 9
Kauraryynipuuro 80 568 9 7
Kiivi 73 500 10 7
Kikherneet 39 250 20 8
Kirsikka 30 500 10 3
Ksylitoli 11 50 100 11
Kurpitsa keitetty 104 1000 5 5
Kuskus 90 431 12 11
L
Laktoosi 63 50 100 63
Lanttu 99 750 7 7
Leipä, hampurilais- 84 100 50 42
Leipä, täysjyväruis- 80 107 47 38
Linssit, punaiset 36 417 12 4
Linssit, vihreät 41 441 11 5
Luumu 54 500 10 5
M
Maapähkinät 19 417 12 2
Maissi, pakaste 67 270 18 67
Maissi, tuore 73 234 21 15
Maito, 0,5 % 44 962 5 2
Maito, 0,1 % 44 962 5 2
Makaronit 65 188 27 18
Mango 70 353 14 10
Mansikat 55 2000 3 2
N
Nektari 94 500 10 9
Nuudelit, mungopapu- 46 200 25 11
Nuudelit, pika- 65 225 22 14
Nuudelit, riisi- 84 231 22 19
Näkkileipä 95 63 79 75
O
Ohraleipä, täysjyvä- 39-66 100 50 20-33
Omena 52 400 13 7
Omenamehu 55 431 12 7
P
Pannukakut 92 69 73 67
Papaija 81 353 14 11
Patonki 131 100 50 66
Pavut, kidney- 39 300 17 7
Pavut, säilykekidney- 72 441 11 8
Pavut, mung- 43 441 11 5
Pavut, idätetyt mung- 35 441 11 4
Pavut, musta- 28 300 17 5
Pavut, mustasilmä- 58 250 20 12
Pavut, pinto- 54 288 17 9
Pavut, ruskeat 33 100 50 17
Pavut, soija- 25 1250 4 1
Pavut, säilykesoija- 19 1250 4 1
Pavut, valkoiset,
tomaattikastikkeessa
66 500 10 7
Pavut, vihreät 52 242 21 11
Persikka 58 545 9 5
Persikka, säilyke sokeriliemessä 79 353 14 11
Peruna, keitetty, jauhoinen 90 300 17 15
Peruna, keitetty, kiinteä 80 300 17 14
Peruna, raaka 79 357 14 11
Perunamuusi 102 375 13 13
Porkkana, keitetty 80 667 8 6
Porkkana, raaka 22 500 10 2
Porkkanamehu 59 543 9 5
Popcorn 99 91 55 55
Punajuuri 88 571 9 8
Päärynä 52 545 9 5
R
Ranskalaiset perunat 104 259 19 20
Riisi, basmati- 80 197 25 20
Riisi, esikeitetty 65 208 24 16
Riisi, jasmin- 150 179 28 42
Riisikakut 126 60 83 104
Ruisleipä, kokojyvä- 69 125 40 28
Ruisleipä, pellavansiemenillä 57 78 100 50
Ruisleipä, täysjyvä- 89 100 50 45
Rusinat 88 68 73 64
Rypäleet 63 333 15 10
Rypälesokeri (glukoosi) 138 50 100 138
S
Soijamaito, kevyt- 61 735 7 4
Soijamaito, täys- 55 694 7 4
Sokeri 94 50 100 94
Spagetti, keitetty 10 – 15 min. 59 188 27 16
Spagetti, täysjyvä- 51 214 23 12
Sushi 72 135 37 27
T
Taatelit, kuivatut 142 75 67 95
Tattari 75 205 20 15
Tomaattimehu 52 1389 4 2
U
Uuniperuna 117 250 20 23
V
Vesimeloni 99 1000 5 5
Viikunat, kuivatut 84 15 43 36
Viili 15 136 4 1
Viinimarjat 30 500 10 3
Vohvelit 105 135 37 39

Taulukon lähde: Keittotaito

Glykeeminen indeksi on hyödyllinen työkalu hiilihydraattien ja niiden vaikutusten arviointiin. Esidiabetesta ja diabetesta sairastavien on tärkeää seurata hiilihydraattien määrää ja laatua. Mitä korkeampi GI, sitä nopeammin hiilihydraatit nostavat verensokeria.

Glykeeminen kuorma (glycemic load /GL)

Glykeeminen kuorma määrittelee ravinnon sisältämien hiilihydraattien laatua ja määrää. Sitä voidaan hyödyntää, kun lasketaan aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen. Pelkkä GI ei kerro koko totuutta. Vähäisellä määrällä korkean GI-arvon ruokia ei ole suurta vaikutusta verensokeriin, ja siksi on tärkeämpää arvioida koko aterian vaikutusta verensokeriin ja insuliinivasteeseen eli glykeemista kuormaa. GL lasketaan seuraavasti:

GI x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa arvioitaessa lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Mitä tämä tarkoittaa?

Täysjyväviljat ja runsaasti kuitua sisältävät ravintoaineet imeytyvät ruoansulatuskanavasta verenkiertoon hitaammin kuin ”nopeat hiilihydraatit”. Elimistö prosessoi sokerit ja raffinoidut hiilihydraatit nopeasti. Se kohottaa verensokerin nopeasti.

Korkea verensokeri ja happomyrkytys

Korkea verensokeri eli hyperglykemia aiheuttaa yleensä väsymystä, janon tunnetta, lisääntynyttä virtsaamistarvetta, pahoinvointia ja kuivumista. Pitkään jatkuessaan korkea verensokeri lisää riskiä sairastua diabeteksen lisäsairauksiin. Korkea verensokeri on 10-13,9 mmol/l ja hyvin korkea verensokeri yli 13,9 mmol/l.

Rasvahappojen aineenvaihdunta tuottaa ketoaineita, eli beetahydroksivoihappoa, asetetikkahappoa ja asetonia. Näiden määrä kasvaa elimistössä paastotilassa ja insuliininpuutoksen seurauksena. Ketoaineiden tuotanto on elimistön luontainen prosessi, mutta diabeetikoilla insuliinin puute voi johtaa elimistön happamoitumiseen ja happomyrkytykseen eli ketoasidoosiin, joka diabeetikoilla voi olla hengenvaarallinen tila. Ketoosi ja ketoasidoosi ovat kaksi eri asiaa.

Esidiabetesta sairastavien on tärkeää välttää sokeripiikkejä.

  • ruoat, joiden GI on 55 tai vähemmän, nostavat verensokeria hitaasti
  • ruoat, joiden GI on 56-69, kohottavat verensokeri keskinopeasti
  • ruoat, joiden GI on 70 tai suurempi, nostavat verensokeria nopeasti
  • Puhtaiden (raffinoitujen) sokereiden GI on yleensä korkeampi kuin luonnollisia sokereita sisältävien elintarvikkeiden, kuten hedelmien GI.
  • Täysjyväviljojen GI on matalampi kuin raffinoitujenviljojen GI.
  • Bataattien, useimpien vihannesten ja palkokasvien GI on pienempi kuin tärkkelystä sisältävien perunoiden ja maissin GI.
  • Hedelmien kypsyminen lisää hedelmän sokeripitoisuutta ja GI-arvoa.
  • Pastojen tärkkelyssidokset voivat olla sellaisia, että niillä on matalahko GI.
  • Esikiehautetun (parboiled) riisin, basmati-riisin ja täysjyväriisin GI on pienempi kuin lyhytjyväisten puuroriisien ja jasmiiniriisin GI.

Hiilihydraattien laskeminen

Hiilihydraattimäärien laskeminen voi helpottaa ruokavalion seuraamista. Hiilihydraattien täydellinen poistaminen ruokavaliosta ei ole suositeltavaa, sillä monet hiilihydraatteja sisältävät vihannekset sisältävät tärkeitä terveyttä ylläpitäviä ravintoaineita.

Toisaalta monet vähän hiilihydraatteja sisältävät ravintoaineet voivat korvata runsaasti hiilihydraatteja sisältävät ravintoaineet.

Esimerkiksi:

Seuraavat ruoat sisältävät runsaasti tärkkelystä eli hiilihydraatteja:

  • perunat
  • pavut ja linssit
  • riisi
  • viljat
  • maissi

Paljon hiilihydraatteja sisältävät kasvikset voi korvata mm. seuraavilla ravinne- ja kuitupitoisilla vähän hiilihydraatteja sisältävillä kasviksilla:

  • parsa
  • parsakaali
  • porkkanat (vähän)
  • selleri
  • vihreät pavut
  • salaatit ja tummanvihreät lehtivihannekset
  • paprika
  • pinaatti
  • tomaatti
  • kesäkurpitsa

Syö tasaisin väliajoin

Esidiabetesta sairastavan tulee pitää verensokeri mahdollisimman tasaisena.

Paastoaminen voi vaikuttaa merkittävästi verensokeritasoihin, joten pienet matalan- tai keskitason GI-arvon omaavat ruoat tasaisesti pitkin päivää pitävät verensokerin tasaisena ilman suuria piikkejä.

Asiantuntijat suosittelevat:

  • syömään kolmesti päivässä. Aterioiden välillä ei tulisi olla yli 6 tunnin jaksoa.
  • syömään tasapainoisesti ravinteiltaan rikasta, sopivassa suhteessa hiilihydraatteja, rasvoja ja proteiineja sisältävää ruokaa

Lautasmalli

Yksi tapa syödä terveellisesti ja tasapainoisesti on ns. lautasmalli, jota Yhdysvalloissa suosittelee paikallinen Diabetesliitto. Siinä puolet lautasesta täytetään vihanneksilla, neljännes proteiinia sisältävillä ruoka-aineilla ja neljännes hiilihydraateilla, kuten ruskealla riisillä tai kvinoalla.

Lautasmallissa jokaisen aterian tulee sisältää kolmea seuraavista neljästä ruoka-aineryhmästä.

  • hedelmä tai vihannekset
  • täysjyväviljat
  • maito- ja meijerituotteet
  • liha, kala, palkokasvit, linssit tms.

Laihtumisessa auttaa terveellisen ruokavalion lisäksi pienempi lautanen ja se, että välttää santsaamista ja ähkyksi syömistä.

DASH-dieetti

DASH on laajalti suositeltu ja terveelliseksi todettu ruokavalio. Sen tiedetään laskevan verenpainetta, mutta se voi myös ehkäistä diabetesta seuraamalla yhtäältä hiilihydraattien saantia ja toisaalta ravintoaineiden glykeemistä indeksiä.

DASH ei perustu kaloreiden vähentämiseen, vaan terveellisiin valintoihin.

DASH suosittelee syömään:

  • vihanneksia
  • hedelmiä
  • täysjyväviljoja
  • rasvattomia tai vähärasvaisia meijerituotteita
  • kalaa
  • siipikarjaa
  • papuja
  • pähkinöitä
  • kasvisöljyjä

Vältettäviä ruokia DASH-ruokavaliossa ovat esimerkiksi:

  • rasvaiset lihat
  • täysirasvaiset meijerituotteet
  • trooppiset öljyt, kuten kookosöljy ja palmuöljy
  • makeiset
  • vaaleat leivät
  • leivonnaiset, snacksit, keksit
  • makeat juomat

Pahoittelut, jos tekstiin jäi ylettömästi toistoa, asia- ja/tai kirjoitusvirheitä. Siinä oli tiistain ja keskiviikon välisen yön anti Ruokasodalle. Ehkä tuosta jotain oppi. Jokseenkin noin homma toimii ketogeenisen ruokavalion ja diabeteksen kanssa, mutta toki asioita  voi käsitellä toisesta näkövinkkelistä ja laajemminkin.

Ravitsemuksen osalta konsensuksen löytäminen on mahdotonta. Todetaan siis sama, mitä totesin aiemmin: On monta tapaa syödä oikein ja monta tapaa syödä väärin.

Kuvat: Pixabay tai ja huonommat kuvat ovat omia




Mitä, miten ja miksi LCHF-ruokavalio?

Mitä, miten ja miksi LCHF`Vähän hiilihydraatteja ja runsaasti rasvoja sisältävässä ruokavaliossa (LCHF) hiilihydraattien saantia korvataan hyvillä rasvoilla. LCHF-ruokavaliot (ketogeeninen ruokavalio ja Atkinsin dieetti) ovat suosittuja etenkin laihduttajien keskuudessa, sillä ne laihduttavat nopeasti ja tehokkaasti.

Vähän hiilihydraatteja sisältävässä ruokavaliossa elimistö opetetaan käyttämään energianlähteenä sekä ravinnosta saatua että rasvasoluihin varastoitua rasvaa, josta aineenvaihdunta valmistaa energiaravinteiksi kelpaavia ketoaineita.

Lääketieteellisesti suhtautuminen LCHF-dieetteihin on hyvin kaksijakoinen. Perinteisemmän rasvateorian mukaan rasvat ovat syypäitä lähes kaikkiin terveysongelmiin ja kaikkiin maailman muihinkin ongelmiin nälänhädästä Antti Rinteen hallitukseen.

Kasvavan tutkimusaineisto haastaa perinteiset ja fakkiutuneet opit rasvojen haitallisuudesta. Yleistä tieteellistä konsensusta rasvojen terveyshaitoista ja -hyödyistä ei kuitenkaan vallitse.


Miten noin niin kuin aikuisten oikeasti? Kannattaako ketoilu?


Täällä Ruokasodan ketonurkkauksessa haluan tarjota objektiivisen ja kattavan kuvan ketogeenisistä ruokavalioista, Atkinsin dieetistä ja muista pahamaineisista moraalia ja terveyttä turmelevista LCHF-ruokavalioista. Yritän tarjota terveellisiä LCHF-reseptejä ja vinkkejä ketoiluun. Katsotaan kuin tämä etenee.

Lähdin tähän seikkailuun 02.12.2019. Aiemmat kokemukseni vähähiilihydraattisesta ruokavaliosta olivat hyvin rohkaisevia, mutta niistä on jo vuosia. Sen jälkeen vyötärönympärys on harpannut kolme paitakokoa ja paino 20 kiloa. Tervetuloa mukaan!

Asetun itse ruokavalion keskiöön koekaniiniksi. Kommentoin ketonurkkauksessa viimeaikaista keskustelua ketogeeenisten ruokavalioiden ympärillä, tuoreita tutkimuksia ja uutisia sekä omia havaintojani. Lähtöpainoni on 92 kg ja vyötärölihavuus alkaa olla hengenvaarallisella tasolla. Lisäksi sairastan etenevää multippeliskleroosia, mikä vaikuttaa fyysiseen aktiivisuuteen sitomalla minut käytännössä tuoliin. Tavoitepainoni on 72 kg. Verenpaineeni ovat nyt riskirajoilla (keskimäärin 80-90 alapaine ja yläpaine 135-150 tasolla).

Vähän hiilihydraatteja, mutta runsaasti rasvaa ja proteiineja sisältävä ruokavalio ylläpitää kylläisyyden tunnetta hiilihydraatteja paremmin. Tämän seurauksena ravinnosta saatu kokonaisenergia yleensä laskee, mikä edistää laihtumista. Kaikissa ruokavalioissa on kuitenkin muistettava turvata välttämättömien ravintoaineiden saanti. Se on terveyden kannalta olennaista.

Laihtumisen lisäksi LCHF-dieetti auttaa ylläpitämään terveyttä, kuten European Journal of Clinical Nutrition kertoo katsauksessaan. Tuoreiden tutkimusten valossa LCHF-ruokavaliolla on suotuisia vaikutuksia

  • aikuistyypin diabetekseen
  • eräisiin syöpiin
  • munasarjojen monirakkulaoireyhtymään (PCOS)
  • Alzheimerin tautiin
  • sydämen terveydelle
  • etenevään multippeliskleroosiin

Varoituksen sana on paikallaan: tutkimukset ovat antaneet ristiriitaisia tuloksia LCHF-ruokavalioiden terveysvaikutuksista. Vähän hiilihydraatteja, kohtuullisesti proteiineja ja runsaasti rasvoja sisältävien ruokavalioiden pitkäaikaisvaikutuksia ei vielä tunneta.

Lääketieteellisessä Lancet-julkaisussa esitetyn tutkimuksen mukaan LCHF lisää kuolleisuutta kaikkiin syihin, mutta sama ilmiö toteutuu U-käyrän toisessa päässä; myös eniten hiilihydraatteja syövien kuolleisuus kasvaa saman tutkimuksen perusteella verrokkeihin nähden. Mistä tällainen voisi johtua?

On luultavaa ja jopa todennäköistä, että molemmissa ääripäissä ruokavalion yksipuolisuuden vuoksi syntyy puutoksia välttämättömistä ravintoaineista. Erään toisen tutkimuksen mukaan terveyden kannalta tärkeintä ei ole se, kuinka monta pizzaa tai hampurilaista syö, vaan se, että samalla saa kaikki välttämättömät ravintoaineet. Välttämättömien ravintoaineiden merkitystä terveydelle ei voi korostaa liikaa.

On jännä, että varsin monille LCHF-ruokavalio on punainen vaate, joka herättää suoranaista raivoa. Samanlainen vihainen asennoituminen on havaittavissa suhtautumisesta kasvisruokaan, lihan rajoittamiseen, vegaanisuuteen ja paleo-dieetin noudattamiseen. Yhteistä kaikille näille ruokavalioille on se, että niillä pyritään ylläpitämään terveyttä. Jonkin rajatun ruokavalion noudattaminen johtaa nopeasti paljon syvällisempään ravintoaineiden ja aineenvaihdunnan ymmärtämiseen, kuin mihin raivokkaimmat ruokavalioiden vastustajat koskaan yltävät. Miksi sortua trendikkäisiin ruokavalioihin, jotka muuttuvat nopeammin kuin muoti?

En halua asettaa ruokavalioita paremmuusjärjestykseen. Useimmat niistä painottavat välttämättömien ravintoaineiden saantia ja karsivat epäterveellisiä tai elimistön kannalta turhia ravintoaineita pois. On valtavasti tutkimusnäyttöä siitä, että esimerkiksi kasvisruokavaliot ja vegaanisuus ovat oikein noudatettuina hyvin terveellisiä.


Tärkeimmät syyt miettiä mitä suuhunsa laittaa ovat


Aikuistyypin diabetes

The International Diabetes Federation arvioi maailmanlaajuisesti aikuistyypin diabetekseen sairastuneiden määräksi yli 400 miljoonaa vuonna2015. Sairastuneiden määrä lisääntyy nopeasti.

Tutkimusten mukaan Yhdysvalloissa esidiabetesta sairastaa yksi kolmesta aikuisesta ja yhdeksän kymmenestä esidiabetesta sairastavasta ei tiedä olevansa sairas ennen kuin esidiabetes pahenee diabetekseksi. Pelkästään Yhdysvalloissa aikuistyypin diabetesta sairastavia on lähemmäksi 10 % väestöstä ja joka vuosi diagnosoidaan 1,4 miljoonaa uutta sairastunutta. Yhdysvalloissa diabeteksen hoitomenot olivat 245 miljardia dollaria vuonna 2012 ja kasvavat vuosittain.

Maailmanlaajuisesti diabetes aiheutti arviolta 1,5 miljoonaa ennenaikaista kuolemantapausta vuonna 2012. Sairastuneiden määrä, hoidon hinta ja kuolleisuus lisääntyvät joka vuosi.

Tyypin 2 diabetes on elintaso- ja elintapasairaus, johon vaikuttavat mm. lihavuus (erityisesti vyötärölihavuus), ikä, vähäinen liikunta ja huonot ravitsemustottumukset. Tutkimusten mukaan LCHF-ruokavaliot pienentävät sairastumisen riskiä ja vähentävät aikuistyypin diabetesta sairastavien lääkkeiden tarvetta. Esimerkiksi Ruotsissa LCHF on aikuistyypin diabeteksen hoidossa hyväksytty ruokavalio.


Lihavuus

Lihominen on maailmanlaajuinen ongelma. Se tappaa jo enemmän ihmisiä kuin aliravitsemus. Vuoden 1975 jälkeen lihavien määrä on kolminkertaistunut. Ylipainoisia aikuisia maailman väestöstä oli vuonna 2016 yli 1,9 miljardia. Näistä 650 miljoonaa eli 39 % oli lihavia. Alle 5-vuotiaista lapsista jopa 41 miljoonaa ja 5-19-vuotiaista 340 miljoonaa oli samana vuonna ylipainoisia tai lihavia. Luvut ovat käsittämättömiä. (WHO)

WHO:n mukaan ylipainoisia ovat ihmiset, joiden BMI (painoindeksi) on 25 tai suurempi. Lihavia ovat ihmiset, joiden BMI on 30 tai suurempi.

Lihavuus on lisääntynyt dramaattisesti. Lihavien ja ylipainosten osuus lapsista oli 4 % vuonna 1975. Nyt lapsista lähes viidennes (18 %) on ylipainoisia tai lihavia. Vuonna 1975 ylipainoisten ja lihavien 5-19-vuotiaiden osuus ikäryhmässä oli vain 1 %, vuonna 2016 saman ikäisten ylipainoisten ja lihavien osuus oli ikäryhmän tytöistä 6 % ja pojista 8 %.

Lihavuus kasvattaa mm. sydän- ja verisuonitautien, metabolisen oireyhtymän, aikuistyypin diabeteksen, syöpien, luunmurtumien ja erilaisten nivel- ja selkävaivojen sekä ennenaikaisen kuoleman riskiä.


Suolistotulehdukset (ärtyvän suolen oireyhtymä eli IBS)

Ärtyvän suolen oireyhtymä (IBS) vaivaa jopa 10-15 prosenttia maailman aikuisväestöstä. IBS ei sinänsä ole hengenvaarallinen sairaus, mutta sen vaikutukset elämänlaatuun ja terveydenhoidolliset kustannukset ovat merkittäviä. IBS on suurin sairauspoissaolopäivien syy tavallisen flunssan jälkeen.

Tulehdukselliset suolistosairaudet yleistyvät nopeasti. Suomessa myös paksusuolen syöpä lisääntyy, mutta lisääntymisen syytä ei tunneta.

Crohnin tauti ja haavainen paksusuolentulehdus ovat kroonisia suoliston tulehduksellisia sairauksia, jotka oireilevat mm. ripulina, verisenä ulosteena ja vatsakipuina. Molemmat edellyttävät perinnöllisen alttiuden sairastua, mutta sairastuminen käynnistyy usein jonkin infektion (kuten turistiripulin) tai stressin seurauksena. Riskitekijöitä ovat lisäksi runsaasti eläinperäistä proteiinia sisältävä ja rasvainen ruoka sekä D-vitamiinin puutos.

Ärtyvän suolen oireyhtymää sairastaa Suomessa jo noin 300 000 henkilöä ja esiintyvyys aikuisväestössä on 10 %. Diagnosoitujen keliakiatapausten ja tulehduksellisten suolistosairauksien esiintyvyys on 1 prosentin luokkaa molempien kohdalla.

Ärtyvän suolen oireyhtymän tavallisia oireita ovat: vatsan turvotus, vatsakipu sekä ummetus- ja ripulioireet. Oireiden taustalla voi olla mm.

Tavallista herkempi vatsan alueen kipuaistimus (alhainen kipukynnys)

  • Lisääntynyt kaasun tuotto paksusuolessa ja mahdollisesti ohutsuolessa
  • Häiriöitä suoliston mikrobitasapainossa
  • Matala-asteinen tulehdus suolessa
  • Suoliston voimakas ja kivulias supistelu tai suolen toiminnan laiskistuminen


    FODMAP-hiilihydraattien (fermentoituvien hiilihydraattien) rajoittaminen helpottaa viimeaikaisen tutkimusnäytön perusteella ärtyvän suolen oireyhtymää. FODMAP-hiilihydraatit ovat kasvikunnan tuotteissa esiintyviä huonosti ohutsuolessa imeytyviä kuitumaisia hiilihydraatteja. FODMAP-hiilihydraattien huono imeytyminen ohutsuolessa päästää näitä paksusuoleen, jossa ne fermentoituvat paksusuolen mikrobien vaikutuksesta. Fermentaatio on sinänsä aivan luonnollinen ja hyvä reaktio, mutta IBS-potilailla se aiheuttaa oireita.

    Laktoosi-intoleranteilla ihmisillä oireita aiheuttaa maitotuotteet. Ksylitoli, sorbitoli, laktitoli, maltitoli, mannitoli ja isomalti, luumut ja kivelliset hedelmät, omenat, sienet, raffinoosi, inuliini, vehnä, ruis, ohra, palkokasvit, sipulit, kaalikasvit ja vesimelonit, jogurtit ja fruktoosi selittävät oireita monilla ärtyvän suolen oireyhtymää sairastavilla.

Kesäkuussa 2009 Clinical Gastroenterology and Hepatology -lehdessä julkaistun tutkimusraportin mukaan hyvin vähän hiilihydraatteja sisältävä ruokavalio helpottaa ärtyvän suolen oireyhtymän oireita. On jonkin verran tieteellistä näyttöä siitä, että suolisto-oireet helpottavat LCHF-ruokavaliolla.

Alkoholista riippumaton rasvamaksa (NAFLD)

Alkoholista riippumaton rasvamaksa yleistyy nopeasti myös Suomessa. Maksan vähäinen rasvoittuminen ei välttämättä ole vaarallista, mutta se voi johtaa vakavampiin sairauksiin, kuten NASH (non-alcoholic steatohepatitis), jossa maksan rasvoittuminen assosioituu maksan tulehdukseen. Se voi johtaa maksan arpeutumiseen ja maksakirroosiin. Rasvamaksa ei välttämättä juuri oireile ennen kuin se pahenee maksatulehdukseksi.

NAFLD liittyy lihomiseen, metaboliseen oireyhtymään, esidiabetekseen ja aikuistyypin diabetekseen. Mikä maksan rasvoittumista aiheuttaa. Tästä vallitsee useita tieteellisesti perusteltuja näkemyksiä. Tutkimuksissa on havaittu, että vakavampaan NASH-tautiin vaikuttavat mm.

– Oksidatiivinen stressi
– Inflammaatio
– Maksasolujen nekroosi eli maksasolujen kuoleminen
– Rasvakudoksen inflammaatio
– Suoliston mikrobiomin epätasapaino (huono bakteerikanta)

Alkoholista riippumattoman rasvamaksan riskitekijöistä lihavuus on ylivoimainen ykkönen. Lihavista kahdella kolmanneksella on rasvoittunut maksa. Insuliiniresistenssi ja aikuistyypin diabetes sekä PCOS kasvattavat myös maksan rasvoittumisen riskiä.

Tehokkain tapa hoitaa rasvoittunutta maksaa on laihduttaminen. Myös lisättyjen sokereiden ja aivan erityisesti teollisen fruktoosisiirapin saannin vähentäminen päivittäisestä energiansaannista on järkevää, koska fruktoosin aineenvaihdunta tapahtuu maksassa ja pieni osa fruktoosista muutetaan aina triglyserideiksi maksassa.

Vähän hiilihydraatteja ja runsaasti rasvaa sisältävistä LCHF-ruokavalioista ja niiden terveysvaikutuksista voidaan toki olla montaa mieltä, mutta varmaa on se, että oheiset ravitsemukseen liittyvät epidemiana leviävät sairaudet eivät johdu siitä, että kourallinen ihmisiä rajoittaa hiilihydraatteja ja korvaa merkittävän osan päivän energiansaannista rasvoilla.

Jos LCHF ei paranna mainittuja sairauksia, on todennäköistä, että oksidatiivisen stressin ja inflammaation hillitseminen sekä laihtuminen helpottavat oheisten sairauksien oireita ja laskevat sairastumisriskiä LCHF-ruokavaliolla.

Nykyiset elintavat, energiatiheät ja ravitsemukseltaan köyhät ruoat sekä stressi ja jatkuva kiire ylläpitävät ja levittävät lihavuusepidemiaa, metabolista oireyhtymää, suolistosairauksia, diabetesta, rasvamaksaa jne. Siksi mikä tahansa ruokavalio kasvisruokavaliosta välimerelliseen tai LCHF-ruokavalioon sekä ymmärrys ravintoaineista ja aineenvaihdunnasta voi laskea sairastumisen riskiä ja ylläpitää terveyttä ja terveellistä painonhallintaa.

Joskus lääketieteessä tuntuu olevan vallalla ajatus, että jos auto liikkuu, ei autolla kannata ajaa ennen kuin tiedetään mihin sen liikkuminen perustuu. Tarvitaan siis lisää tutkimuksia. Se on hyvä asia. LCHF toimii ja sitä noudattavat ihmiset raportoivat jatkuvasti laihtumisesta ja terveyden kohenemisesta, mutta teoriassa sitä ei kannata noudattaa, koska vielä ei sataprosenttisesti ymmärretä, miksi se toimii. LCHF-ruokavalion pitkäaikaisvaikutuksista ei ole olemassa tutkittua tietoa ja siksi siihen suhtaudutaan vielä hyvin varovaisesti. Jokaisen on järkevää kuunnella ja seurata oman elimistönsä lähettämiä viestejä.

Ruokasotaa aloitellessani vuosia sitten uskoin, että jos kysyn oikeat kysymykset, löydän myös oikeat vastaukset. Nykyään olen paljon skeptisempi. Uskon, että ei ole oikeita kysymyksiä ja oikeita vastauksia. Kaikkiin lupauksiin, joita nettivideoissa ja kirjoituksissa annetaan, kannattaa suhtautua terveen skeptisesti.

Helppoja ja yleispäteviä vastauksia vaikeisiin kysymyksiin ei ole. LCHF ei ole ruokavalio, joka soveltuu kaikille tai parantaa kaikki vaivat. Se on tehokas laihdutusruokavalio, joka tutkimusten mukaan voi vähentää oksidatiivista stressiä ja inflammaatiota. Stanfordin yliopistossa tehdyn tutkimuksen mukaan sekä kaloreita rajoittamalla että runsaasti rasvaa sisältävällä ruokavaliolla laihtuu, mutta molemmissa tutkimusryhmissä esiintyi paljon vaihtelua seurattujen henkilöiden laihtumisen suhteen.

Kesäkurpitsanuudelit


Okei, miten aloitan?


Aineenvaihdunta on mutkikas järjestelmä. Ihmisten painonhallintaan vaikuttaa lukemattomia tekijöitä stressistä hormoneihin ja perinnölliseen lihomisalttiuteen. Jotkut eivät liho ja toiset keräävät varastorasvoja luokattoman helposti ja nopeasti. Toisaalta joillekin arkiliikunta ja tasapainoinen ruokavalio riittävät hyvän terveyden ylläpitoon, kun taas sairaalloisen lihavien laihtuminen vaikuttaa jo mahdottomalta.

Jörn Donner totesi, että lukeminen kannattaa aina. Hän oli oikeassa. Sama pätee laihduttamiseen ylipainoisilla. Laihtuminen parantaa terveyttä ja lisää terveitä elinvuosia. Se, miten ihminen laihtuu, on vähemmän tärkeää kuin se, että ihminen laihtuu. Tavallaan on ristiriitaista, että ihmisiä syyllistetään ja pelotellaan onnistumisesta, perustuu onnistuminen sitten vegaaniruokavalioon tai Atkinsin dieettiin. Jos ihmisen verenkuva, paino, verenpaine, verensokeri ja yleinen hyvinvointi kohenevat, onko sillä väliä, päästiinkö tulokseen LCHF-ruokavaliolla vai kasvisruokavaliolla.

Tärkeintä on, että ihminen saa ravinnostaan kaikki välttämättömät ravintoaineet. Laajemmin on havaittu, että vähemmän energiaa sisältävä ravinto (syödyistä makroravinteista riippumatta) ylläpitää terveyttä ja terveitä elinvuosia. Tämä johtunee sirtuiineista (histonideasetylaaseista). Esimerkiksi SIRT1 säätelee keskeisiä metabolisia prosesseja ja sillä on tärkeä merkitys aineenvaihdunnan säätelyssä.

SIRT1 säätelee mm. mitokondrioiden biogeneesiä sekä energia- ja rasvametaboliaa, oksidatiivista stressiä ja vaikuttaa esimerkiksi lihavuuteen ja diabetekseen. SIRT1 säätelee todennäköisesti tulehdusvaisteita ja kudosten atrofioitumista sitoutumalla NF-kB:en. SIRT2 vaikuttaa solunjakautumiseen.

Henkilöiden, jotka päättävät kohentaa terveyttä ja laihtua LCHF-ruokavalion avulla, on syytä syödä hiilihydraattirajoitteista riippumatta mahdollisimman monipuolisesti.

On jonkin verran tutkimusnäyttöä, jonka mukaan kasviperäisten proteiinien ja rasvojen saanti LCHF-ruokavaliossa ylläpitää terveyttä paremmin kuin eläinperäiset rasvat ja proteiinit. Ruokavalion sallimia kasviksia on hyvä syödä runsaasti. Niistä saa kuituja, antioksidantteja, polyfenoleita, vitamiineja, mineraaleja jne., joita elimistö tarvitsee. Rasva on LCHF-ruokavaliossa polttoaine, mutta keho tarvitsee myös aminohappoja, kuituja, vitamiineja jne.

Ensimmäinen ja kenties yksi tärkeimmistä ravintoon liittyvistä valinnoista koskee lisättyjen sokereiden, valkoisten jauhojen ja voimakkaasti raffinoitujen elintarvikkeiden välttämistä. Pelkästään tämä pieni muutos elämäntavoissa voi auttaa laihtumaan ja parantamaan yleistä hyvinvointia. Vaaleat leivät kannattaa korvata täysjyväviljoista leivottuihin leipiin, makeisista ja virvoitusjuomista on hyvä luopua kokonaan jne.

Minä en laske kaloreita tai hiilihydraatteja lainkaan. Tiedän suurin piirtein, mitä kasviksia voin syödä ja sen jälkeen seuraan vain omaa kylläisyyttäni. Luultavasti saan päivittäisestä energiastani nyt yli puolet rasvasta, 30 prosenttia proteiineista ja 10-20 % hiilihydraateista. Se ei aivan noudata ketogeenistä ruokavaliota tai Atkins-ruokavaliota, mutta toisaalta olen luopunut lisätyistä sokereista, runsaasti tärkkelystä sisältävistä perunoista ja riisistä sekä viljoista ja korvaan noiden rajoittamisen tuottaman energiavajeen rasvoilla.

Tämä on kolmas päivä ruokavaliomuutokseni jälkeen. Kaksi ateriaa päivässä on pitänyt minut kylläisenä ja energisenä kahtena ensimmäisenä päivänä. Olen syönyt lounasbrunssin puolen päivän tienoilla ja päivällisen 17-18 aikaan.

Molempien päivien ruoka on koostunut suuresta määrästä sallittuja kasviksia (tomaatit, kurkku, kaali, paprika, salaatti, kesäkurpitsa), rasvasta ja proteiinista (jauheliha, kana). Mitään välipaloja tms. ei ole tehnyt mieli. Yhtenä huomiona olen havainnut, että suoli on toimin poikkeuksellisen hyvin ja täsmällisesti. Se on ilahduttavaa, sillä minulla on ollut ärsyttäviä suolistovaivoja.

Eilinen ruoka (0.12.2019)

Heräsin viiden aikaan. Join aamun ja aamupäivän aikana 4 kupillista mustaa kahvia. En ole koskaan ollut aamupalan ystävä.

Nälkä tuli kello 11 ja 12 välillä, jolloin tein kanasalaattia lounaaksi. Salaattiin tuli jäävuorisalaattia, kurkkua, tomaatteja ja keitettyjä vihreitä papuja. Paistoin ja maustoin (pippurilla, suolalla ja chilillä) kanafileistä leikkaamani suikaleet runsaassa voissa. Tein majoneesin itse: 2 dl rypsiöljyä, muna, korkillinen etikkaa, 0,5 tl suolaa, 1 tl mustapippuria, 1 tl valkosipulijauhetta, 1 tl chilimurskaa öljyssä, 2 tl currya. Näin syntyy hyvin kiinteä majoneesi, jota pehmensin 1,5 desillä rasvaista maustamatonta turkkilaista jogurttia. Sekoitin ainekset keskenään ja hyvää tuli. Se oli lounas.

Iltapäivällä join melkoisesti vettä. Päivälliseksi tein ison täytetyn kesäkurpitsan, johon tuli täytteeksi mm. paistettua jauhelihaa, tomaattikastiketta ja runsas juustokuorrutus. Päivällisen jälkeen join vielä 4 kupillista teetä.

Ruokavalion noudattamisessa on tärkeää seurata ja kuunnella omaa elimistöä

LCHF sisältää useita koulukuntia ja erilaisia ravintohifistelijöitä mahtuu jokaiseen koulukuntaan ruokavalioista riippumatta. En pidä hifistelyä tarkoituksenmukaisena. Pääpiirteitten ollessa selvät henkilön tulee kuunnella omaa elimistöään, eikä jotain gurua. Hiilihydraattien määrä LCHF-ruokavaliossa lasketaan maksimissaan 50 grammaa päivätasolle, mutta mieluummin vieläkin alemmalle tasolle, jos tarkoituksena on ketoosiin pääsy.

Atkinsin ruokavalio

Atkinsin ruokavalio koostuu neljästä vaiheesta:

  • Vaihe 1: Hiilihydraattien määrä lasketaan 20 grammaan päivässä. Tämä jatkuu 2 viikkoa.
  • Vaihe 2: Päivittäiseen syömiseen lisätään pähkinöitä, vähäisiä määriä hedelmiä ja vähähiilihydraattisia vihanneksia.
  • Vaihe 3: Asetetun painotavoitteen lähestyessä hiilihydraattien saantia voidaan lisätä.
  • Vaihe 4: Ruokavalioon otetaan mukaan täysjyväviljoja ja muita terveellisiä hiilihydraatteja sen verran, että paino pysyy tasaisena.

The ketogeeninen ruokavalio

Ketogeeninen ruokavalio rajoittaa hiilihydraatteja merkittävästi ja tähtää ketoosiin, jossa elimistö alkaa tehokkaasti käyttää rasvoja solujen energian lähteenä.

Ketogeeniset ruokavaliot jakautuvat opillisten ja tavoitteellisten erojen puitteissa eräänlaisiin koulukuntiin. Tavallisesti tavoitteena on laskea päivittäinen hiilihydraattien saanti 5-10 prosenttiin päivittäisestä energiasta. Määrällisesti tämä tarkoittaa noin 20-50 grammaa hiilihydraatteja/päivässä.

Ruokavalion tavoitteena on ketoosi, joka on luonnollinen tila, kun elimistö ei saa riittävästi energiaa hiilihydraateista. Ketoosissa elimistö alkaa pilkkomaan varastoimiaan rasvahappoja ketoaineiksi, joita solut voivat hyödyntää energian tuotannossa. Ketoosia ei tule sekoittaa vaaralliseen happomyrkytykseen, ketoasidoosiin. Ketoasidoosissa veren ketoainepitoisuudet nousevat jopa kymmenkertaisiksi ketoosiin verrattuna.

Kanasalaatti


Hyvin suunniteltu on puoliksi tehty


Kaikki ruokavaliot edellyttävät hieman valmistelua ja suunnittelua. Ongelmia syntyy, jos ruokavalio yksipuolistuu liikaa. Silloin se ruokavalion noudattamisesta tulee vaikeaa ja laihduttaminen loppuu nopeasti alkuinnostuksen jälkeen. Siksi on tärkeää suunnitella ruokavaliota niin, että se sisältää vaihtelua, monipuolisia raaka-aineita ja tarjoaa kaikki tarvitut ravinteet.


Mitä söisin tänään?


LCHF-ruokavalioissa hiilihydraattien rajoittaminen rajoittaa syötävien ruokien määrää. Tämä voi tuottaa motivaatio-ongelmia.

Alkavan ketoilijan kauppalista

– Cashew-pähkinät (hyviä rasvoja ja proteiineja)
– Lihat (possu, nauta, kana, kalkkuna, lammas)
– Kalat (erityisesti rasvaiset lohi, sardiinit ja makrilli)
– Juustot
– Voi
– Avokadot
– Öljyt (oliivi-, kookos-, avokado- ja pellavansiemenöljy)
– Pähkinät (maapähkinät, mantelit, cashew-pähkinät)
– Siemenet (auringonkukan siemenet, chia ja pellavansiemenet)
– Munat
– Pinaatti ja muut tummanvihreät lehtivihannekset
– Marjat (mustikat, mustaviinimarjat, mansikat )
– Parsakaali
– Kukkakaali
– Valkokaali
– Ruusukaali
– Parsa
– Kesäkurpitsa
– Tomaatit
– Paprika
– Myskikurpitsa
– Juomaksi (vesi, kahvi, tee)

Seuraavia voi ketogeenisella ruokavaliolla syödä hieman ruokavalion tavoitteista riippuen:

– Porkkanat (vähän)
– Punajuuret (vähän)
– Omena, vesimeloni tai persikka (vähän)
– Kvinoa (vähän)
– Bataatti (vähän)
– Pavut ja palkokasvit (vähän)
– Kauraa (vähän)
– Täysjyviä (vähän)

Rajoitettavia ruokia ovat

Kaikilla LCHF-ruokavalioilla rajoitetaan hiilihydraatteja ja aivan erityisesti puhtaita sokereita ja runsaasti tärkkelystä sisältäviä kasviksia, kuten perunoita ja riisiä. Ruokavalio ei suosittele virvoitusjuomia, mehuja, kakkuja, leivoksia, makeisia, fruktoosisiirapilla tai millään teollisilla makeutusaineilla makeutettuja raffinoituja elintarvikkeita tai alkoholisokereita. Muita rajoitettavia ovat:

  • valkoinen pasta
  • valkoinen riisi
  • leipä, sämpylät ja patongit
  • leivonnaiset, pullat, muffinssit jne.
  • makeiset
  • virvoitusjuomat, mehut
  • olut
  • dieettijuomat ja yleensäkin dieetti-mitkä tahansa
  • vähärasvaiset elintarvikkeet, sillä niissä rasvat on korvattu sokereilla

Kaikkia hiilihydraatti- ja tärkkelyspitoisia ruokia ei ole pakko poistaa ruokalistalta. LCHF-ruokavaliota voi noudattaa, jos siihen sisältyy rajoitetusti papuja ja muita palkokasveja sekä täysjyväviljoja. Niiden määrien tulisi olla vähäisiä, eikä niitä suositella päivittäiseen ruokavalioon.

Ja lopuksi

LCHF-ruokavaliot vaikuttavat eri ihmisiin eri tavoin. Korostan jälleen, että välttämättömien ravintoaineiden saannista tulee huolehtia, vettä tulee juoda riittävästi ja elimistöä pitää kuunnella. LCHF-ruokavaliot voivat aiheuttaa (ainakin kuurin alkuvaiheessa)

  • väsymystä ja heikkoutta
  • kramppeja
  • päänsärkyä
  • ummetusta tai ripulia
  • kutinaa
  • pahanhajuisen hengityksen

Kun elimistö sopeutuu ruokavalion muutoksiin, sivuoireet vähenevät ja katoavat. Tsemppiä ja hyvää terveyttä kaikille, jotka tämän tien valitsevat. Omat kokemukseni olivat ja ovat rohkaisevia, mutta nähtäväksi jää. Oli LCHF-ruokavalio terveellinen tai ei, se ei ainakaan voi olla huonompi vaihtoehto kuin ravinneköyhien ja energiatiheiden transrasvoja runsaasti sisältävien eines- ja pikaruokien, makeisten ja makeiden virvoitusjuomien ahmiminen pitkin päivää.

Kuvat: Pixabay




Ketogeeninen ruokavalio ja MS

Noudatin vähähiilihydraattista ruokavaliota vuosia sitten. Kokeilu jäi vain vajaan vuoden mittaiseksi, mutta kokemukseni olivat sekä painonhallinnan että yleisen hyvinvoinnin kannalta rohkaisevia. Oloni oli erinomaisen hyvä ja painoni laski.

Ruokavalion noudattaminen kaatui jouluherkkuihin. Noiden aikojen jälkeen olen lihonut 20 kiloa ja rasvaa on kerääntynyt erityisesti keskivartalolle haitallisena viskeraalisena läskinä. On aika tehdä jotain.

Ketogeeninen ruokavalio ja MS selvittää vähän hiilihydraatteja ja runsaasti rasvaa sisältävän ruokavalion vaikutuksia etenevää MS-tautia sairastavan terveyteen. 

Ketogeeninen ruokavalio herättää voimakkaita tunteita. Monien on yhä vaikea hyväksyä sitä, että syöty rasva voi laihduttaa. Ketogeeninen ruokavalio kuitenkin toimii mainiosti laihdutusruokavaliona.

MS on siinä mielessä viheliäinen sairaus, että se vaikuttaa vääjäämättä fyysiseen aktiivisuuteen. Painoa alkaa kertyä huomaamatta. Minä olen nauttinut invaliditeetin tuomasta joutenolosta syömällä epäterveellisesti ja juomalla pikkukylän vuosittaista vedenkulutusta vastaavan määrän olutta. Siinäpä tekosyyt.

Mitä ketogeenisella ruokavaliolla tarkoitetaan?

Ketogeeninen dieetti on vähähiilihydraattinen ja runsaasti rasvaa sisältävä ruokavalio. Proteiinien määrä pidetään ruokavaliossa maltillisena.

Evidenssiä tämän ruokavalion hyödyistä laihdutusruokavaliona on runsaasti. Sen sijaan näyttö siitä, että ketogeeninen ruokavalio helpottaisi etenevän multippeliskleroosin oireita, on vähäistä.

Laihtumisella ja elimistön hiljaisen tulehduksen – inflammaation – hillitsemisellä on terveyttä edistäviä vaikutuksia. En usko, että ruokavalio tekee ihmeitä sairaudelleni, mutta toivon laihtuvani sen avulla.

Ruokavaliossa hiilihydraattien, kuten tärkkelyksen ja sokereiden määrää rajoitetaan. Tämä tarkoittaa, että monet yleiset ruoka-aineet, kuten perunat, pastat, riisi, leivät ja hedelmät ovat rajoitettavien ravintoaineiden listalla.

Lihakasvis-vartaat

Ruokavalion puolestapuhujat korostavat, että ketogeeninen ruokavalio voi auttaa laihtumaan ja hillitsemään keskushermostoa degeneroivia tulehdusreaktioita.

Ketogeenisen aineenvaihdunnan perusteet ja toivotut hyödyt

Ketogeeninen ruokavalio voi mahdollisesti hillitä multippeliskleroosin oireita. Mihin ruokavalio ja tällaiset väitteet perustuvat?

Ketogeenisen ruokavalion tarkoituksena on ohjata solujen energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Kehon energiantuotantoa säätelee monet hormonit ja entsyymit, joista ketogeenisen ruokavalion kannalta mielenkiintoisimpia ovat insuliini ja glukagoni.
Ketogeeninen ruokavalio perustuu pitkälti juuri insuliinin ja glukagonin toiminnan ymmärtämiseen ja hyödyntämiseen.

Solujen energiantuotanto

Solut rakastavat glukoosia, sillä se on helppo ja nopea energianlähde. Ruoansulatuskanavassa hiilihydraatit, kuten tärkkelystä sisältävät perunat ja riisi, pilkotaan sokereiksi ja muiksi ravinteiksi. Glukoosi kulkee ohutsuolen endoteelin läpi verenkiertoon eräiden glut-molekyylien kuljettamana ja kohottaa verensokeria.

Haima reagoi sokeripitoisuuden lisääntymiseen erittämällä vereen insuliinia. Insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, jolloin solun sisältämät solukalvon läpäisevät glukoosia kuljettavat kanavat tulevat solukalvolle. Näiden avulla glukoosi pääsee soluun.

Solun sytoplasmassa käynnistyy glykolyysi, jossa glukoosimolekyyli pilkotaan kahdeksi pyruvaatiksi. Reaktiossa syntyy myös kaksi korkeaenergistä ATP-molekyyliä ja kuusi vetyionia kumpaakin pyruvaattia kohden. Syntyneet 12 protonia pelkistävät NAD+ ja NADP+ (dyhydronikotiiniamidi-adeniini-dikuleotidi -fosfatti) ionit.

NADH ja NADPH molekyylit siirtävät protonit elektronisiirtoketjun käyttöön, jos happea on riittävästi soluhengityksen käynnistämiseen. Anaerobinen (hapeton) energiantuotanto loppuu siihen, että pyruvaatit pelkistyvät laktaatiksi.

Sitruunahappokierto
Kuvan lähde: Wikipedia

Aerobinen (hapellinen) energiantuotanto jatkuu soluhengityksenä sitruunahappokierrossa sellaisissa soluissa, joilla on käytettävänään happea ja mitokondrioita. Sitruunahappokierto (Krebsin sykli, trikarboksyylihappokierto (TCA-kierto)) käynnistyy sitraattisyntaasientsyymin katalysoidessa sitraatin muodostumista oksaaliasetaatista ja asetyylikoentsyymi-A:sta.  

Sitraatista kierto etenee isositraattiin, siitä alfa-ketoglutaraattiin, edelleen sukkinyyli-koentsyymi-A:han, sitten sukkinaattiin, edelleen fumaraattiin, sitten malaattiin, kunnes kierto palaa oksaaliasetaattiin. Tuloksena asetyyliryhmä on hapetettu täydellisesti hiilidioksidiksi ja kolme NADH:ta, yksi FADH2 ja yksi GTP on tuotettu. Ketoilijoiden kannalta oleellista on, että rasva muutetaan sitruunahappokierron väliaineeksi – asetyylikoentsyymi-A:ksi.

Ennen kuin hiilihydraatit ja rasvat voivat tulla mukaan sitruunahappokiertoon, solussa tapahtuvien muiden prosessien on muutettava ne sopivaan muotoon asetyyliryhmäksi, joka sitoutuu koentsyymi-A:n kanssa aktiiviseksi etikkahapoksi eli asetyylikoentsyymi-A:ksi.

 Mitokondrioissa tapahtuvassa sitruunahappokierrossa syntyy vielä parikymmentä korkeaenergistä ATP-molekyyliä ja protoneja elektroninsiirtoketjuun. Soluhengityksen lopputuotteena on vettä ja hiilidioksidia, jotka poistuvat ihon ja hengityksen kautta. Sokerit ja rasvat siis palavat solujen mitokondrioissa vedeksi ja hiilidioksidiksi. Glukoosi kelpaa sellaisenaan solujen energiantuotantoon. Rasvat ja proteiinit on ensin muokattava asetyylikoentsyymi-A:ksi ja sokerit glukoosiksi.

Kun elimistö pakotetaan hyödyntämään rasvasoluihin varastoitua rasvaa energianlähteenä, läskin palaminen tehostuu huomattavasti.

Kaikki sokerit eivät kelpaa suoraan energiantuotantoon, vaan ne pitää ensin muuttaa glukoosiksi ja glykogeeneiksi, jotka muodostuvat jopa kymmenistä tuhansista yksittäisistä glukoosimolekyyleistä. Ravinnosta saatavan fruktoosin aineenvaihdunta eli fruktolyysi tapahtuu maksassa. Suurin osa fruktoosista syntetisoidaan glykogeeneiksi maksan nopeisiin sokerivarastoihin. Osa fruktoosista muutetaan maksassa glukoosiksi, joka vapautuu verenkiertoon ja ravitsee solujen energiantarvetta. Pari prosenttia fruktoosista muutetaan maksassa suoraan triglyserideiksi eli varastorasvaksi. Fruktoosin aineenvaihdunta rasittaa ja voi pahimmillaan rasvoittaa maksaa. Ilmeisesti epidemiaksi äitynyt alkoholista riippumaton rasvamaksa palautuu väestön ylettömään sokerin kulutukseen.

Jos veressä on liikaa glukoosia solujen ravinteiksi sekä lihasten ja maksan glykogeenivarastoihin, aineenvaihdunta alkaa muuttaa sokereita triglyserideiksi eli varastorasvaksi de novo lipogeneesissa. Insuliini osallistuu myös rasvanhappojen varastoimiseen rasvasoluihin. Tähän perustuu sokereiden lihottava vaikutus.

Kun veren sokeripitoisuus laskee, haima erittää vereen glukagonia. Glukagoni on insuliinin vastavaikuttaja ja sillä on monia tärkeitä tehtäviä aineenvaihdunnan säätelyssä.

1. Glukagoni purkaa maksan glykogeenivarastoja glukoosiksi verenkiertoon solujen energiantuotannon turvaamiseksi ja lihasten glykogeenivarastoja lihasten energiantuotantoon.

2. Glukagonin vaikutuksesta rasvasoluihin varastoituja triglyseridejä vapautuu verenkiertoon. Maksassa ja munuaisissa käynnistyvät ketogeneesi ja glukoneogeneesi. Ne valmistavat verenkiertoon vapautuneista vapaista rasvahapoista yms. aineista solujen energiantuotantoon kelpaavia ketoaineita ja glukoosia. Glukoneogeneesi syntetisoi mm. vapaista aminohapoista ja sitruunahappokierron välituotteista glukoosia.

Verensokerin kohotessa insuliini keskeyttää ketogeneesin ja glukoneogeneesin.

3. Rasvahappojen beetaoksidaatio käynnistyy

Beetaoksidaatiossa rasvahappoketjusta muodostetaan ketohappoja siten, että kolmanteen hiileen liittyy ketoryhmä. Sen edellä oleva kahden hiilen mittainen ketju karboksyyliryhmineen irrotetaan muodostamaan asetyylikoentsyymi-A-molekyyli ja jäljellä oleva hiiliketju aloittaa ketohappojen muodostamisen alusta, kunnes ketju on pilkottu loppuun. Rasvahapon kohta, johon ketoryhmä muodostuu, joutuu ensin luovuttamaan 2 protonia, jotka NAD+ molekyylit siirtävät elektronisiirtoketjulle.

Ketogeenisessä ruokavaliossa elimistö alkaa aktiivisesti muuttaa varastoimiaan rasvoja energiaksi kelpaavaan muotoon, koska soluille ei tarjota helppoa ja nopeaa glukoosia energianlähteeksi. Keho siis pakotetaan polttamaan rasvaa. Tästä ketoosissa ja ketogeenisessä ruokavaliossa on kyse.

Aineenvaihduntaprosessi on täysin luonnollinen. Elimistö osaa käyttää rasvaa polttoaineena, mutta koska solut on lapsuudesta lähtien tehokkaasti opetettu käyttämään polttoaineena sokeria, rasvavarastoja ei juurikaan pureta; lihominen jatkuu niin kauan kuin tarjolla on helppoja hiilihydraatteja ja veren insuliinipitoisuus säilyy korkeana. Elimistö alkaa purkaa rasvavarastoja, kun sille ei tarjota helppoa energiaa. Tavallaan kaloreita merkittävästi rajoittamalla päädytään samaan tilanteeseen, jossa kehon on turvauduttava varastoenergiaan.


Ketoosin hyödyt

Elimistö menee ketoosiin, kun veren sokeripitoisuus ja sen seurauksena insuliinipitoisuus ovat matalat. Varsinainen ketoaineita tuottava ketoosi käynnistyy muutamassa vuorokaudessa, jos hiilihydraattien saantia rajoitetaan 20-50 grammaan vuorokaudessa. Kehon varastoimien rasvojen tehokas käyttö energianlähteenä alkaa noin kolmessa viikossa edellyttäen, että hiilihydraattien saanti pysyy hyvin matalana. Ketoosissa:

  • paino laskee ja elimistö käyttää tehokkaasti varastorasvoja energianlähteenä
  • muuttunut aineenvaihdunta suojaa soluja
  • inflammaatio ja hapetus-pelkistysreaktion epätasapainon seurauksena syntyneet happiradikaalit vähenevät ja antioksidatiiviset prosessit tehostuvat
  • stressihormonien määrä elimistössä ja stressitasot laskevat


Ketogeeninen ruokavalio ja MS

Eräs ketogeeniseen ruokavalioon liitetty vaikutus on se, että se suojelee elimistöä solutasolla vaikuttamalla hapetusstressiin (oksidatiivinen stressi). Verensokerin nousu assosioituu oksidatiiviseen stressiin ja se ylläpitää inflammaatiota.  

Lihavilla myös ylimääräinen rasvakudos ylläpitää elimistön tulehdustilaa, koska rasvakudos erittää erilaisia tulehdussytokiineja eli tulehdusta välittäviä aineita. Laihduttaminen vähentää tällaista inflammaatiota ja tehokas laihtuminen voi laskea tulehdusarvoja (CRP) merkittävästi ja siten parantaa yleistä terveyttä.  

Mitä tutkimukset sanovat?

Saksalaisen 2015 toteutetun seurantatutkimuksen perusteella ketogeeninen ruokavalio parantaa multippeliskleroosia sairastavien elämänlaatua. Tutkimuksen miinuksena on, että se oli hyvin pienimuotoinen (60 osallistujaa) ja kesti vain puoli vuotta.

Saman vuoden aikana ilmestynyt tutkimusraportti löysi viitteitä siitä, että ketogeeninen ruokavalio suojaa etenevää multippeliskleroosia sairastavien keskushermostoa etenevään multippeliskleroosiin assosioituvilta neurodegeneratiivisilta tuhoilta.

”Until recently, multiple sclerosis has been viewed as an entirely inflammatory disease without acknowledgment of the significant neurodegenerative component responsible for disease progression and disability. This perspective is being challenged by observations of a dissociation between inflammation and neurodegeneration where the neurodegenerative component may play a more significant role in disease progression. In this review, we explore the relationship between mitochondrial dysfunction and neurodegeneration in multiple sclerosis. We review evidence that the ketogenic diet can improve mitochondrial function and discuss the potential of the ketogenic diet in treating progressive multiple sclerosis for which no treatment currently exists.” Lue tutkimus
tästä.

Ketogeeninen ruokavalio näyttää hyödyttävän multippeliskleroosia sairastavia solutasolla. Se vähentää oksidatiivista stressiä ja lisää veren antioksidanttitasoja. Tämä suojaa hermo- ja aivosoluja neurodegeneraatiolta. Vastaavia havaintoja on tehty dementian ja Alzheimerin taudin kohdalla; ketogeeninen ruokavalio on tutkimuksissa liitetty pienempään muistisairauksien riskiin.

Oksidatiivinen stressi ja antioksidantit

Oksidatiivinen stressi tarkoittaa solujen ja laajemmin koko elimistön hapetus-pelkistystilan epätasapainoa. Käytännössä hapettavien tekijöiden liiallinen määrä ja antioksidatiivisten järjestelmien vajavainen toiminta välittyy reaktiivisten happi- ja typpiradikaalien kautta, mikä ylläpitää elimistön inflammaatiota.

Verensokeri vaikuttaa oksidatiiviseen stressiin ja inflammaatioon sitä enemmän, mitä korkeammalle verensokeri nousee ja mitä suuremmasta syödystä hiilihydraattimäärästä on kyse. Suuren glykeemisen kuorman sisältävät ruoka-annokset nostavat verensokeria rajusti. Oksidatiivisen stressin aiheuttamia tulehdusta lisääviä vaikutuksia voi vähentää tulehdusta jarruttavilla tekijöillä: polyfenoleilla, C-vitamiinilla, kanelilla ja etikalla, kuiduilla ja rasvalla.

Miten se toimii?

Reaktiivinen happiradikaali sisältää parittoman elektronin ja on siksi hyvin reaktiivinen. Energiataloudellisesti parittomat elektronit ovat epäedullisia ja siksi yhdiste pyrkii parilliseen elektronimäärään reagoimalla läheisyydessä olevien muiden yhdisteiden kanssa. Happiradikaali vaurioittaa kohtaamiaan molekyylejä. Tämä voi ilmetä eri tavoin:

Lipidiperoksidaatiossa rasvat härskiintyvät. Oksidatiivisessa stressissä rasvat hapettuvat happiradikaalien liiallisen määrän vuoksi ja seurauksena voi olla esimerkiksi rasvakalvojen virheellinen toiminta, joka vaikuttaa hormonien ja muiden viestiaineiden aikaansaamien signaalien välittymisessä solukalvon kautta soluun.
– Proteiinien vauriot. Proteiinit toimivat entsyymikatalyytteina, jotka mahdollistavat elintoiminnoille välttämättömät kemialliset reaktiot. Jotkin proteiinit toimivat reseptoreina, jotka vastaanottavat soluun tulevia kemiallisia viestejä. Happiradikaalien vaikutukset proteiineihin voivat aiheuttaa monenlaisia elintoimintojen häiriöitä.
– Myös DNA voi vaurioitua hapettumisen seurauksena. Tämä aiheuttaa geneettisiä vaurioita eli mutaatioita DNA:n emäsjärjestyksissä. Tällaiset muutokset voivat muuttaa ko. aluetta koodinaan käyttävän proteiinin rakennetta ja edelleen pysyvästi solun toimintaa, minkä seurauksena solut saattavat muuttua pahanlaatuisiksi. Se altistaa syövän kehittymiselle.  

Happiradikaaleja syntyy elimistön normaalin toiminnan seurauksena esimerkiksi ruokailun jälkeen ja soluhengityksessä, kun mitokondrioiden elektroninsiirtoketju käyttää happea energiantuotannossa. Happiradikaalien muodostuminen on osa perusaineenvaihduntaa, mutta niiden määrää rajoittaa elimistön omat antioksidatiiviset järjestelmät. Hapetus-pelkistystiloissa tapahtuvat muutokset ovat osa solujen välistä viestintämekanismia (redox signaling). Keho voi hyödyntää happiradikaaleja myös immuunijärjestelmän osana. Luontainen immuniteetti ja siihen liittyvät fagosytoivat solut tuhoavat elimistölle vieraita mikrobeja tuottamalla happiradikaaleja.

Elimistöllä on omia mekanismeja reaktiivisten happiradikaalien määrän rajoittamiseen. Näistä tärkeimpiä ovat happiradikaaleja vaarattomiksi molekyyleiksi muuttavat entsyymit, kuten superoksididismutaasi, katalaasi ja glutationiperoksidaasi.  Ravinnosta saatavat pienimolekyyliset antioksidantit pystyvät myös inaktivoimaan happiradikaaleja. Antioksidantteihin kuuluu eräitä vitamiineja ja flavonoideja. Tutuimpia ovat C- ja E-vitamiinit.

Liiallinen oksidatiivinen stressi voi johtaa solukuolemaan ja kudostuhoon. Inflammaatio on kaikkien kroonisten sairauksien riskitekijä.

Tässä on syytä painottaa sitä, että kovin paljon tutkimustietoa ketogeenisen ruokavalion hyödyistä multippeliskleroosia sairastavien oireiden helpottajana ei ole. Havaitut hyödyt on todennettu lähinnä eläinkokeissa ja pitkäaikaisvaikutuksista ei ole tietoa. Toisaalta tutkimusten tulokset ovat hyvin rohkaisevia.

Huomioitavaa

Ketogeenisen ruokavalion noudattaminen voi aiheuttaa multippeliskleroosia sairastavilla väsymystä (fatiikkia). Omalla kohdallani en sellaista huomannut, mutta multippeliskleroosi vaikuttaa eri ihmisiin eri tavoin, joten varoituksen sana on paikallaan.

Usein vähän hiilihydraatteja sisältävää ruokavaliota noudattavia varoitetaan kuitujen ja välttämättömien ravintoaineiden mahdollisista puutoksista hiilihydraattirajoitteiden seurauksena. Se voi olla yksipuolisella ketogeenisella dieetillä ongelma, mutta myös vähän hiilihydraatteja sisältävällä ruokavaliolla saa kaikki välttämättömät ravintoaineet ja riittävästi kuituja, jos ruokavalio on riittävän monipuolinen.

Mitä pitäisi vältellä

Ketoosi edellyttää hiilihydraattien tuntuvaa rajoittamista päivittäisessä ruokavaliossa ja hiilihydraattien korvaamista rasvalla ja proteiineilla. Välteltäviä ravintoaineita ovat erityisesti sokerit ja tärkkelys, jauhot ja niistä valmistetut ruoat sekä riisi, peruna, maissi ja hedelmät.

Rasvat

Hyväksyttyihin ravintoaineisiin kuuluvat hyvät rasvat ja proteiinit sekä vähän hiilihydraatteja sisältävät kasvikset ja pähkinät. Voi kuuluu monissa virallisissa ravintosuosituksissa vältettäviin epäterveellisiin rasvoihin, mutta minä suhtaudun voihin äärimmäisen myönteisesti. Sen sijaan margariineja en mielelläni syö. Voin terveysvaikutuksista vallitsee kaksi koulukuntaa: klassinen rasvavastainen koulukunta ja uusimpiin tutkimuksiin perustuva modernimpi lähestymistapa. Jokainen tehköön valintansa itse. Yhtä totuutta voin terveysvaikutuksista ei ole olemassa.

  • oliiviöljy
  • voi (tai ei, jos syö mieluummin voimakkaasti raffinoituja margariineja)
  • avokadot
  • pähkinät, mantelit, pistaasit
  • rasvaiset kalat, kuten lohi, sardiinit ja makrilli

Proteiinit

Ketogeeniseen ruokavalioon voi sisältyä sekä eläin- että kasvisperäisiä proteiineja.

  • liha
  • meijerituotteet (juustot yms.)
  • munat
  • pähkinät, maapähkinät ja cashew-pähkinät

Hiilihydraatit

Ketogeenisella ruokavaliolla rajoitetaan erityisesti seuraavien hiilihydraattien saantia:

  • sokerit
  • hedelmämehut, virvoitusjuomat ja makeutetut teet
  • makeiset ja leivonnaiset
  • maitoa, sillä se sisältää maitosokeria eli laktoosia
  • pasta
  • leipä
  • pavut
  • hedelmät
  • murot, puurot yms.
  • tärkkelyspitoiset vihannekset, kuten perunat ja maissi

Esimerkki päivän ruoista ketogeenisella ruokavaliolla

Aamiainen

  • pari paistettua munaa
  • pekonia
  • kahvia

Välipala

  • puolikas avokado, kourallinen pähkinöitä

Lounas

  • viipaloitua kurpitsaa
  • lihapullia ja tomaattikastiketta

Välipala

  • manteleita

Päivällinen

  • paistettua lohta
  • kukkakaalia ja voita
  • pinaattia

Tuo on vain eräs esimerkki päivittäisen ruokavalion sisällöstä. Tulen lisäämään tänne ketonurkkaukseen erilaisia hyviksi koettuja reseptejä sekä muuta aihetta sivuavaa infoa.  

Lopuksi

En voi sietää sanaa ”karppaaminen”. Siinä on jotenkin negatiivinen sointi. Lisäksi se kuulostaa pikemminkin hiilihydraattien syömiseltä kuin niiden rajoittamiselta. Käytän itse ketoilu-sanaa vähän hiilihydraatteja ja runsaasti rasvaa sisältävästä ruokavaliosta.

 Aloitin ketoilun eilen 2.12.2019. Söin päivän aikana kaksi ateriaa. Brunssi-lounaalla naudan jauhelihapihvin, runsaasti paistettua valkosipulilla ja chilillä maustettua kaali-paprika-sekoitusta ja juustoraastetta. Päivällisellä 3 paistettua munaa, kaali-paprikasekoituksen jämät ja paistetun naudan jauhelihapihvin. Pysyin kylläisenä, enkä kaivannut välipaloja tai iltapalaa.

Aloitan tulevien viikkojen aikana kokoamaan Ruokasotaan erityistä Ketonurkkausta, jossa kerron ketoiluun liittyvistä tutkimuksista, omista havainnoistani ja hyvistä resepteistä.

 




Atkinsin dieetti

Atkinsin dieetti on tunnetuin pysyvään laihtumiseen tähtäävä vähähiilihydraattinen ruokavalio.

Atkinsin mukaan insuliinilla on tärkeä rooli rasvan varastoimisessa ja rasvakudoksen rakentamisessa. Atkinsin dieetin tavoitteena on hiilihydraatteja rajoittamalla laskea haiman erittämän insuliinin määrää verenkierrossa, mikä Atkinsin mukaan vähentää rasvan varastoitumista rasvakudokseen, tehostaa varastoidun rasvan ”polttamista” energiaksi ja auttaa laihtumaan.

Amerikkalainen kardiologi Robert Atkins laati Atkinsin dieetin 1970-luvun alussa. Ruokavalio on kehittynyt vuosikymmenten saatossa. Nykyisin Atkinsin dieetti kehottaa täydentämään liha- ja rasva-painotteisen ruokavalion laihduttavia vaikutuksia runsaskuituisilla, vähän tärkkelystä sisältävillä kasviksilla ja liikunnalla.

Kahden viikon vähähiilihydraattisen induktiovaiheen tavoitteena on käynnistää ketoosi. Induktion jälkeen hiilihydraattien määrää lisätään varovasti jatkuvan laihtumisen, esiylläpidon- ja ylläpidon vaiheiden aikana, kunnes ihannepaino saavutetaan.


Atkinsin dieetti ja aineenvaihdunta


Ketoosi on aineenvaihdunnan tila, joka käynnistyy, kun ravinnosta saatavien hiilihydraattien määrä ei riitä täyttämään elimistön energiantarvetta. Hiilihydraateista saatava glukoosi on elimistön ensisijainen ”polttoaine”, mutta aineenvaihdunta osaa tuottaa tarvitsemansa energian myös rasvasta ja proteiineista. Kun glukoosi ei täytä energiantarvetta, aineenvaihdunta aloittaa energiantuotannon rasvoista.

Kun veren insuliinipitoisuus laskee, haiman erittämän glukagonin määrä veressä lisääntyy. Glukagoni käynnistää maksaan ja lihaksiin varastoitujen glykogeenien purkamisen vereen glukoosi- eli sokerimolekyyleiksi. Glukagonin vaikutuksesta maksassa ja munuaisisten kuoriosissa alkaa glukoneogeneesi ja ketogeneesi sekä rasvahappojen hiiliä asetyylikoentsyymi-A:ksi hapettavan β-oksidaatio.

Ketoosissa vapaista rasvahapoista muodostetaan ketoaineita, joita solut voivat käyttää energiantuotantoon.

Ketoosin aikana rasvasoluista vapautuu rasvahappoja verenkiertoon. jolloin aineenvaihdunta alkaa hyödyntää vapaita rasvahappoja energianlähteenä.

Ketoosi ja varastorasvojen hyödyntäminen

Glukoneogeneesin käynnistyessä elimistö alkaa muodostaa glukoosia vapaista aminohapoista, rasvojen glyseroliosista ja maitohaposta. Glukoneogeneesin rinnalla käynnistyy ketogeneesi.

Ketogeneesi vähentää glukoosin tuottamisen tarvetta, mikä säästää vapaita aminohappoja solujen uusiutumiseen.

Ketogeneesi muodostaa verenkierron vapaista rasvahapoista ketoaineita (asetoasetaatti, beeta-hydroksibutyraatti), joita useimmat solut pystyvät käyttämään energianlähteenä palauttaen ketoaineet asetyylikoentsyymi-A:ksi, joka on suoraan käytettävissä oksidatiiviseen energiantuotantoon sitruunahappokierron kautta mitokondrioissa samaan tapaan kuin glukoosi.

Insuliini

Insuliini, jolla on keskeinen merkitys Atkinsin ajattelussa, on ihmiselle elintärkeä sokeriaineenvaihduntaa säätelevä hormoni, jota erittyy haiman Langerhansin saarekkeiden β-soluista, kun hiilihydraateista ohutsuolesta verenkiertoon imeytyvä sokeri (glukoosi) nostaa veren sokeripitoisuutta.

Vereen erittyneet insuliinimolekyylit kiinnittyvät solujen insuliinireseptoreihin, mikä saa solussa olevat solukalvon läpäisevät glukoosinsiirtäjäproteiinit siirtymään solukalvolle. Näiden avulla glukoosimolekyylit pääsevät verestä solun sisälle.

Solussa glukoosimolekyylit osallistuvat energiantuotantoon glykolyysissä ja sitruunahappokierrossa. Ylimääräinen glukoosi varastoidaan lihasten ja maksan glykogeeneihin ja / tai muutetaan rasvasynteesin avulla varastorasvaksi.

Veren sokeripitoisuuden kasvu lisää insuliinin eritystä. Verensokerin lasku puolestaan aktivoi haimaa erittämään glukagonia, jonka vaikutuksesta maksan ja lihassolujen glykogeenejä puretaan glukoosimolekyyleiksi. Kun glykogeenivarastot tyhjentyvät, elimistö siirtyy ketoosiin ja alkaa tuottaa energianlähteiksi kelpaavia ketoaineita mm. rasvahapoista.

Insuliinireseptori

Insuliinireseptorin tehtävä on ohjata veren sokeria siirtävät proteiinit kuten SLC2A4 solukalvolle, edelleen ohjata näiden reseptoreiden suorittamaa glukoosin siirtoa soluihin ja glykogeenin sekä rasvahappojen synteesiä.

Insuliinimolekyylin elinkaari kestää noin 71 minuuttia. Haiman erittämästä insuliinista suuri osa on tavallisesti kiinnittyneenä maksan insuliinireseptoreihin. Osa insuliinista vapautuu reseptoreista takaisin verenkiertoon. Insuliinimolekyylit voivat hajota verenkierrossa monella tavalla.

Endoteliinit

Verenkierrossa insuliini stimuloi myös endoteliinien, eli verisuonten endoteelisolujen tuottamien peptidihormonien tuotantoa. Endoteliinit säätelevät verisuonten sileiden lihassyiden supistumista ja osallistuvat verenkierron paikalliseen säätelyyn. Endoteliinit voivat myös paksuntaa ja jäykentää verisuonia, mikä kohottaa verenpainetta ja altistaa sydän- ja verisuonitaudeille.


Atkinsin dieetti käytännössä


Atkinsin ruokavalioon sopivat vähähiilihydraattiset vihannekset, proteiinit ja rasvat.

Atkinsin kehittämässä ruokavaliossa hiilihydraattien saantia ravinnosta vähennetään rajusti, mutta rasvojen ja proteiinien määrää ei tavallisesti rajoiteta lainkaan.

Atkinsin mukaan prosessoidut hiilihydraatit, sokerit, maissisiirappi ja valkoiset jauhot ovat lihomisen tärkeimmät aiheuttajat. Atkins ei usko perinteiseen kaloriteoriaan.

Atkinsin ruokavalion päämääränä on vähentää glykeemistä kuormaa ja tehostaa laihtumista.

Glykeeminen kuorma (GL) ja glykeeminen indeksi (GI) kertovat ravinnon sisältämien hiilihydraattien laadusta, määrästä ja imeytymisnopeudesta. Sitä voidaan hyödyntää arvioitaessa aterian vaikutusta veren sokeriin ja veren insuliinivasteeseen.

Nopeilla ja hitailla hiilihydraateilla viitataan korkean glykeemisen indeksin hiilihydraatteihin ja matalan glykeemisen indeksin hiilihydraatteihin. Yleensä nopean glykeemisen indeksin hiilihydraatteja pidetään terveyden ja painonhallinnan kannalta huonompina kuin hitaasti imeytyviä hiilihydraatteja.

Glykeeminen kuorma

Glykeeminen kuorma voidaan laskea, ja siten selvittää syödyn ravinnon vaikutus veren sokeriin ja elimistön insuliinivasteeseen. Suuri hiilihydraattimäärä ja hiilihydraattien korkea glykeeminen indeksi kasvattavat ravinnon glykeemista kuormaa. Glykeemisen indeksin ja kuorman ymmärtäminen on erityisen tärkeää diabeetikoille.

Glykeeminen kuorma lasketaan seuraavasti: aterian glykeeminen indeksi x imeytyvän hiilihydraatin määrä / 100. Aterian glykemiakuormaa määritettäessä lasketaan yhteen sen sisältämien ruoka-aineiden GL-arvot.

Glykeeminen indeksi

Glykeeminen indeksi määrittelee ruoka-aineen imeytyvien hiilihydraattien aiheuttaman vaikutuksen verensokeriin verrattuna referenssiruoka-aineeseen kuten glukoosiliuokseen tai valkoiseen leipään.

Hiilihydraatin korkea GI kertoo, että se kohottaa verensokeria nopeasti ja vereen vapautuu paljon insuliinia. Matala GI kertoo, että hiilihydraattien imeytyminen on hitaampaa ja tasaisempaa.

Runsaasti prosessoidut hiilihydraatit, kuten leivokset, karamellit ja valkoinen leipä sekä runsaasti tärkkelystä sisältävät hiilihydraatit, kuten perunat ja riisi, ovat korkean glykeemisen indeksin ruokia ja ne kohottavat verensokeri- ja insuliinitasoja nopeasti aterian jälkeen. Määrä on kuitenkin laatua keskeisemmässä asemassa, joten glykeeminen kuorma on parempi indikaattori aterian vaikutuksista verensokeri- ja insuliinitasoihin.

Jotkin hiilihydraatit, kuten kaura, kohottavat veren glukoositasoja hitaasti ja tasaisesti. Niiden glykeeminen indeksi on matala.

Nettohiilihydraatit

Nettohiilihydraattien määrä saadaan, kun hiilihydraattien kokonaismäärästä vähennetään kuidut ja sokerialkoholit. Sokerialkoholeilla on minimaalinen vaikutus veren sokeripitoisuuteen. Atkinsin mukaan parhaita hiilihydraatteja ovat ne, joiden glykeeminen kuorma on vähäisin.

Vitamiinit lisäravinteina

Atkinsin ruokavaliossa vältetään monia mineraali- ja vitamiinirikkaita vihanneksia ja hedelmiä, joten vitamiini- ja mineraalilisien ottaminen on suositeltavaa Atkinsin dieetin aikana.

Kuinka Atkinsin ruokavalio toimii?

Atkinsin ruokavalion neljä perustavoitetta:  

  • Laihtuminen
  • Painonhallinta
  • Hyvä terveys
  • Sairauksien ehkäisy

Atkinsin ruokavalion tavoitteena on muuttaa elimistön energia-aineenvaihdunta sokeripolttoisesta rasvapolttoiseksi. Se muistuttaa monin tavoin muita vähähiilihydraattisia ruokavalioita, kuten ketogeenistä ruokavaliota.

Hiilihydraattien korvaaminen rasvalla ja proteiineilla ohjaa elimistön käyttämään energianlähteenä ravinnon sisältämien rasvojen lisäksi kehoon varastoituneita rasvoja.

Aloittaminen

Atkinsin dieetti aloitetaan kahden viikon idnuktiovaiheella, jossa hiilihydraattien saanti rajoitetaan alle 20 grammaan vuorokaudessa. Tavoitteena on elimistön ketoositilan nopea saavuttaminen.

Induktion jälkeen hiilihydraattien määrää nostetaan kuukausien mittaan eri vaiheissa vähitellen, kunnes saavutetaan ihannepaino ja sopiva ylläpitotaso.

Ruokavalion laihduttava vaikutus perustuu siihen, että elimistö oppii käyttämään energianlähteenä rasvasoluihin varastoimiaan rasvoja, kun energia-aineenvaihdunnan kannalta nopeita ja helppoja hiilihydraatteja ei ole tarjolla ja veren insuliinitaso pidetään hiilihydraatteja rajoittamalla matalana.

Toisaalta Atkinsin ruokavalio hillitsee myös ruokahalua, jolloin ravinnosta saatava energiamäärä laskee luonnostaan.

Huomioi ennen Atkinsin dieetin aloittamista!

Jos sairastat jotain kroonista sairautta ja syöt siihen säännöllisesti lääkkeitä, sinun on syytä neuvotella lääkärin tai ravitsemusasiantuntijan kanssa ennen Atkinsin ruokavalion aloittamista.
Eräillä lääkkeillä, kuten insuliinilla, voi Atkinsin ruokavaliota noudatettaessa olla odottamattomia ja negatiivisia vaikutuksia.

Muista juoda riittävästi

Atkinsin dieetti on diureettinen, eli nesteitä poistava, joten myös nesteitä poistavien lääkkeiden ja muiden diureettien, kuten kahvin ja alkoholin välttäminen on suotavaa dieetin aikana. Riittävän nesteensaannin turvaaminen ja kehon nestetasapainon ylläpitäminen on Atkinsin ruokavaliossa erittäin tärkeää. Nestehukka aiheuttaa yleensä päänsärkyä, joten Atkinsin ruokavalioon liittyvä päänsärky viittaa usein liian vähäiseen nesteytykseen.

Diabeetikoilla insuliinintarve muuttuu Atkinsin ruokavalion seurauksena, joten on ehdottoman tärkeää, että diabetesta sairastavat neuvottelevat Atkinsin ruokavalioon siirtymisestä lääkärin kanssa ja noudattavat ruokavaliota asiantuntijan tai lääkärin valvonnassa.


Induktio ja syöminen


Atkinsin ruokavaliossa ketoosi käynnistetään nopeasti pudottamalla syötyjen hiilihydraattien määrä alle 20 grammaan vuorokaudessa. Tämä induktiovaihe jatkuu kaksi viikkoa. Proteiineja ja rasvaa voi induktiovaiheen aikana syödä nälkäänsä rajoituksetta.

Ruokavalioon sopivat kaikki lihat, kalat, linnut, äyriäiset, kananmunat ja juustot ja vihannekset, joissa on alle 10 % hiilihydraatteja. Atkinsin ruokavaliossa ei syödä induktio-, laihdutus- ja esiylläpitovaiheen aikana hedelmiä, viljoja, margariinia, tärkkelystä (kuten perunat, riisi, maissi), pastoja tai vähärasvaisia maitotuotteita.

Hiilihydraattien rajoittamisesta seuraava verensokerin lasku aktivoi haiman erittämään insuliinin vastavaikuttajaa, glukagonia, joka käynnistää ketogeneesin ja glukoneogeneesin. Glukagoni myös aktivoi soluissa tapahtuvan β-oksidaation käynnistymisen.

β-oksidaatio

β-oksidaatio tapahtuu solujen mitokondrioissa ja peroksisomeissa. Oksidaatiossa ravinnon ja rasvasolujen rasvahappojen β-hiiliä hapetetaan karbonyyleiksi. Reaktioketju tapahtuu neljässä vaiheessa:

– Dehydraus
– Hydraatio
– Hapetus-pelkistysreaktio
– Tiolyysi

Reaktiosarja toistuu, kunnes rasvahappo on kulunut loppuun. Joka toistossa rasvahapoista poistuu 2 hiiltä asetyylikoentsyymi-A:na. Tiolyysin asetyylikoentsyymi-A siirtyy yleensä sitruunahappokiertoon mennen siten ATP:n tuottoon. Muissa vaiheissa saadut NADH ja FADH2 päätyvät ATP:n tuottoon menemällä mitokondrion elektroninsiirtoketjuun. Lähde: Wikipedia


Kuvakaappauksen lähde. Wikipedia

Ketoosin käynnistyminen

Tavoitteena oleva ketoosi saavutetaan yleensä parissa viikossa, kun maksan ja lihasten polysakkarideista muodostuvat glykogeenivarastot tyhjenevät. Tämän vaiheen tavoitteena on katkaista energia-aineenvaihdunnan hiilihydraattiriippuvuus ja siirtää elimistön aineenvaihdunta käyttämään sokerin sijasta rasvaa ja varastorasvoja energianlähteenä.

Atkinsin ruokavalion alkuvaiheessa elimistöstä poistuu paljon nesteitä. Ensimmäisen puolentoista viikon aikana painonpudotus johtuu pääasiassa elimistöstä poistuvista nesteistä.


Atkinsin dieetti sisältää neljä vaihetta


Vaihe 1: Induktio

Hiilihydraattien saanti lasketaan alle 20 grammaan päivässä. Päivittäiset hiilihydraatit saadaan hyvin vähän tärkkelystä ja hiilihydraatteja sisältävistä vihanneksista.

Ruokavaliossa syödään runsaasti rasvaa ja proteiineja sekä salaatteja tms. vihreitä lehtivihanneksia.

Vaihe 2: Jatkuva laihtuminen / tasapainottaminen

Ravinnerikkaita ja runsaasti kuituja sisältäviä ruokia lisätään päivittäiseen ruokavalioon. Hiilihydraattien päivittäistä määrää nostetaan viidellä grammalla kerrallaan niin kauan kuin laihtuminen jatkuu.

Sallittuihin ruokiin sisältyvät edellisten lisäksi mm. pähkinät, vähähiilihydraattiset vihannekset ja vähäinen määrä hedelmää.

Vaihe 3: Esiylläpitovaihe

Hiilihydraattien määrää nostetaan tasolle, jossa painonpudotus hidastuu tai loppuu. (25-90 g /vuorokausi), kun dieetissä on päästy noin viiden kilon päähän tavoitepainosta. Tämä esiylläpitovaihe jatkuu vähintään 2 kuukautta siten, että painoa putoaa alle puoli kiloa viikossa.

Vaihe 4: Ylläpitovaihe

Kun asetettu tavoitepaino on saavutettu, siirrytään Atkinsin dieetissä ylläpitovaiheeseen. Laihduttaja lisää ruokavalioonsa monipuolisesti erilaisia hiilihydraatteja, mutta tarkkailee samalla, että paino pysyy vakiona, eikä lähde kasvuun. Ylläpitovaiheessa ketoosi ei enää ole tarpeellinen.

Ylläpitovaiheen aikana voi jo syödä lihan ja rasvan lisäksi monipuolisemmin useimpia vihanneksia, pähkinöitä, marjoja ja kokojyväviljoja sekä joskus hiukan perunaa ja hedelmiä. Lisättyä sokeria ei suositella. Alkoholia ja kahvia tulee käyttää kohtuudella. Robert Atkinsin mukaan liikunta on tärkeä osa Atkinsin laihdutusohjelmaa.

Atkins suositteli, että tyydyttyneen rasvan osuus päivittäisestä energiansaannista pysyisi alle 20 prosentissa.

Atkins 40:

Atkinsin ruokavaliosta on olemassa erilaisia variaatioita. Atkins 40 on hieman helpompi noudattaa, sillä alun induktiovaiheessa saa syödä 40 grammaa hiilihydraatteja vuorokaudessa.

Atkinsin ruokavaliota noudatettaessa omaan hyvinvointiin tulee kiinnittää huomiota. Ruokavalio ei välttämättä sovi kaikille. Jos paino alkaa nousta, päivittäisten hiilihydraattien määrää tulee jälleen laskea laihduttavalle tasolle.

Atkins ja kasvisruokavalio

Atkinsin dieetin noudattaminen kasvisruokavaliona on ongelmallista, koska kasviproteiinit esiintyvät yleensä yhdessä hiilihydraattien kanssa. Dieetistä voi toisaalta muokata kasvisruokavalion, kun siihen sisällyttää maitotuotteita ja kananmunia. Lakto-ovovegetaristinen Atkinsin dieetti suositellaan aloittamaan kakkosvaiheesta, eli jatkuvan painonpudotuksen vaiheesta, jossa hiilihydraattien määrä pidetään 30 grammassa vuorokaudessa.

Atkinsin kasvisversio sisältää runsaasti kasviöljyjä. Myös vegaaninen Atkinsin dieetti on mahdollinen, jos hiilihydraattien määrä pidetään 50 grammassa päivässä, mutta siinä proteiinien saannin kanssa on oltava erityisen tarkkana. Proteiininlähteiksi soveltuvat esimerkiksi siemenet, pähkinät, soijaruoat, kvinoa ja vegaanisessa Atkinsin dieetissä myös palkokasvit.

Mitä Atkinsin dieetissä saa ja ei saa syödä

Syötävät ruoat:

Laihduttajat saavat syödä avokadoja, sillä ne sisältävät terveellisiä rasvoja.

  • kaikki lihat ovat
  • rasvaiset kalat ja äyriäiset
  • munat
  • avokadot
  • vähän hiilihydraatteja sisältävät vihannekset, kuten valkokaali, parsakaali ja parsa
  • täysirasvaiset maitotuotteet, kuten juustot
  • pähkinät ja siemenet
  • terveelliset rasvat, kuten neitsytoliiviöljy, kookosöljy ja avokadoöljy

Dieettiin sopivia juomia ovat vesi, kahvi ja vihreä tee

Päivän ruokavalio on esimerkiksi tällainen:

  • Aamiainen: Juustomunakas ja vähän hiilihydraatteja sisältäviä vihanneksia
  • Lounas: Kanasalaatti ja pähkinöitä
  • Päivällinen: Lihapullia ja vähähiilihydraattisia vihanneksia

Välipaloiksi sopivat esimerkiksi pähkinät, siemenet, kananmunat ja kreikkalainen jogurtti

Vältettävät ruoat:

  • sokeri, virvoitusjuomat, leivokset ja makeiset
  • kaikki viljat, kuten vehnä, speltti ja riisi
  • vähärasvaiset laihdutusruoat, koska niissä rasva on usein korvattu hiilihydraateilla
  • palkokasvit, kuten linssit, pavut, herneet

Induktiovaiheen aikana runsashiilihydraattisia hedelmiä, kuten banaaneita, omenoita ja rypäleitä sekä runsashiilihydraattisia vihanneksia, kuten porkkanoita, tulee välttää.

TL;DR

Atkinsin mukaan verensokeri ja pohjukaissuolen erittämä GIP-hormoni stimuloivat insuliinin eritystä ja insuliinia tarvitaan rasvan ja sokereiden varastoimiseen rasvasoluihin. Rasvasoluissa myös sokerimolekyyleistä syntetisoidaan rasvahappoja. Insuliinin erityksen vähentäminen hiilihydraattien rajoittamisella vähentää rasvan varastoitumista, tehostaa varastorasvojen käyttämistä energiaksi ja auttaa laihduttamaan.


Kritiikki


”Insuliinilla on aineenvaihdunnassa muitakin tehtäviä. Verensokerin ohella se säätelee myös rasvahappojen siirtymistä verestä rasvasoluihin, jotka varastoivat ne rasvana. Varastorasva on juuri sitä tuttua rasvaa, jota nimitämme läskiksi. – – – Vaikka päättely insuliinista saattaa kuulostaa loogiselta, se on täysin virheellinen yksinkertaistus. Sen esittäjät ovat poimineet ihmisen aineenvaihdunnasta yhden palan ymmärtämättä rasvan varastoitumisen kokonaisuutta.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Pertti Mustajoki korostaa, että Atkinsin dieetin laihduttavat ominaisuudet perustuvat siihen, että Atkinsin ruokavaliota noudattava saa ravinnostaan vähemmän kaloreita. Vastakkain ovat klassinen kaloriteoria ja uudempi aineenvaihdunnan erilaisia mekanismeja korostava näkemys. Tutkimuksissa on osoitettu, että vähähiilihydraattinen ruokavalio laihduttaa vähän kaloreita sisältävää ravintoa selvästi tehokkaammin dieetin ensimmäiset kuukaudet, mutta erot ruokavalioiden välillä tasoittuvat noin vuoden laihduttamisen jälkeen.

”Oikeastaan ei tarvita edellä kuvattujen monimutkaisten aineenvaihdunnan tapahtumien tuntemusta. Energian häviämättömyyden lain perusteella voidaan helposti ymmärtää, että painonhallinnassa ruuan rasva ei suinkaan ole viaton. Jos saamme ruuasta energiaa enemmän kuin ”poltamme” eli kulutamme, ainoa mahdollisuus on varastoida se. Ylimääräinen energia ei voi hävitä. Se jää meihin, oli se sitten peräisin hiilihydraateista, proteiinista tai rasvoista.” Sisätautien erikoislääkäri Pertti Mustajoki – Duodecim

Kuinka rasvasolut vaikuttavat painonhallintaan?

Rasvasolut eli adiposyytit tai liposyytit ovat kantasoluista kehittyneitä soluja, joiden tärkein tehtävä on varastoida ylimääräistä energiaa. Ihmisillä on kahdenlaisia rasvasoluja: valkoisia rasvasoluja (WAT) ja ruskeita rasvasoluja (BAT).

Ravinnon sisältämä ylimääräinen energia varastoidaan rasvasoluihin. Kun rasvasolut täyttyvät ja kasvavat riittävän suuriksi, ne jakautuvat ja tekevät näin varastoitavalle energialle enemmän tilaa.

Kerran muodostuneet rasvasolut eivät katoa mihinkään, vaikka paino putoaisi. Se on eräs laihduttamisen vaikeuteen vaikuttava tekijä. Laihtumisen ja lihomisen seurauksena rasvasoluihin varastoituneen rasvan määrä vaihtelee; solut eivät katoa.

Valkoiset rasvasolut

Valkoiset rasvasolut ovat yhden nesterakkulan soluja, jotka sisältävät ohuen sytoplasman ympäröimän ”rasvapisaran”. Valkoiset rasvasolut varastoivat ensisijaisesti triglyseridejä.

Valkoiset rasvasolut muistuttavat toiminnaltaan elintä, sillä ne erittävät aineenvaihduntaan vaikuttavia hormoneja, adipokiinejä kuten resistiiniä, adiponektiinia, leptiiniä ja apeliinia. Näillä hormoneilla on suuri vaikutus painonhallintaan. Esimerkiksi rasvasolujen erittämä leptiini kertoo aivoille, kun kehon energiavarastot ovat täyttyneet. Leptiini on siis kylläisyyshormoni.

Mitä enemmän ihmisellä on rasvasoluja, sitä hitaammin kehon energiavarastot täyttyvät ja rasvasolujen kemiallinen viesti energiavarastojen täyttymisestä hidastuu.

Suuri määrä energiatyydyttyneitä rasvasoluja voi aiheuttaa leptiinisignaaleilla eräänlaisen oikosulun aivojen leptiinireseptoreissa. Tällainen aiheuttaa leptiiniresistenssin, jossa aivot eivät enää reagoi kylläisyyshormoniin normaalisti. Kun rasvasolujen määrä kasvaa tai leptiinin toiminta heikkenee, ihminen syö enemmän kuin tarvitsee.

Ihmisellä on keskimäärin 30 miljardia valkoista rasvasolua, joihin on varastoitunut noin 13,5 kiloa rasvaa.

Ruskeat rasvasolut

Ruskeat rasvasolut sisältävät useita nesterakkuloita, joihin on varastoitunut rasvapisaroita. Ruskeat rasvasolut poikkeavat valkoisista rasvasoluista erityisesti koska ne sisältävät runsaasti energiaa tuottavia mitokondrioita. Ruskeaa rasvaa kutsutaan joskus vauvanrasvaksi ja se tuottaa elimistöön lämpöä.

Atkinsin dieetti voi vaikuttaa suotuisasti tyypin 2 diabetesta tai metabolista oireyhtymää sairastavien terveyteen ja vähentää lääkkeiden tarvetta. Diabetekseen erikoistuneet lääkärit varoittavat kuitenkin, että Atkinsin dieetti ei ole yksinkertainen ratkaisu tyypin 2 diabeteksen hoitoon, vaikka hiilihydraattien ja glukoosin saannin seuraaminen on tärkeä osa diabeteksen hoitoa.


Entä vaikutukset – toimiiko Atkinsin dieetti?


Atkinsin ruokavalion tavoitteena on laihtua ja ehkäistä eräitä sairauksia, kuten metabolista oireyhtymää, tyypin 2 diabetesta, korkeaa verenpainetta sekä sydän- ja verisuonitauteja.

Tutkimuksen mukaan useimmat lopettavat Atkinsin ruokavalion noudattamisen 2-3 vuodessa.

Stanfordin yliopiston tutkimuksessa Atkinsin dieettiä noudattavien verenpaine ja kolesterolitasot kehittyivät suotuisaan suuntaan, ja dieetti laihdutti tehokkaammin kuin vertailtavat laihdutusruokavaliot.

Ruokavalion alkuvaiheessa joillain laihduttajilla ilmenee:

  • päänsärkyä
  • huimausta
  • heikotusta
  • väsymystä
  • ummetusta

Atkinsin dieetin puolestapuhujien mukaan ruokavalio sopii painonpudotuksen ohella diabeteksen ja korkean verenpaineen hoitoon. Muunneltua Atkinsin dieettiä käytetään myös lasten vaikean epilepsian lääketieteelliseen hoitoon.

Hyödyt

Ruokavalion kehittäjän Robert Atkinsin mukaan vähähiilihydraattisen ruokavalion etuja ovat:

  • Ruoan määrää tai kalorimäärää ei rajoiteta
  • Nälkää ei tarvitse tuntea
  • Ruokahalu vähenee
  • Ruoansulatus paranee
  • Paino laskee eikä tule takaisin, koska ruokavalio sopii pysyvään painonhallintaan
  • Useimmat ylipainoisuuteen liittyvät terveysongelmat helpottuvat

Atkinsin mukaan vähän hiilihydraatteja sisältävän ketogeenisen ruokavalion myötä veren kolesteroliarvot paranevat ja sydäntautien riski vähenee. Atkinsin mukaansa ruokavalioon liitetyt terveysongelmat eivät johdu rasvasta, vaan 1800-luvun jälkeen yleistyneiden prosessoitujen hiilihydraattien käytöstä.

ketogeenisen ruokavalion hyötyjä:

1. Vähähiilihydraattinen ruokavalio vähentää ruokahalua

Monissa laihdutusruokavalioissa jatkuva näläntunne tuottaa ongelmia. Se johtaa helposti dieetin lopettamiseen. Vähähiilihydraattinen ruokavalio ylläpitää kylläisyyden tunnetta erinomaisesti, vaikka se samalla leikkaa energiansaantia.

Tutkimusten mukaan hiilihydraatteja rasvalla ja proteiineilla korvaavat saavat ravinnosta vähemmän kaloreita kuin hiilihydraattipainotteista ruokavaliota noudattavat.

2. Atkinsin dieetti on tehokkain laihdutusruokavalio ensimmäiset kuukaudet

Hiilihydraattien rajoittaminen on yksinkertaisin ja tehokkain tapa laihtua. Tutkimusten mukaan vähän hiilihydraatteja sisältävää ruokavaliota noudattavat laihtuvat nopeammin kuin laihduttajat, jotka rajoittavat rasvaa ja laskevat kaloreita.

Tutkimuksissa, joissa on vertailtu vähähiilihydraattisen ruokavalion ja vähärasvaisen ruokavalion tehoa laihduttamisessa, on havaittu, että hiilihydraatteja rajoittamalla laihtuu selvästi nopeammin ja enemmän tuntematta nälkää.

Vähän hiilihydraatteja sisältävä dieetti on muita laihdutusruokavalioita tehokkaampi ensimmäisen puolen vuoden aikana, mutta sen jälkeen erot ruokavalioiden välillä tasoittuvat.

3. Viskeraalinen vyötärölihavuus vähenee selvästi

Kaikki rasvat eivät ole samanarvoisia. Pahinta elimistöön kertyvää rasvaa on vatsaonteloon elinten ympärille varastoituva viskeraalinen rasva eli sisälmysrasva.

Sillä mihin kehon osaan rasva varastoituu, on merkitystä terveyden ja sairastumisriskin kannalta. Viskeraalinen rasva on yleisintä ylipainoisilla miehillä. Vyötärölihavuuteen liittyy usein myös maksan rasvoittuminen.

Viskeraalinen rasva kerääntyy vatsaontelossa elinten ympärille ja kasvattaa inflammaation sekä insuliiniresistenssin riskiä.

Vähän hiilihydraatteja sisältävät ruokavaliot, kuten Atkinsin dieetti, vähentävät hyvin tehokkaasti erityisesti vatsaonteloon kerääntyvää viskeraalista rasvaa.

4. Triglyseridien määrä veressä laskee merkittävästi

Triglyseridit ovat verenkierrossa kiertäviä vapaita rasvahappoja. Koholla olevat triglyseridit on tunnettu sydäntautien riskitekijä. Runsaasti hiilihydraatteja sisältävä ravinto ja etenkin fruktoosi kasvattavat veren triglyseridipitoisuutta.

Hiilihydraatteja rajoittavassa ruokavaliossa veren vapaat rasvahapot – triglyseridit siirtyvät ketoaineiden ja energiantuotantoon.

5. Atkinsin ruokavalio lisää hyvän HDL-kolesterolin määrää

HDL tunnetaan ns. ”hyvänä” kolesterolina: ts. mitä enemmän HDL-kolesterolia veressä on suhteessa LDL-kolesteroliin, sitä pienempi sydäntautiriski. Vastaavasti LDL-kolesterolin kasvu kasvattaa sydäntautien riskiä.

Paras tapa lisätä hyvän HDL-kolesterolin määrää, on syödä rasvaa. Atkinsin ruokavalio ja muut ketogeeniset ruokavaliot ovat runsasrasvaisia dieettejä. Lähde1, Lähde2.

6. Veren sokeri- ja insuliinipitoisuus laskee

Vähähiilihydraattiset ja ketogeeniset ruokavaliot saattavat vähentää lääkkeiden tarvetta metabolista oireyhtymää ja tyypin 2 diabetesta sairastavilla. Hiilihydraattien rajoittaminen laskee verensokeria ja veren insuliinitasoja.

Joidenkin aikuistyypin diabetesta sairastavien insuliinintarve laskee Atkinsin ruokavalion myötä jopa 50 %. Yhden tutkimuksen mukaan tyypin 2 diabetesta sairastavista 95 prosenttia vähensi lääkkeiden käyttöä 6 kuukauden sisällä Atkinsin dietiin aloittamisesta. Lähde.

Jos sairastat diabetesta ja aloitat vähähiilihydraattisen ja ketogeenisen ruokavalion, konsultoi asiasta lääkäriäs, sillä riskinä on hypglykemia.

7. Atkinsin ruokavalio voi laskea verenpainetta

Kohonnut verenpaine lisää sydän- ja verisuonitautien riskiä. Vähän hiilihydraatteja sisältävät ruokavaliot voivat joidenkin tutkimusten mukaan laskea verenpainetta.

Lähteitä:

Glykemiakuorma
Ketoosi
What to know about low-carb, high-fat diets
Atkins diet: What is it and should I try it?
Aktins.com
Atkinsin dieetti




Ketogeeninen ruokavalio ja aineenvaihdunta

Ketogeeninen ruokavalio kääntää perinteiset ravintosuositukset päälaelleen. Vähähiilihydraattisena ruokavaliona se ylittää aika ajoin uutiskynnyksen ja keskustelu sen ympärillä on ollut kiivasta karppausbuumin alkuajoista alkaen.

Viime kuussa joukko amerikkalaisia asiantuntijoita rankkasi ketogeenisen ruokavalion 40 dieetin vertailussa pitkäaikaisvaikutuksiltaan huonoimmaksi laihdutusruokavalioksi. Luulen, että ketogeeniseen ruokavalioon liittyy paljon epätietoisuutta. Mitä ketogeenisellä ruokavaliolla tarkoitetaan ja kuinka se toimii?

Ketogeeninen ruokavalio ja aineenvaihdunta

Ketogeeninen dieetti on vähähiilihydraattinen ruokavalio, jossa tavoitellaan aineenvaihdunnan ketoositilaa. Kun maksaan ja lihaksiin varastoidut hiilihydraattivarastot tyhjenevät, maksa ryhtyy tuottamaan ketoaineita ketogeneesissä ja käyttämään rasvakudokseen säilöttyä energiaa tasapainottaakseen elimistön energiavajetta.

Käytännössä ketogeenisessä ruokavaliossa tavoitellaan sellaista aineenvaihdunnan tilaa, jossa elimistö oppii käyttämään tehokkaasti rasvakudokseen varastoitua läskiä energianlähteenä.

Ketogeneesin käynnistyminen edellyttää, että ravinnon hiilihydraattien saantia rajoitetaan. Ketoosi alkaa, kun elimistö ei saa riittävästi hiilihydraatteja ja elimistön hiilihydraattivarastot eli glykogeenit tyhjenevät.

Varsinkin ruokavalion alkuvaiheessa hiilihydraatteja rajoitetaan reilusti. Tämän ”induktiovaiheen” tavoitteena on uudelleenohjelmoida elimistö käyttämään energianlähteenä aluksi ketoaineita ja myöhemmin pääasiassa rasvaa. Hiilihydraattien saanti lasketaan 20-100 grammaan vuorokaudessa.

Ketogeeninen ruokavalio lääketieteessä

Lääketieteessä ketogeenista ruokavaliota käytetään erityisesti vaikean epilepsian hoitoon lapsilla. Käypä hoito -suosituksissa neuvotaan harkitsemaan ketogeenista ruokavaliota yhteistyössä ravitsemusterapeutin kanssa vaikean epilepsian hoidossa silloin, kun epilepsialääkkeet eivät käy eikä kirurgisen hoidon mahdollisuutta ole. Ketogeenista ruokavaliota on käytetty myös lasten lihavuuden hoidossa.

Vähähiilihydraattinen ruokavalio on hyväksi diabeetikoille, sydän- ja syöpäpotilaille sekä ylipainoisille. Vähän hiilihydraatteja sisältävä ravinto laihduttaa ja vähentää ylipainoisten ihmisten sydäntautien riskiä tehokkaammin kuin vähärasvainen ruokavalio, osoittaa laajameta-analyysi, jossa käytiin läpi tutkimukset vuosilta 1966-2014 (Sackner-Bernstein ym. 2015).

Induktiovaiheen ravintosisältö

Alkuvaiheessa ketogeeninen ruokavalio sisältää yleensä noin 20 – 50 grammaa hiilihydraatteja vuorokaudessa hieman henkilöstä ja ruokavalion tavoitteista riippuen. Proteiinien saanniksi suositellaan 1-2 grammaa / painokilo, mutta ikääntyneillä proteiinien saanti voi olla korkeampikin lihaksia energianlähteeksi pilkkovan katabolisen aineenvaihdunnan vuoksi. Suurin osa ravinnosta muodostuu ketogeenisessä ruokavaliossa rasvasta.

Vettä on tärkeää juoda runsaasti (3-4 l/vuorokaudessa), sillä ketogeeninen ruokavalio poistaa vettä sitovien hiilihydraattien puutoksen vuoksi runsaasti kehoon sitoutuneita nesteitä. Myös suolan saannista on tärkeä huolehtia, koska se sitoo elimistöön nestettä ja ehkäisee elimistön kuivumista hiilihydraattien puuttuessa.

Noin neljän viikon induktiojakson jälkeen hiilihydraattien määrää voi lisätä  alle 50 grammasta 50-100 grammaan vuorokaudessa esimerkiksi kasviksia lisäämällä.

  • 5-10 % Ravinnon energiamäärästä (kcal) tulisi saada hiilihydraateista
  • 30 % Ravinnon energiamäärästä (kcal) tulisi saada proteiineista
  • 60 % Ravinnon energiamäärästä (kcal) tulisi saada rasvasta

Ketogeenisen ruokavalion tiedetään aiheuttavan päänsärkyä monilla, mutta se on yleensä seurausta veden liian vähäisen juomisen aiheuttamasta nestehukasta.Silloin kannattaa juoda enemmän vettä.

Ketoosi ja ketoasidoosi eivät ole sama asia

Ketoasidoosi eli happomyrkytys on toksinen tila, jossa ketoaineiden määrä verenkierrossa voi kasvaa monikymmenkertaiseksi ketoosiin verrattuna. Lievimmillään ketoasidoosia ei välttämättä edes huomaa, mutta vakavimmillaan se on hengenvaarallinen myrkytystila. Ketoosi ja ketoasidoosi ovat siis kaksi eri asiaa.

Ketogeeninen ruokavalio ja aineenvaihdunta

Aineenvaihdunnan tasolla ketogeneesi tarkoittaa energianlähteiksi kelpaavien ketoaineiden tuottamista rasvahapoista silloin kun hiilihydraattien saanti on niukkaa tai olematonta.

Ketoaineet ovat rasvasta ja etanolista muodostuvia pienimolekyylisia yhdisteitä. Elimistössä muodostuu kolmea eri ketoainetta:

  • asetoasetaattia
  • beeta-hydroksibutyraattia
  • asetonia

Ketoaineiden tuotannon käynnistyminen

Aineenvaihdunta aloittaa ketoaineiden tuotannon, kun maksan ja lihasten sokerivarastot (glykogeenit) on kulutettu loppuun esimerkiksi intensiivisen urheilusuorituksen, vähän hiilihydraatteja sisältävän ravinnon tai paaston vaikutuksesta.

Ketoaineiden tuotannon käynnistyminen ei tarkoita, että elimistö on ketoosissa. Se on vain merkki siitä, että hiilihydraattivarastot ovat loppu ja elimistö siirtyy ”varavoimanlähteen” käyttöön. Ketoosi alkaa yleensä muutamassa päivässä ja rasvan käyttäminen solujen polttoaineena vakiintuu 3-4 viikossa.

Kun keho menee ketoosiin, aineenvaihdunta turvaa elintoimintojen tarvitseman energian saannin glukoneogeneesillä ja ketogeneesillä myös paaston ja hiilihydraatittoman ruokavalion aikana. 3-4 viikossa elimistö korvaa ketoaineet energianlähteinä rasvakudoksen ja ravinnon rasvoilla.

Näiden aineenvaihduntamekanismien ansiosta terve ihminen selviää elossa pelkällä vedellä jopa kuukauden ajan.

Ketoaineita syntyy maksassa ja munuaisissa

Yleensä ketoaineita syntyy maksan ja munuaisten solujen mitokondrioissa solujen glukoneogeneesin sivutuotteina. Kun solut tuottavat glukoosia, ne tuottavat tarvitsemansa energian hapettamalla rasvahappoja asetyylikoentsyymi-A:ksi.

Asetyylikoentsyymi-A

Wikipedia kertoo, että asetyylikoentsyymi-A, eli aktiivinen etikkahappo, on kaikille ravintoaineille yhteinen välituote solun valmistaessa energiaa.  Asetyylikoentsyymi-A:ta saadaan monosakkarideista (sokereista), triglyserideistä (rasvoista) ja aminohapoista (proteiineista) erilaisten reaktiovaiheiden kautta.

Asetyylikoentsyymi-A:n asetyyliryhmän hiilet hapettuvat hiilidioksidiksi Krebsin syklissä (sitruunahappokierto) ja vedyt siirtyvät erityisten koentsyymien avulla elektroninsiirtoketjuun. Näissä reaktioissa syntyy energiaa, joka varastoidaan fosfaattiyhdisteisiin, esimerkiksi ATP:ksi.

Glukoosi hajoaa solulimassa tapahtuvassa glykolyysissä kahdeksi pyruvaatiksi, joista molemmista saadaan edelleen oksidatiivisessa dekarboksylaatiossa kaksi asetyylikoentsyymi-A:ta. Jos happea ja mitokondrioita ei ole riittävästi, pyruvaatti pelkistyy maitohapon anioniksi laktaatiksi.

Rasvahapot hajoavat hapettumalla β-oksidaatiossa niin, että rasvahappoketjusta irtoaa kahden hiilen asetyyliryhmiä, jotka ovat kiinnittyneenä reaktioon osallistuvaan koentsyymi-A:han.

– Wikipedia

Asetyylikoentsyymi-A, joka ei hapetu normaalisti sitruunahappokierrossa glukoneogeneesin ollessa käynnissä, muuntuu ketogeneesissä asetoasetaatiksi ja edelleen betahydroksibutyraatiksi.

Ketoaineet kulkeutuvat verenkierron mukana maksasta ja munuaisista muualle elimistöön. Aivojen gliasolut käyttävät asetoasetaattia ja betahydroksibutyraattia lipidien rakennusaineena. Sydän, lihakset ja aivot voivat tarvittaessa käyttää ketoaineita solujen energianlähteenä.

Ketogeneesi on elintoimintojen varavoimanlähde

Glukoneogeneesi ja ketogeneesi toimivat itsenäisesti energiantuotannon taustaprosesseina ja ylläpitävät solujen energiansaantia silloin, kun syömisestä on kulunut paljon aikaa. Glukoneogeneesi käynnistyy haiman erittämän glukagonin aktivoimana maksassa ja munuaisissa ja se johtaa edelleen ketogeneesin käynnistymiseen maksan ja munuaisten mitokondrioissa.

Ilman näitä aineenvaihdunnan prosesseja evoluutio ja aivojen kehitys olisivat pysähtyneet esihistorian aamuhämärissä, eikä nykyihmistä olisi koskaan kehittynyt.

In essence, a ketogenic diet mimics starvation, allowing the body to go into a metabolic state called ketosis (key-tow-sis). Normally, human bodies are sugar-driven machines: ingested carbohydrates are broken down into glucose, which is mainly transported and used as energy or stored as glycogen in liver and muscle tissue. When deprived of dietary carbohydrates (usually below 50g/day), the liver becomes the sole provider of glucose to feed your hungry organs – especially the brain, a particularly greedy entity accounting for ~20% of total energy expenditure. The brain cannot DIRECTLY use fat for energy. Once liver glycogen is depleted, without a backup energy source, humanity would’ve long disappeared in the eons of evolution. .

Scientific American

Ketogeneesi on osa kehon normaalia aineenvaihduntaa. Nykyisin ravinto on sen verran energiatiheää ja hiilihydraattipainotteista, että elimistö turvautuu ketogeneesiin vain satunnaisesti, vaikka se esi-isillämme oli luontainen osa elimistön energiantuotantoa. Viimeisten vuosisatojen aikana ravintotottumukset ovat muuttuneet valtavasti, mutta aineenvaihdunnan mekanismit muuttuvat hitaammin.

Aineenvaihduntamme on lapsesta lähtien opetettu saamaan energia hiilihydraateista, mutta se ei tarkoita sitä, etteikö energiansaantiin olisi muita tapoja. Aineenvaihdunta voidaan uudelleenohjelmoida ”sokeripolttoisesta” tehtaasta ”rasvapolttoiseksi” ravintoon liittyvillä valinnoilla.

Aineenvaihdunta biohakkeroimalla rasvaa polttavaksi

Ketoosi on ketogeneettisessä ruokavaliossa tavoiteltava aineenvaihdunnan tila. Siihen päästään ”biohakkeroimalla” aineenvaihdunnan toimintaa.

Käytännössä biohakkeroinnilla tarkoitetaan ravinnosta saatavien hiilihydraattien rajoittamista 20-50 grammaan vuorokaudessa. Aineenvaihdunta opetetaan käyttämään ketoaineita ja rasvasolujen sisältämiä energiavarastoja energianlähteenä, koska sille ei tarjota helppoa energianlähdettä hiilihydraattien muodossa.

Kuvan lähde: Wikipedia – Glycogen

Glykogeenit

Oheinen kuva esittää kaksiulotteisen mallin glykogeenistä, joka on jopa 30 000 glukoosimolekyylistä muodostuva monihaarainen ja pitkäketjuinen polysakkaridi. Osa verensokerista varastoidaan tällaisina polysakkarideina maksa- ja lihassoluihin.

Kun verensokeri laskee, haima erittää glukagonia, joka purkaa glykogeenejä maksasta verenkiertoon. Se kohottaa verensokeria ja antaa lihas- ja aivosoluille nopeaa energiaa glukoosin muodossa. Lihassolujen varastoimat glykogeenit eivät vapaudu verenkiertoon, vaan lihas käyttää ne nopeana energianlähteenä itse.

Glykogeneesi

Glykogeenit muodostuvat insuliinin aktivoimana glykogeneesissä maksa- ja lihassoluissa. Maksasolut ylläpitävät veren glukoosipitoisuutta glykogeenivarastojensa avulla syömisten välissä.

Aivot käyttävät valtavasti energiaa

Glykogeenivarastot ovat kooltaan varsin pienet ja elimistö kuluttaa varastosokerit nopeasti loppuun.  Pelkästään aivot kuluttavat vuorokaudessa noin 100 g glukoosia, joka saadaan syödyistä hiilihydraateista sekä glukagonin avulla puretuista maksan varastosokereista.

Glukoneogeneesin sivutuotteena syntyy ketoaineita

Kun glykogeenit tyhjenevät, maksa ryhtyy korvaamaan aivojen tarvitsemaa glukoosia ketoaineilla. Glykogeenejä purkava glukagoni aktivoi glukoosia tuottavan glukoneogeneesin maksassa ja munuaisten kuoriosissa.

Glukoosimolekyylin syntetisoiminen kuluttaa enemmän energiaa kuin glukoosimolekyyli tuottaa

Glukoneogeneesi hyödyntää mm. vapaita aminohappoja ja rasvoja sekä glykolyysissä syntyneitä maitohappoja, sitruunahappokierron sivutuotteita sekä ketoaineita glukoosin syntetisoimisessa.

Yhden glukoosimolekyylin tuottaminen vaatii 2 pyruvaattimolekyyliä, 4 ATP:tä, 2 GTP:tä, 2 NADH-molekyyliä ja neljä vesimolekyyliä. Se vaatii siten enemmän energiaa kuin glykolyysi tuottaa yhdesta glukoosimolekyylistä.

Glykogeenit purkautuvat glukagonin vaikutuksesta glykogenolyysissa

Haiman alfasolujen erittämä glukagoni aktivoi glykogeenien purkamisen eli glykogenolyysin maksassa ja lihassoluissa, jolloin glykogeeni purkautuu glukoosiksi (maksasta) ja glukoosi-1-fosfaatiksi (lihaksissa).

Glukagoni käynnistää glykogenolyysin yhteydessä glukoneogeneesin. Haiman beetasolujen erittämä insuliini puolestaan pysäyttää glukongeogeneesin, kun verensokeri nousee ja aineenvaihdunnan energianlähde muuttuu glukoosiksi.

Induktio

Scientific American kirjoittaa, että aivot toimivat hyvin myös ketoaineilla. Aivojen toiminta on turvattu, jos ~70 % aivojen energiatarpeesta saadaan ketoaineista. Prosessi, jossa aivot oppivat käyttämään ketoaineita energianlähteenä 0 – 70 % vie kolmisen viikkoa. Tämä on eräänlainen aineenvaihdunnan induktiovaihe.

Induktiovaiheen aikana aivoja lukuun ottamatta kaikki kehon kudokset vähentävät ketoaineiden käyttöä energianlähteenä. 3-4 viikon aikana solut sopeutuvat käyttämään energianlähteenä rasvasoluista vapautuvia vapaita rasvahappoja.

Induktion jälkeen elimistö tuottaa hyvin vähän ketoaineita (vähemmän kuin 280 kcal / päivä), mutta riittävästi aivosolujen energiantarpeen turvaamiseksi.

Ketogeenisessä ruokavaliossa painosta putoaa ennen induktiovaiheen loppua lähinnä nesteitä, joten nestetasapainon kanssa tulee olla tarkkana ja juoda reilusti vettä. Rasvan käyttö energianlähteenä tehostuu hitaasti koko ajan ja on tehokkaimmillaan vasta kolmisen viikkoa ruokavalion aloittamisen jälkeen. Sen verran kestää, että solut sopeutuvat uuteen energianlähteeseen.

Aineenvaihdunta

Aineenvaihduntaan vaikuttaa useita tekijöitä: ravinnon määrä ja laatu, makroravinteet, ravinnon sisältämät vitamiinit ja mineraalit, stressi, nestetasapaino, maksan ja haiman terveys, geenit, hormonit, insuliinisensitiivisyys, liikunta, ja uni.

Oheinen Jonathan Bailorin luento sisältää mielenkiintoisia huomioita aineenvaihdunnan toiminnasta, lihomisesta ja laihtumisesta:

Aineenvaihdunta ylläpitää elämää sitkeästi. Se on joustava ja pystyy hyödyntämään tehokkaasti erilaisia ravinnonlähteitä elintoimintojen ylläpidossa.

Perusaineenvaihdunta kuluttaa valtavasti energiaa

Sängyssä makaaminen kuluttaa 80 kg painavalla, 180 cm pitkällä 30 vuotiaalla miehellä noin 1780 kcal vuorokaudessa. Aivojen ja välttämättömien elintoimintojen ylläpito edellyttävät paljon energiaa.

Keskimäärin aikuinen tarvitsee ravinnosta 2000-2500 kcal vuorokaudessa. Liikunta lisää energiantarvetta, mutta ikä, paino ja kehon rakenne vaikuttavat lepokulutukseen.

Tärkeimpiä elintoimintoja ylläpitää perusaineenvaihdunta. Siihen kuuluvat keuhkojen ja sydämen toiminta, kemiallisten yhdisteiden eristys ja synteesit, sekä ionien siirto solukalvojen läpi. Vuorokautisesta kokonaisenergiankulutuksesta 65–75 prosenttia on
perusaineenvaihduntaa, miehillä keskimäärin 4,2 kJ/min ja naisilla 3,8 kJ/min. Perusaineenvaihdunta koostuu aivojen (21 %), lihasten (22 %), maksan (18 %), munuaisten (6 %), sydämen (12 %) ja muiden kudosten (21 %) energiankulutuksesta. Sen suuruuteen vaikuttaa sukupuolen lisäksi ikä, kehon tyyppi ja koostumus, paasto, lämpötila ja laihduttaminen. – Wikipedia

Anabolinen ja katabolinen aineenvaihdunta

Solun aineenvaihdunta voidaan jakaa kahteen toimintamekanismiin: anaboliseen ja kataboliseen aineenvaihduntaan.

Anaboliset reaktiot ovat biosynteettisiä eli kokoavia aineenvaihduntatapahtumia, joissa yksinkertaisemmista molekyyleistä rakennetaan monimutkaisempia molekyylejä.

Katabolisissa reaktioissa monimutkaisempia molekyylirakenteita pilkotaan yksinkertaisemmiksi molekyyleiksi.

Energian tuotanto

ADP + Pi      –                ATP
NAD+              –                 NADH +H+

  • Energianlähteenä voi hyödyntää hiilihydraatteja, rasvoja ja proteiineja
  • Solut saavat energiaa orgaanisista molekyyleistä hapettamalla niitä esimerkiksi:
    – Glukoosin hapetus tapahtuu sytoplasman glykolyysissä
    – Rasvahappojen hapetus = β-oksidaatio

β–oksidaatiossa rasvahappojen käyttö energiantuotantoon alkaa siten, että rasvat hajotetaan rasvahapoiksi ja glyseroliksi.

Glyseroli hapetetaan solulimassa glyseraldehydi-3-fosfaatiksi ja se voidaan käyttää joko energiantuotantoon (n. 5 % triglyseridistä saatavasta energiasta) tai glukoosin tuottamiseen glukoneogeneesissä.

Rasvahapot hapetetaan mitokondrioissa β–oksidaatiossa. Aluksi rasvahapot aktivoidaan mitokondrion ulkokalvolla kiinnittämällä rasvahapon karboksyyliryhmään koentsyymi-A. Näin muodostunut asyyli-KoA kulkee mitokondrion sisäkalvon läpi aktiivisella kuljetuksella. Näin siksi, että soluliman ja mitokondrion asyyli-KoA:lla on eri tehtävät – solulimassa anabolia, mitokondriossa katabolia.

Mitokondrion matriksissa rasvahappo hajotetaan kaksihiilisiksi pätkiksi (asetyyli-KoA), joka edelleen hapetetaan sitruunahappokierrossa.

Kuvan lähde: Nina Peitsaro

Anabolinen ja katabolinen aineenvaihdunta vuorottelevat elimistössä päivittäisten rutiinien lisäksi myös iän ja elämäntilanteen mukaan. Fyysinen harjoittelu ja sairaudesta toipuminen kallistavat aineenvaihduntaa anaboliseksi, jolloin aineenvaihdeunta rakentaa lihaskudosta tai korjaa sairauden aiheuttamia vaurioita. Myös kasvavien lasten aineenvaihdunta on anabolinen, mutta vanhemmilla ihmisillä ja hyvin vähän liikkuvilla aineenvaihdunta on yleensä pitkäkestoisessa katabolisessa tilassa.

Anabolisen aineenvaihdunnan käynnistyminen

Anabolinen aineenvaihdunta käynnistyy yleensä ruokailun jälkeen. Ravinnosta saaduista perusmolekyyleistä muodostetaan elimistössä suurempia molekyylejä, kuten lihasten tarvitsemia proteiineja.

Kun ruokailusta kuluu enemmän aikaa ja ravintoaineiden saatavuus ruoansulatuskanavan kautta vähenee, aineenvaihdunnan painopiste siirtyy katabolisten reaktioiden puolelle.

Anaboliset reaktiot kuluttavat energiaa

Anaboliset reaktiot kuluttavat energiaa ATP:n tai NADH:n (ja NADPH:n) muodossa.
ATP à ADP + Pi
NADH + H+ — NAD+

Katabolinen aineenvaihdunta tuottaa ravintoaineista soluhengityksen avulla energiaa. Anabolinen aineenvaihdunta rakentaa ja uusii elimistön rakenteita mm. proteiinisynteesissä.

Kehon energiantuotanto: Kuinka hiilihydraatit tuottavat energiaa

Hiilihydraatit ovat energiansaannin kannalta tehokkaimpia ravintoaineita. Myös rasvat ja proteiinit voidaan hyödyntää energiaksi.

Rasvat ovat hiilihydraatteja edullisempi tapa varastoida energiaa, sillä niissä on yli kaksinkertainen määrä energiaa painoyksikköä kohden.

Hiilihydraateista pilkotut sokerit imeytyvät verenkiertoon ohutsuolessa. Glukoosi kohottaa verensokeria, johon haima reagoi erittämällä vereen insuliinia. Insuliini kiinnittyy solun pinnassa olevaan insuliinireseptoriin, jolloin solussa olevat sokerikanavat (kalvorakkulat) siirtyvät solukelmulle ja päästävät glukoosimolekyylin solun sisälle.

Solulimassa glukoosi osallistuu glykolyysiin eli reaktioiden sarjaan, jossa glukoosimolekyyli hajotetaan pyruvaatiksi. Glukoosi on solujen energiantuotannon yleisin lähtöaine. Fruktoosin aineenvaihdunta tapahtuu maksassa, jossa se muutetaan lipogeneesissä triglyseridiksi eli rasvaksi.

Glukoosi, joka ei ravitse solujen energiantarvetta, varastoituu maksa- ja lihassoluihin glykogeeneinä, joista energiavarasto on nopeasti purettavissa. Glukoosi, joka ei ravitse solujen energiantarvetta tai mahdu glykogeenivarastoihin, siirtyy insuliinin avaamien sokerikanavien avulla rasvakudoksen rasvasoluihin, jossa se muutetaan lipogeneesissa rasvaksi.

Lipogeneesi

Insuliini säätelee lipogeneesiä, jossa veren ylimääräiset glukoosimolekyylit muutetaan triglyserideiksi eli rasvoiksi maksassa, rasvakudoksessa ja toimivan maitorauhasen soluissa. Lipogeneesissä yhdestä glukoosimolekyylistä muodostuu ensin kaksi glyserolimolekyyliä, joihin liittyy glukoosin auenneesta renkaasta muodostunut, pelkistynyt rasvahappoketju.

  • Keho käyttää arviolta 45 % ravinnosta saatavista hiilihydraateista energiantuotantoon ja 55 % hiilihydraateista muutetaan lipogeneesissä rasvahapoiksi.

Rasva-aineenvaihdunta on hyvin dynaaminen. Osa vapaista rasvahapoista hyödynnetään glukoneogeneesissä ja osa varastoituu rasvasoluihin. Rasvasoluista vapautuu kuitenkin jatkuvasti rasvasoluja verenkiertoon. Yksittäisen lipidimolekyylin elinaika on arviolta 2-10 vuorokautta.

Solulimassa tapahtuva reaktioketju – glykolyysi tuottaa energiaa

Glykolyysi tuottaa energiaa ATP-molekyylien muodossa. Soluissa, joilla on käytettävissään happea, energiaa tuottava reaktio etenee glykolyysistä mitokondrioiden soluhengitykseen.

Haima ja haiman tehtävät aineenvaihdunnassa

Haima osallistuu ravintoaineiden aineenvaihduntaan erittämiensä ruoansulatusentsyymien sekä insuliinin ja glukagonin avulla.

Haima muodostuu kahdesta toiminnallisesti erilaisesta solukkotyypistä: avorauhas- ja umpirauhasosasta. Avorauhasosa tuottaa ruoansulatusentsyymejä, jotka pilkkovat kaikkia ravintoaineita (sokereita, rasvoja, proteiineja ja nukleiinihappoja).

Haiman erittämät ruoansulatusentsyymit ja niiden tehtävät

  • Amylaasi: pilkkoo sokereita
  • Peptidaasit: pilkkovat proteiineja
  • Lipaasit: pilkkovat rasvahappoja
  • Nukleaasit: pilkkovat nukleiinihappoja (DNA ja RNA)

Insuliini ja glukagoni säätelevät sokeriaineenvaihduntaa

Haiman umpirauhasosa tuottaa elintärkeitä hormoneja: insuliinia ja glukagonia. Useimmista kehon umpirauhasista poiketen glukagonin ja insuliinin eritystä säätelee veressä olevan sokerin määrä eikä aivojen hypotalamus.

Jos veren sokeripitoisuus on matala, haiman Alfa-solut erittävät glukagonia, joka nostaa verensokeria purkamalla maksaan ja lihaksiin varastoituneita glykogeenejä.

Jos veren sokeripitoisuus on korkea, haiman Beta-solut erittävät insuliinia, joka kiinnittyessään solun insuliinireseptoriin, päästää sokerimolekyylin solun sisälle, jossa se osallistuu energiantuotantoon glykolyysissa ja mahdollisesti edelleen mitokondrion soluhengityksessä.

Glukagoni ja glykogeenit

Keho varastoi osan ravinnosta saaduista sokereista maksa- ja lihassoluihin glykogeeneinä, joista energia on nopeasti purettavissa energiaa tuottavan glykolyysin ja soluhengityksen tarvitsemiksi lyhytketjuisiksi sokereiksi.

Kun haiman erittämä glukagoni kiinnittyy maksa- tai lihassolun pinnalla olevaan reseptoriinsa, sokerin pitkäketjuiset varastomolekyylit eli glykogeenit alkavat hajota solussa lyhytketjuisemmiksi sokereiksi. Glykogeeneistä puretut sokerit kulkeutuvat maksasta verenkiertoon, jolloin verensokeri nousee.

Glukagonin purkaa glykogeenejä ja käynnistää glukoneogeneesin

Verensokerin lasku lisää glukagonin eritystä haimasta. Glukagoni purkaa maksa- ja lihassolujen sokerivarastoja, jolloin verensokeri jälleen nousee.

Glukagoni käynnistää myös maksassa ja munuaisten kuorikerroksessa tapahtuvan glukoneogeneesin, joka syntetisoi glukoosia muista yhdisteistä. Glukoneogeneesin yhteydessä maksassa ja munuaisissa alkaa syntyä ketoaineita.

Insuliinin merkitys glukoosin aineenvaihdunnalle

Kaikkien solujen pinnalla on insuliinireseptoreita. Insuliinin kiinnittyminen solureseptoriinsa laukaisee solun sisällä toisiolähettijärjestelmän. Tämä saa aikaan sen, että solun sisällä olevat transmembraanisia (kalvon läpi ulottuvia) sokerikanavaproteiineja kuljettavat kalvorakkulat kiinnittyvät solukelmuun.

Insuliini saa siis sokerikanavat siirtymään solun ulkopinnalle jolloin glukoosi pääsee siirtymään verestä sokerikanavan läpi solun sisälle.

Mutta on hyvä muistaa, että insuliini myös varastoi ylimääräiset glukoosimolekyylit rasvakudoksen, maksan ja maitorauhasten rasvasoluihin eli adiposyytteihin, joissa sokerit muutetaan lipogeneesissä rasvahapoiksi. Näin veren runsas insuliini- ja glukoosipitoisuus aiheuttavat lihomista.

Glykolyysi

Solu saa energiantuotantoon tarvitsemansa glukoosin joko solun ulkopuolelta tai lihassolun sisällä olevasta glykogeenistä.

Glykolyysi on monesta reaktiovaiheesta muodostuva reaktioketju. Solulimassa tapahtuvassa glykolyysissä glukoosi hajotetaan palorypälehapon anionimuodoksi eli pyruvaatiksi. Anaerobinen energiansaanti perustuu glykolyysiin, joka tuottaa kaksi ATP-molekyyliä ja kaksi NADH-molekyyliä.

Jos solulla on happea käytettävissään, energiantuotanto jatkuu soluhengityksessä mitokondrioissa. Pyruvaateista saadaan mitokondrioissa eräiden entsyymien avulla tapahtuvassa oksidatiivisessa dekarboksylaatiossa asetyylikoentsyymi-A:ta.

Jos solulta puuttuu mitokondriot (kuten veren punasoluilta) tai happea ei ole käytettävissä, pyruvaatti pelkistyy maitohapoksi.

  • Anaerobinen glykolyysi päättyy pyruvaatin pelkistyessä maitohapoksi
  • Aerobinen glykolyysi jatkaa energiantuotantoa ja tuottaa pyruvaatista edelleen asetyylikoentsyymi-A:ta.

Sokerikanavaproteiinit kiertävät jatkuvasti soluliman ja solukelmun välillä. Kun insuliinipitoisuus laskee veressä, solu imee sokerikanavia sisältävät solukelmun osat sisäänsä.

Ihminen voi kuluttaa vuorokauden aikana painonsa verran ATP-molekyylejä.

ATP eli Adenosiinitrifosfaatti on runsasenerginen mitokondrioiden soluhengityksessä, tai glykolyysin solulimassa tuottama yhdiste. ATP:tä käytetään energian siirtoon ja lyhytaikaiseen varastointiin lihaksissa.

Kun elimistön solut tarvitsevat ATP-molekyyleihin sitoutunutta energiaa, ATPaasi-entsyymi pilkkoo runsasenergisiä sidoksia fosfaattiryhmien väliltä.

ATP:ssä on emäsoasa (adeniini), sokeriosa (riboosi) ja 3 fosfaattiosaa. Kun ATP:stä irtoaa yksi fosfaattiosa, siitä tulee adenosiinidifosfaattia eli ADP:tä ja kun ADP:stä irtoaa fosfaattiosa, syntyy adenosiinimonofosfaatti eli AMP.

Ihminen kuluttaa vuorokauden aikana arviolta painonsa verran ATP-molekyylejä. Yksi ATP-molekyyli kierrätetään jopa 1000-1500 kertaa vuorokauden aikana.

ATP on lihassupistuksen ainoa energianlähde. Sitä on hieman varastoituneena lihaksissa, mutta nämä varastot hyödynnetään nopeasti.

Energian varastomolekyyli: ADP+ADP à ATP+AMP

Kuinka ketogeneesin aineenvaihdunta toimii

Paasto, intensiivinen liikunta tai vähähiilihydraattinen ruokavalio saa aineenvaihdunnan tuottamaan ketoaineita energianlähteeksi. Muutaman päivän vähähiilihydraattinen jakso siirtää aineenvaihdunnan ketoosiin, jolloin ketoaineiden käyttö energianlähteenä tehostuu. Ketoaineiden tuotanto käynnistyy aina, kun veren insuliinipitoisuus laskee.

Haima erittää insuliinia verensokerin eli glukoosipitoisuuden kohotessa. Kun veressä ei ole glukoosia energianlähteenä, aineenvaihdunta ryhtyy hyödyntämään ketoaineita energianlähteenä ja ”polttamaan” rasvoja.

Rasvahappojen hapetus = β-oksidaatio

β–oksidaatiossa rasvahappojen käyttö energiantuotantoon alkaa siten, että rasvat hajotetaan rasvahapoiksi ja glyseroliksi.

Glyseroli hapetetaan solulimassa glyseraldehydi-3-fosfaatiksi ja se voidaan käyttää joko energiantuotantoon (n. 5 % triglyseridistä saatavasta energiasta) tai glukoosin tuottamiseen glukoneogeneesissä.

Rasvahapot hapetetaan mitokondrioissa β–oksidaatiossa. Aluksi rasvahapot aktivoidaan mitokondrion ulkokalvolla kiinnittämällä rasvahapon karboksyyliryhmään koentsyymi-A. Näin muodostunut asyyli-KoA kulkee mitokondrion sisäkalvon läpi aktiivisella kuljetuksella. Näin siksi, että soluliman ja mitokondrion asyyli-KoA:lla on eri tehtävät – solulimassa anabolia, mitokondriossa katabolia.

Mitokondrion matriksissa rasvahappo hajotetaan kaksihiilisiksi pätkiksi (asetyyli-KoA), joka edelleen hapetetaan sitruunahappokierrossa.

Lähteet:

Scientific American

KetoSchool

CNN

Wikipedia – Ketoasidoosi

Wikipedia – Glykolyysi

Wikipedia – Ketoaine

Wikipedia – Ketogeneesi

Wikipedia – Glukoneogeneesi

Solunetti – Solun aineenvaihdunta

Solun aineenvaihdunta – Nina Peitsaro

Safkatutka

Laihdutus.info